Contact Molecules for Homologous Proteins | ||||
[Full Bars] |
[SiteTable] |
|
[Back to Search Page] |
[Back to HOMCOS] |
[SupCon3D] |
[help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
2752856 | 925 | 83 | O95786(RIGI_HUMAN) | RecName: Full=Antiviral innate immune response receptor RIG-I ;AltName: Full=ATP-dependent RNA helicase DDX58 ; EC=3.6.4.13 ;AltName: Full=DEAD box protein 58;AltName: Full=RIG-I-like receptor 1; Short=RLR-1;AltName: Full=RNA sensor RIG-I ;AltName: Full=Retinoic acid-inducible gene 1 protein; Short=RIG-1;AltName: Full=Retinoic acid-inducible gene I protein; Short=RIG-I; |
QUERYSEQ |
MTTEQRRSLQAFQDYIRKTLDPTYILSYMAPWFREEEVQYIQAEKNNKGPMEAATLFLKFLLELQEEGWFRGFLDALDHAGYSGLYEAIESWDFKKIEKLEEYRLLLKRLQPEFKTRIIPTDIISDLSECLINQECEEILQICSTKGMMA GAEKLVECLLRSDKENWPKTLKLALEKERNKFSELWIVEKGIKDVETEDLEDKMETSDIQIFYQEDPECQNLSENSCPPSEVSDTNLYSPFKPRNYQLELALPAMKGKNTIICAPTGCGKTFVSLLICEHHLKKFPQGQKGKVVFFANQI PVYEQQKSVFSKYFERHGYRVTGISGATAENVPVEQIVENNDIIILTPQILVNNLKKGTIPSLSIFTLMIFDECHNTSKQHPYNMIMFNYLDQKLGGSSGPLPQVIGLTASVGVGDAKNTDEALDYICKLCASLDASVIATVKHNLEELE QVVYKPQKFFRKVESRISDKFKYIIAQLMRDTESLAKRICKDLENLSQIQNREFGTQKYEQWIVTVQKACMVFQMPDKDEESRICKALFLYTSHLRKYNDALIISEHARMKDALDYLKDFFSNVRAAGFDEIEQDLTQRFEEKLQELESV SRDPSNENPKLEDLCFILQEEYHLNPETITILFVKTRALVDALKNWIEGNPKLSFLKPGILTGRGKTNQNTGMTLPAQKCILDAFKASGDHNILIATSVADEGIDIAQCNLVILYEYVGNVIKMIQTRGRGRARGSKCFLLTSNAGVIEK EQINMYKEKMMNDSILRLQTWDEAVFREKILHIQTHEKFIRDSQEKPKPVPDKENKKLLCRKCKALACYTADVRVIEECHYTVLGDAFKECFVSRPHPKPKQFSSFEKRAKIFCARQNCSHDWGIHVKYKTFEIPVIKIESFVVEDIATG VQTLYSKWKDFHFEKIPFDPAEMSK |
925 | region | name | description |
1-925 | CHAIN | /note="Antiviral innate immune response receptor RIG-I" /id="PRO_0000144093" | |
1-87 | DOMAIN | /note="CARD 1" | |
92-172 | DOMAIN | /note="CARD 2" | |
251-430 | DOMAIN | /note="Helicase ATP-binding" | |
610-776 | DOMAIN | /note="Helicase C-terminal" | |
794-925 | DOMAIN | /note="RLR CTR" | |
218-925 | REGION | /note="Interaction with ZC3HAV1" | |
735-925 | REGION | /note="Mediates interaction with RNF135" | |
264-271 | BINDING | /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" | |
810-810 | BINDING | /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" | |
813-813 | BINDING | /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" | |
864-864 | BINDING | /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" | |
869-869 | BINDING | /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" | |
1-925 | DISORDER | predicted by DISOPRED |
MONOMER | |||||||
925 | |||||||
pdb_id | a1 | identity[%]2 | description | ||||
8dvs | A | 100.0 | DDX58_HUMAN Antiviral innate immune response receptor RIG-I | ||||
4nqk | D | 100.0 | DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58 | ||||
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue. |
HETERO | |||||||
925 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
4nqk[3] | E | UBC_HUMAN Ubiquitin[72 aa] | A | 100.0 /100.0 |
5 /5 |
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58 | |
4nqk[4] | J | UBC_HUMAN Ubiquitin[73 aa] | A | 100.0 /100.0 |
9 /9 |
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58 | |
4nqk[3] | F | UBC_HUMAN Ubiquitin[73 aa] | B | 100.0 /100.0 |
11 /11 |
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58 | |
7jl1[4] | D | RN135_HUMAN E3 ubiquitin-protein ligase RNF135[171 aa] | A | 100.0 /100.0 |
10 /10 |
DDX58_HUMAN Antiviral innate immune response receptor RIG-I | |
7jl3[2] | D | RN135_HUMAN E3 ubiquitin-protein ligase RNF135[169 aa] | A | 100.0 /100.0 |
1 /1 |
DDX58_HUMAN Antiviral innate immune response receptor RIG-I | |
8g7t[6] | B | RN135_HUMAN E3 ubiquitin-protein ligase RNF135[178 aa] | A | 100.0 /100.0 |
13 /13 |
DDX58_HUMAN Antiviral innate immune response receptor RIG-I | |
8g7v[1] | B | RN135_HUMAN E3 ubiquitin-protein ligase RNF135[178 aa] | C | 100.0 /100.0 |
1 /1 |
DDX58_HUMAN Antiviral innate immune response receptor RIG-I | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
NUCLEOTIDE | |||||||
925 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
3ncu[2] | C | 5'-R(*(GDP)P*AP*CP*GP*CP*UP*AP*GP*CP*GP*UP*C)-3' | A | 100.0 /100.0 |
13 /13 |
DDX58_HUMAN RIG-I | |
3ncu[2] | D | 5'-R(*(GDP)P*AP*CP*GP*CP*UP*AP*GP*CP*GP*UP*C)-3' | A | 100.0 /100.0 |
4 /4 |
DDX58_HUMAN RIG-I | |
7bai[4] | C | RNA (5'-R(*(GDP)P*AP*CP*GP*CP*UP*AP*GP*CP*GP*UP*C).. | A | 100.0 /100.0 |
11 /11 |
DDX58_HUMAN Antiviral innate immune response receptor RIG-I | |
7bai[4] | D | RNA (5'-R(*(GDP)P*AP*CP*GP*CP*UP*AP*GP*CP*GP*UP*C).. | A | 100.0 /100.0 |
3 /3 |
DDX58_HUMAN Antiviral innate immune response receptor RIG-I | |
5e3h[1] | B | RNA (5'-R(*CP*GP*AP*CP*GP*CP*UP*AP*GP*CP*GP*U)-3').. | A | 100.0 /100.0 |
18 /18 |
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58 | |
5e3h[1] | C | RNA (5'-R(*CP*GP*AP*CP*GP*CP*UP*AP*GP*CP*GP*U)-3').. | A | 100.0 /100.0 |
27 /27 |
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58 | |
5f98[12] | B | RNA (5'-R(P*GP*AP*AP*UP*AP*UP*AP*AP*UP*AP*GP*UP*GP.. | A | 100.0 /100.0 |
40 /40 |
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58 | |
5f9h[6] | B | RNA (5'-R(P*AP*AP*UP*AP*UP*AP*AP*UP*AP*GP*UP*GP*AP.. | A | 100.0 /100.0 |
37 /37 |
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58 | |
6kyv[6] | A | RNA (5'-R(*GP*GP*UP*AP*GP*AP*CP*GP*CP*UP*UP*CP*GP*.. | B | 100.0 /100.0 |
46 /46 |
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58 | |
7bah[2] | C | RNA (5'-R(*GP*AP*CP*GP*CP*UP*AP*GP*CP*GP*UP*C)-3').. | A | 100.0 /100.0 |
11 /11 |
DDX58_HUMAN Antiviral innate immune response receptor RIG-I | |
7bah[2] | D | RNA (5'-R(*GP*AP*CP*GP*CP*UP*AP*GP*CP*GP*UP*C)-3').. | A | 100.0 /100.0 |
3 /3 |
DDX58_HUMAN Antiviral innate immune response receptor RIG-I | |
7jl1[1] | B | dsRNA strand 1 | A | 100.0 /100.0 |
17 /17 |
DDX58_HUMAN Antiviral innate immune response receptor RIG-I | |
7jl1[1] | C | dsRNA strand 2 | A | 100.0 /100.0 |
27 /27 |
DDX58_HUMAN Antiviral innate immune response receptor RIG-I | |
7jl3[3] | G | dsRNA strand1 | A | 100.0 /100.0 |
14 /14 |
DDX58_HUMAN Antiviral innate immune response receptor RIG-I | |
7jl3[3] | H | dsRNA strand 2 | A | 100.0 /100.0 |
24 /24 |
DDX58_HUMAN Antiviral innate immune response receptor RIG-I | |
7mk1[2] | C | DNA (41-MER) | A | 100.0 /100.0 |
17 /17 |
DDX58_HUMAN Antiviral innate immune response receptor RIG-I | |
7tnx[1] | B | p3dsRNAa | A | 100.0 /100.0 |
24 /24 |
DDX58_HUMAN Antiviral innate immune response receptor RIG-I | |
7tnx[1] | C | p3dsRNAb | A | 100.0 /100.0 |
21 /21 |
DDX58_HUMAN Antiviral innate immune response receptor RIG-I | |
7tny[2] | B | p2dsRNA | A | 100.0 /100.0 |
26 /26 |
DDX58_HUMAN Antiviral innate immune response receptor RIG-I | |
7tny[2] | C | p2dsRNA | A | 100.0 /100.0 |
29 /29 |
DDX58_HUMAN Antiviral innate immune response receptor RIG-I | |
7to0[1] | B | OHdsRNA | A | 100.0 /100.0 |
27 /27 |
DDX58_HUMAN Antiviral innate immune response receptor RIG-I | |
7to0[1] | C | OHdsRNA | A | 100.0 /100.0 |
28 /28 |
DDX58_HUMAN Antiviral innate immune response receptor RIG-I | |
7to1[1] | B | p3SLR30 | A | 100.0 /100.0 |
41 /41 |
DDX58_HUMAN Antiviral innate immune response receptor RIG-I | |
7to2[1] | B | p3SLR30 | A | 100.0 /100.0 |
57 /57 |
DDX58_HUMAN Antiviral innate immune response receptor RIG-I | |
8dvr[1] | B | p3SLR30 | A | 100.0 /100.0 |
33 /33 |
DDX58_HUMAN Antiviral innate immune response receptor RIG-I | |
8dvs[1] | B | OHSLR30 | A | 100.0 /100.0 |
48 /48 |
DDX58_HUMAN Antiviral innate immune response receptor RIG-I | |
8dvu[1] | B | OHSLR30 | A | 100.0 /100.0 |
55 /55 |
DDX58_HUMAN Antiviral innate immune response receptor RIG-I | |
8g7t[2] | E | p3dsRNA24a | A | 100.0 /100.0 |
22 /22 |
DDX58_HUMAN Antiviral innate immune response receptor RIG-I | |
8g7t[2] | E | p3dsRNA24a | C | 100.0 /100.0 |
21 /21 |
DDX58_HUMAN Antiviral innate immune response receptor RIG-I | |
8g7t[2] | F | p3dsRNA24b | A | 100.0 /100.0 |
24 /24 |
DDX58_HUMAN Antiviral innate immune response receptor RIG-I | |
8g7t[2] | F | p3dsRNA24b | C | 100.0 /100.0 |
16 /16 |
DDX58_HUMAN Antiviral innate immune response receptor RIG-I | |
8g7v[2] | E | p3dsRNA24a | A | 100.0 /100.0 |
21 /21 |
DDX58_HUMAN Antiviral innate immune response receptor RIG-I | |
8g7v[2] | F | p3dsRNA24b | A | 100.0 /100.0 |
19 /19 |
DDX58_HUMAN Antiviral innate immune response receptor RIG-I | |
8scz[1] | B | p3SLR30 | A | 100.0 /100.0 |
42 /42 |
RIGI_HUMAN Antiviral innate immune response receptor RIG-I | |
8sd0[1] | B | p3SLR14 | A | 100.0 /100.0 |
39 /39 |
DDX58_HUMAN Antiviral innate immune response receptor RIG-I | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
COMPOUND | |||||||
925 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
5e3h[1] | I |
ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms] |
A | 100.0 /100.0 |
13 /13 |
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58 | |
7jl1[4] | E |
ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms] |
A | 100.0 /100.0 |
10 /10 |
DDX58_HUMAN Antiviral innate immune response receptor RIG-I | |
7to2[3] | E |
ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms] |
A | 100.0 /100.0 |
12 /12 |
DDX58_HUMAN Antiviral innate immune response receptor RIG-I | |
5f98[6] | O |
M7G
7N-METHYL-8-HYDROGUANOSINE-5'-DIPHOSPHATE[29 atoms.. |
A | 100.0 /100.0 |
7 /7 |
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58 | |
5f9h[6] | Q |
GTP
GUANOSINE-5'-TRIPHOSPHATE[32 atoms] |
A | 100.0 /100.0 |
10 /10 |
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58 | |
8dvr[1] | D |
GTP
GUANOSINE-5'-TRIPHOSPHATE[32 atoms] |
A | 100.0 /100.0 |
10 /10 |
DDX58_HUMAN Antiviral innate immune response receptor RIG-I | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
METAL | |||||||
925 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
2qfb[10] | K |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58 | |
3ncu[2] | E |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
DDX58_HUMAN RIG-I | |
5e3h[19] | D |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58 | |
6kyv[6] | M |
ZN
ZINC ION[1 atoms] |
B | 100.0 /100.0 |
4 /4 |
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58 | |
7bah[10] | E |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
DDX58_HUMAN Antiviral innate immune response receptor RIG-I | |
7jl1[4] | H |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
DDX58_HUMAN Antiviral innate immune response receptor RIG-I | |
7mk1[2] | E |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
DDX58_HUMAN Antiviral innate immune response receptor RIG-I | |
7tnx[16] | D |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
DDX58_HUMAN Antiviral innate immune response receptor RIG-I | |
8scz[1] | C |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
RIGI_HUMAN Antiviral innate immune response receptor RIG-I | |
2qfd[10] | K |
HG
MERCURY (II) ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58 | |
4on9[1] | G |
CL
CHLORIDE ION[1 atoms] |
B | 100.0 /100.0 |
2 /2 |
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58 | |
5e3h[5] | E |
MG
MAGNESIUM ION[1 atoms] |
A | 100.0 /100.0 |
2 /2 |
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58 | |
5e3h[1] | F |
MG
MAGNESIUM ION[1 atoms] |
A | 100.0 /100.0 |
1 /1 |
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58 | |
5e3h[2] | G |
MG
MAGNESIUM ION[1 atoms] |
A | 100.0 /100.0 |
2 /2 |
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58 | |
5f98[6] | N |
MG
MAGNESIUM ION[1 atoms] |
A | 100.0 /100.0 |
2 /2 |
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58 | |
5f9f[4] | N |
MG
MAGNESIUM ION[1 atoms] |
A | 100.0 /100.0 |
1 /1 |
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58 | |
5f9h[2] | N |
MG
MAGNESIUM ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58 | |
5f9h[1] | O |
MG
MAGNESIUM ION[1 atoms] |
A | 100.0 /100.0 |
2 /2 |
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58 | |
5f9h[1] | P |
MG
MAGNESIUM ION[1 atoms] |
A | 100.0 /100.0 |
1 /1 |
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58 | |
5f9h[1] | U |
MG
MAGNESIUM ION[1 atoms] |
E | 100.0 /100.0 |
1 /1 |
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58 | |
5f9h[1] | X |
MG
MAGNESIUM ION[1 atoms] |
G | 100.0 /100.0 |
2 /2 |
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58 | |
7jl3[3] | K |
MG
MAGNESIUM ION[1 atoms] |
A | 100.0 /100.0 |
1 /1 |
DDX58_HUMAN Antiviral innate immune response receptor RIG-I | |
7mk1[2] | F |
MG
MAGNESIUM ION[1 atoms] |
A | 100.0 /100.0 |
1 /1 |
DDX58_HUMAN Antiviral innate immune response receptor RIG-I | |
7to2[3] | D |
MG
MAGNESIUM ION[1 atoms] |
A | 100.0 /100.0 |
2 /2 |
DDX58_HUMAN Antiviral innate immune response receptor RIG-I | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
HOMO | |||||||
925 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
4nqk[4] | B | DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58[188 aa] | A | 100.0 /100.0 |
21 /21 |
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58 | |
4nqk[4] | D | DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58[188 aa] | A | 100.0 /100.0 |
12 /12 |
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58 | |
4on9[2] | B | DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58[495 aa] | A | 100.0 /100.0 |
40 /40 |
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58 | |
5f98[18] | C | DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58[648 aa] | A | 100.0 /100.0 |
20 /20 |
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58 | |
5f98[6] | E | DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58[641 aa] | A | 100.0 /100.0 |
26 /26 |
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58 | |
5f98[6] | G | DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58[647 aa] | A | 100.0 /100.0 |
1 /1 |
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58 | |
5f98[6] | K | DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58[644 aa] | A | 100.0 /100.0 |
3 /3 |
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58 | |
5f98[6] | G | DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58[647 aa] | C | 100.0 /100.0 |
11 /11 |
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58 | |
5f98[6] | K | DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58[644 aa] | C | 100.0 /100.0 |
3 /3 |
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58 | |
7jl3[2] | C | DDX58_HUMAN Antiviral innate immune response receptor RIG-I[65.. | A | 100.0 /100.0 |
7 /7 |
DDX58_HUMAN Antiviral innate immune response receptor RIG-I | |
7jl3[2] | E | DDX58_HUMAN Antiviral innate immune response receptor RIG-I[65.. | A | 100.0 /100.0 |
6 /6 |
DDX58_HUMAN Antiviral innate immune response receptor RIG-I | |
8g7t[4] | C | DDX58_HUMAN Antiviral innate immune response receptor RIG-I[61.. | A | 100.0 /100.0 |
10 /10 |
DDX58_HUMAN Antiviral innate immune response receptor RIG-I | |
8g7u[1] | A | DDX58_HUMAN Antiviral innate immune response receptor RIG-I[64.. | C | 100.0 /100.0 |
10 /10 |
DDX58_HUMAN Antiviral innate immune response receptor RIG-I | |
8g7v[1] | A | DDX58_HUMAN Antiviral innate immune response receptor RIG-I[64.. | C | 100.0 /100.0 |
9 /9 |
DDX58_HUMAN Antiviral innate immune response receptor RIG-I | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
PRECIPITANT | |||||||
925 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
4on9[2] | C |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /100.0 |
7 /7 |
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58 | |
4on9[2] | D |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /100.0 |
4 /4 |
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58 | |
4on9[2] | E |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /100.0 |
1 /1 |
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58 | |
5e3h[1] | H |
GOL
GLYCEROL[6 atoms] |
A | 100.0 /100.0 |
5 /5 |
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58 | |
5e3h[1] | J |
BEF
BERYLLIUM TRIFLUORIDE ION[4 atoms] |
A | 100.0 /100.0 |
5 /5 |
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58 | |
5f9f[1] | O |
ETF
TRIFLUOROETHANOL[6 atoms] |
A | 100.0 /100.0 |
9 /9 |
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58 | |
5f9f[1] | Y |
ETF
TRIFLUOROETHANOL[6 atoms] |
E | 100.0 /100.0 |
5 /5 |
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58 | |
5f9f[2] | CA |
ETF
TRIFLUOROETHANOL[6 atoms] |
G | 100.0 /100.0 |
5 /5 |
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58 | |
5f9f[1] | NA |
ETF
TRIFLUOROETHANOL[6 atoms] |
K | 100.0 /100.0 |
6 /6 |
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58 | |
5f9f[1] | P |
BU3
(R,R)-2,3-BUTANEDIOL[6 atoms] |
A | 100.0 /100.0 |
7 /7 |
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58 | |
5f9f[1] | Q |
BU3
(R,R)-2,3-BUTANEDIOL[6 atoms] |
A | 100.0 /100.0 |
5 /5 |
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58 | |
5f9f[2] | U |
BU3
(R,R)-2,3-BUTANEDIOL[6 atoms] |
A | 100.0 /100.0 |
5 /5 |
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58 | |
5f9f[1] | T |
BU3
(R,R)-2,3-BUTANEDIOL[6 atoms] |
C | 100.0 /100.0 |
4 /4 |
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58 | |
5f9f[1] | V |
BU3
(R,R)-2,3-BUTANEDIOL[6 atoms] |
C | 100.0 /100.0 |
4 /4 |
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58 | |
5f9f[5] | W |
BU3
(R,R)-2,3-BUTANEDIOL[6 atoms] |
C | 100.0 /100.0 |
8 /8 |
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58 | |
5f9f[2] | AA |
BU3
(R,R)-2,3-BUTANEDIOL[6 atoms] |
E | 100.0 /100.0 |
9 /9 |
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58 | |
5f9f[1] | EA |
BU3
(R,R)-2,3-BUTANEDIOL[6 atoms] |
G | 100.0 /100.0 |
5 /5 |
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58 | |
7jl1[4] | F |
ALF
TETRAFLUOROALUMINATE ION[5 atoms] |
A | 100.0 /100.0 |
5 /5 |
DDX58_HUMAN Antiviral innate immune response receptor RIG-I | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. |