HOMCOS(prot_sch_conbars.cgi):

		Contact Molecules for Homologous Proteins
[Full Bars]	[SiteTable]	Summary Bars[0.0 %]	[Back to Search Page]	[Back to HOMCOS]
	[help]	seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]	[show] [download] [help]

PID

QueryLength

Homolgous Sequence in PDB

UniProt Query

TITLE

1702314

1817

207

P52948(NUP98_HUMAN)

RecName: Full=Nuclear pore complex protein Nup98-Nup96 ; EC=3.4.21.- ;Contains: RecName: Full=Nuclear pore complex protein Nup98; AltName: Full=98 kDa nucleoporin; AltName: Full=Nucleoporin Nup98; Short=Nup98;Contains: RecName: Full=Nuclear pore complex protein Nup96; AltName: Full=96 kDa nucleoporin; AltName: Full=Nucleoporin Nup96; Short=Nup96;Flags: Precursor;

QUERYSEQ

MFNKSFGTPFGGGTGGFGTTSTFGQNTGFGTTSGGAFGTSAFGSSNNTGGLFGNSQTKPGGLFGTSSFSQPATSTSTGFGFGTSTGTANTLFGTASTGTSLFSSQNNAFAQNKPTGFGNFGTSTSSGGLFGTTNTTSNPFGSTSGSLFGP
SSFTAAPTGTTIKFNPPTGTDTMVKAGVSTNISTKHQCITAMKEYESKSLEELRLEDYQANRKGPQNQVGAGTTTGLFGSSPATSSATGLFSSSTTNSGFAYGQNKTAFGTSTTGFGTNPGGLFGQQNQQTTSLFSKPFGQATTTQNTGF
SFGNTSTIGQPSTNTMGLFGVTQASQPGGLFGTATNTSTGTAFGTGTGLFGQTNTGFGAVGSTLFGNNKLTTFGSSTTSAPSFGTTSGGLFGNKPTLTLGTNTNTSNFGFGTNTSGNSIFGSKPAPGTLGTGLGAGFGTALGAGQASLFG
NNQPKIGGPLGTGAFGAPGFNTTTATLGFGAPQAPVALTDPNASAAQQAVLQQHINSLTYSPFGDSPLFRNPMSDPKKKEERLKPTNPAAQKALTTPTHYKLTPRPATRVRPKALQTTGTAKSHLFDGLDDDEPSLANGAFMPKKSIKKL
VLKNLNNSNLFSPVNRDSENLASPSEYPENGERFSFLSKPVDENHQQDGDEDSLVSHFYTNPIAKPIPQTPESAGNKHSNSNSVDDTIVALNMRAALRNGLEGSSEETSFHDESLQDDREEIENNSYHMHPAGIILTKVGYYTIPSMDDL
AKITNEKGECIVSDFTIGRKGYGSIYFEGDVNLTNLNLDDIVHIRRKEVVVYLDDNQKPPVGEGLNRKAEVTLDGVWPTDKTSRCLIKSPDRLADINYEGRLEAVSRKQGAQFKEYRPETGSWVFKVSHFSKYGLQDSDEEEEEHPSKTS
TKKLKTAPLPPASQTTPLQMALNGKPAPPPQSQSPEVEQLGRVVELDSDMVDITQEPVLDTMLEESMPEDQEPVSASTHIASSLGINPHVLQIMKASLLTDEEDVDMALDQRFSRLPSKADTSQEICSPRLPISASHSSKTRSLVGGLLQ
SKFTSGAFLSPSVSVQECRTPRAASLMNIPSTSSWSVPPPLTSVFTMPSPAPEVPLKTVGTRRQLGLVPREKSVTYGKGKLLMDMALFMGRSFRVGWGPNWTLANSGEQLNGSHELENHQIADSMEFGFLPNPVAVKPLTESPFKVHLEK
LSLRQRKPDEDMKLYQTPLELKLKHSTVHVDELCPLIVPNLGVAVIHDYADWVKEASGDLPEAQIVKHWSLTWTLCEALWGHLKELDSQLNEPREYIQILERRRAFSRWLSCTATPQIEEEVSLTQKNSPVEAVFSYLTGKRISEACSLA
QQSGDHRLALLLSQFVGSQSVRELLTMQLVDWHQLQADSFIQDERLRIFALLAGKPVWQLSEKKQINVCSQLDWKRSLAIHLWYLLPPTASISRALSMYEEAFQNTSDSDRYACSPLPSYLEGSGCVIAEEQNSQTPLRDVCFHLLKLYS
DRHYDLNQLLEPRSITADPLDYRLSWHLWEVLRALNYTHLSAQCEGVLQASYAGQLESEGLWEWAIFVLLHIDNSGIREKAVRELLTRHCQLLETPESWAKETFLTQKLRVPAKWIHEAKAVRAHMESDKHLEALCLFKAEHWNRCHKLI
IRHLASDAIINENYDYLKGFLEDLAPPERSSLIQDWETSGLVYLDYIRVIEMLRHIQQVDCSGNDLEQLHIKVTSLCSRIEQIQCYSAKDRLAQSDMAKRVANLLRVVLSLHHPPDRTSDSTPDPQRVPLRLLAPHIGRLPMPEDYAMDE
LRSLTQSYLRELAVGSL

[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [P52948(NUP98_HUMAN)]

1817
	region	name	description
	1-880	CHAIN	/note="Nuclear pore complex protein Nup98" /id="PRO_0000019929"
	881-1817	CHAIN	/note="Nuclear pore complex protein Nup96" /id="PRO_0000019930"
	738-880	DOMAIN	/note="Peptidase S59"
	1-156	REGION	/note="FG repeats 1"
	157-213	REGION	/note="GLEBS; interaction with RAE1"
	214-480	REGION	/note="FG repeats 2"
	512-535	REGION	/note="Disordered"
	614-633	REGION	/note="Disordered"
	662-682	REGION	/note="Disordered"
	886-937	REGION	/note="Disordered"
	886-901	COMPBIAS	/note="Basic and acidic residues"
	902-921	COMPBIAS	/note="Polar residues"
	881-881	ACT_SITE	/note="Nucleophile" ECO:0000269\|PubMed:18287282"
	1-1817	DISORDER	predicted by DISOPRED

MONOMER

1817

pdb_id a¹ identity[%]² description

7r5j KB 100.0 NUP98_HUMAN Nuclear pore complex protein Nup96

6lk8 G 62.2 A0A1L8HBE3_XENLA Nuclear pore complex protein Nup96

2q5y A 100.0 NUP98_HUMAN Nuclear pore complex protein Nup98

7byf F 100.0 Q3TPG3_MOUSE Peptidase S59 domain-containing protein

7q64 N 100.0 NUP98_HUMAN Nuclear pore complex protein Nup98

1.a¹:asym_id for the homologue. 2.identity[%]²:sequence identity between the query and the homologue.

HETERO

1817 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

1ko6[2] B NU98_HUMAN Nuclear Pore Complex Protein Nup98[6 aa] A 100.0
/100.0 11
/11 NUP98_HUMAN Nuclear Pore Complex Protein Nup98

1ko6[1] B NU98_HUMAN Nuclear Pore Complex Protein Nup98[6 aa] C 100.0
/100.0 1
/1 NUP98_HUMAN Nuclear Pore Complex Protein Nup98

2q5y[2] B NUP98_HUMAN Nuclear pore complex protein Nup96[3 aa] A 100.0
/100.0 11
/11 NUP98_HUMAN Nuclear pore complex protein Nup98

3bg0[8] A SEC13_HUMAN Protein SEC13 homolog[283 aa] B 22.2
/26.4 9
/39 NU145_YEAST Nucleoporin NUP145

3bg0[4] E SEC13_HUMAN Protein SEC13 homolog[283 aa] B 0.0
/26.4 2
/2 NU145_YEAST Nucleoporin NUP145

5a9q[32] G SEC13_HUMAN PROTEIN SEC13 HOMOLOG[285 aa] F 100.0
/100.0 8
/8 NUP98_HUMAN NUCLEAR PORE COMPLEX PROTEIN NUP96

7peq[32] D SEC13_HUMAN Protein SEC13 homolog[285 aa] C 100.0
/100.0 13
/13 NUP98_HUMAN Nuclear pore complex protein Nup96

7r5j[64] OB SEC13_HUMAN Protein SEC13 homolog[301 aa] KB 100.0
/100.0 59
/59 NUP98_HUMAN Nuclear pore complex protein Nup96

3mmy[15] A RAE1L_HUMAN mRNA export factor[354 aa] B 100.0
/100.0 29
/29 NUP98_HUMAN Nuclear pore complex protein Nup98

7f60[4] B RAE1L_HUMAN mRNA export factor[330 aa] C 100.0
/100.0 25
/25 NUP98_HUMAN Nuclear pore complex protein Nup98-Nup96

4owr[1] C MATRX_VSIVS Matrix protein[176 aa] B 100.0
/100.0 3
/3 NUP98_HUMAN Nuclear pore complex protein Nup98-Nup96

5a9q[32] E NU107_HUMAN NUCLEAR PORE COMPLEX PROTEIN NUP107[660 aa] F 100.0
/100.0 7
/7 NUP98_HUMAN NUCLEAR PORE COMPLEX PROTEIN NUP96

7byf[2] D O41931_MHV68 10 protein[399 aa] B 100.0
/100.0 2
/2 Q3TPG3_MOUSE Peptidase S59 domain-containing protein

7mni[2] A NUP88_HUMAN Nuclear pore complex protein Nup88[409 aa] B 100.0
/100.0 27
/27 NUP98-2_HUMAN Nuclear pore complex protein Nup98

7peq[24] B NU107_HUMAN Nuclear pore complex protein Nup107[678 aa] C 100.0
/100.0 4
/4 NUP98_HUMAN Nuclear pore complex protein Nup96

7peq[8] F NUP85_HUMAN Nuclear pore complex protein Nup85[632 aa] C 100.0
/100.0 1
/1 NUP98_HUMAN Nuclear pore complex protein Nup96

7r5j[32] WB NUP85_HUMAN Nuclear pore complex protein Nup85[655 aa] LB 100.0
/100.0 2
/2 NUP98_HUMAN Nuclear pore complex protein Nup96

7peq[32] H NU160_HUMAN Nuclear pore complex protein Nup160[996 aa] C 100.0
/100.0 32
/32 NUP98_HUMAN Nuclear pore complex protein Nup96

7r5j[24] A RBP2_HUMAN E3 SUMO-protein ligase RanBP2[756 aa] KB 100.0
/100.0 1
/1 NUP98_HUMAN Nuclear pore complex protein Nup96

7r5j[16] C RBP2_HUMAN E3 SUMO-protein ligase RanBP2[756 aa] KB 100.0
/100.0 3
/3 NUP98_HUMAN Nuclear pore complex protein Nup96

7r5j[8] D RBP2_HUMAN E3 SUMO-protein ligase RanBP2[756 aa] LB 100.0
/100.0 5
/5 NUP98_HUMAN Nuclear pore complex protein Nup96

7r5k[8] B RBP2_HUMAN E3 SUMO-protein ligase RanBP2[756 aa] KB 100.0
/100.0 7
/7 NUP98_HUMAN Nuclear pore complex protein Nup96

7r5k[8] D RBP2_HUMAN E3 SUMO-protein ligase RanBP2[756 aa] LB 100.0
/100.0 4
/4 NUP98_HUMAN Nuclear pore complex protein Nup96

7r5j[64] EC NU160_HUMAN Nuclear pore complex protein Nup160[1399 aa] KB 100.0
/100.0 30
/30 NUP98_HUMAN Nuclear pore complex protein Nup96

7r5j[64] GB NU107_HUMAN Nuclear pore complex protein Nup107[782 aa] KB 100.0
/100.0 22
/22 NUP98_HUMAN Nuclear pore complex protein Nup96

7r5j[32] HB NU107_HUMAN Nuclear pore complex protein Nup107[782 aa] KB 100.0
/100.0 4
/4 NUP98_HUMAN Nuclear pore complex protein Nup96

7r5j[24] U NUP93_HUMAN Nuclear pore complex protein Nup93[726 aa] KB 100.0
/100.0 15
/15 NUP98_HUMAN Nuclear pore complex protein Nup96

7r5j[8] V NUP93_HUMAN Nuclear pore complex protein Nup93[726 aa] MB 100.0
/100.0 4
/4 NUP98_HUMAN Nuclear pore complex protein Nup96

7vpg[2] K NS6_SARS ORF6 protein[10 aa] F 100.0
/100.0 1
/1 NUP98_HUMAN Isoform 3 of Nuclear pore complex protein Nup98-Nu..

7vph[1] L NS6_SARS2 ORF6 protein[9 aa] B 100.0
/100.0 1
/1 NUP98_HUMAN Isoform 3 of Nuclear pore complex protein Nup98-Nu..

3pbp[4] A NUP82_YEAST Nucleoporin NUP82[438 aa] B 35.0
/30.4 20
/22 NU116_YEAST Nucleoporin NUP116/NSP116

3tkn[3] A NUP82_YEAST Nucleoporin NUP82[451 aa] C 95.2
/98.0 21
/21 Q6PFD9_MOUSE Nucleoporin 98

7now[2] A Anti-Nup98 nanobody MS98-27[129 aa] B 88.9
/72.8 18
/18 A0A6I8SCP2_XENTR Nuclear pore complex protein Nup98

7nqa[2] B Anti-Nup98 Nanobody MS98-6[124 aa] A 68.2
/72.8 22
/22 A0A6I8QG85_XENTR Nuclear pore complex protein Nup98

5e0q[1] A Anti-Nup98 Nanobody TP377[126 aa] B 78.9
/72.2 19
/19 J7I6Y1_XENTR Nuclear pore complex protein Nup98-Nup96

7fik[1] I A2RV69_XENLA Nuclear pore complex protein[729 aa] CA 60.0
/63.9 5
/5 A0A1L8HBE3_XENLA Nuclear pore complex protein Nup98-Nup96

7fik[1] I A2RV69_XENLA Nuclear pore complex protein[729 aa] G 76.5
/66.3 17
/17 A0A1L8HBE3_XENLA Nuclear pore complex protein Nup98-Nup96

6lk8[2] DA Q7ZYJ8_XENLA GATOR complex protein SEC13[287 aa] CA 53.8
/62.0 13
/13 A0A1L8HBE3_XENLA Nuclear pore complex protein Nup96

7fik[2] DA Q6GNX0_XENLA Protein SEC13 homolog[288 aa] CA 68.9
/63.9 45
/45 A0A1L8HBE3_XENLA Nuclear pore complex protein Nup98-Nup96

7tdz[2] G Q7ZYJ8_XENLA Protein SEC13 homolog[306 aa] AA 56.0
/64.0 50
/50 A0A1L8HBE3_XENLA Nuclear pore complex protein Nup96

7vci[6] G Q7ZYJ8_XENLA GATOR complex protein SEC13[294 aa] F 55.8
/64.0 43
/43 A0A1B8XZT4_XENTR Nuclear pore complex protein Nup96

6lk8[6] EA A2RV69_XENLA Nuclear pore complex protein[727 aa] CA 80.0
/62.0 10
/10 A0A1L8HBE3_XENLA Nuclear pore complex protein Nup96

7tdz[2] A A2RV69_XENLA Nuclear pore complex protein[789 aa] AA 100.0
/64.0 7
/7 A0A1L8HBE3_XENLA Nuclear pore complex protein Nup96

7tdz[1] A A2RV69_XENLA Nuclear pore complex protein[789 aa] BA 54.5
/64.0 11
/11 A0A1L8HBE3_XENLA Nuclear pore complex protein Nup96

7vci[3] Q A2RV69_XENLA Nuclear pore complex protein[780 aa] F 66.7
/64.0 12
/12 A0A1B8XZT4_XENTR Nuclear pore complex protein Nup96

7fik[1] E outer Nup160[1310 aa] G 80.0
/66.3 10
/10 A0A1L8HBE3_XENLA Nuclear pore complex protein Nup98-Nup96

7wb4[1] H A0A1L8GIX3_XENLA outer Nup160[1363 aa] M 0.0
/63.6 1
/1 A0A1L8HBE3_XENLA Nuclear pore complex protein Nup96

7wb4[1] I A0A1L8GIX3_XENLA outer Nup160[1310 aa] O 83.3
/64.7 6
/6 A0A1L8HBE3_XENLA Nuclear pore complex protein Nup96

7vop[1] U NUP93_XENLA Nuclear pore complex protein Nup93[654 aa] F 69.2
/62.8 13
/14 A0A1B8XZT4_XENTR Nuclear pore complex protein Nup96

7wb4[1] R NUP93_XENLA Nuclear pore complex protein Nup93[641 aa] O 100.0
/64.7 1
/1 A0A1L8HBE3_XENLA Nuclear pore complex protein Nup96

7wb4[1] Z ELYS_XENLA Protein ELYS[910 aa] O 80.0
/64.7 5
/5 A0A1L8HBE3_XENLA Nuclear pore complex protein Nup96

7tdz[2] X A0A1L8GIX3_XENLA Nup160[1352 aa] AA 80.0
/64.0 15
/15 A0A1L8HBE3_XENLA Nuclear pore complex protein Nup96

7vci[1] T ELYS_XENLA Protein ELYS[1013 aa] F 100.0
/64.0 10
/10 A0A1B8XZT4_XENTR Nuclear pore complex protein Nup96

7vci[1] U NUP93_XENLA Nuclear pore complex protein Nup93[820 aa] F 70.6
/64.0 17
/17 A0A1B8XZT4_XENTR Nuclear pore complex protein Nup96

7fik[1] AA outer Nup160[1247 aa] CA 80.0
/63.9 5
/5 A0A1L8HBE3_XENLA Nuclear pore complex protein Nup98-Nup96

7fik[1] P NUP93_XENLA Nuclear pore complex protein Nup93[593 aa] CA 66.7
/63.9 6
/6 A0A1L8HBE3_XENLA Nuclear pore complex protein Nup98-Nup96

7fik[1] U A2RV69_XENLA Nuclear pore complex protein[673 aa] CA 83.3
/63.9 6
/6 A0A1L8HBE3_XENLA Nuclear pore complex protein Nup98-Nup96

7fik[1] K A0A1L8HGL2_XENLA Nup358 complex, clamps[697 aa] CA 50.0
/63.9 2
/2 A0A1L8HBE3_XENLA Nuclear pore complex protein Nup98-Nup96

7fik[1] K A0A1L8HGL2_XENLA Nup358 complex, clamps[697 aa] G 66.7
/66.3 3
/3 A0A1L8HBE3_XENLA Nuclear pore complex protein Nup98-Nup96

7fik[1] M A0A1L8HGL2_XENLA Nup358 complex, clamps[654 aa] G 50.0
/66.3 2
/2 A0A1L8HBE3_XENLA Nuclear pore complex protein Nup98-Nup96

7tdz[1] U A0A1L8HGL2_XENLA Nup358[798 aa] AA 33.3
/64.0 18
/18 A0A1L8HBE3_XENLA Nuclear pore complex protein Nup96

7tdz[1] R A0A1L8HGL2_XENLA Nup358[798 aa] BA 5.3
/64.0 19
/19 A0A1L8HBE3_XENLA Nuclear pore complex protein Nup96

7tdz[1] T A0A1L8HGL2_XENLA Nup358[798 aa] BA 100.0
/64.0 1
/1 A0A1L8HBE3_XENLA Nuclear pore complex protein Nup96

7vop[1] V A0A1L8HGL2_XENLA Nup358[772 aa] F 42.9
/62.8 7
/7 A0A1B8XZT4_XENTR Nuclear pore complex protein Nup96

7vop[2] Y A0A1L8HGL2_XENLA Nup358[761 aa] F 37.5
/62.8 24
/24 A0A1B8XZT4_XENTR Nuclear pore complex protein Nup96

7vop[2] Z A0A1L8HGL2_XENLA Nup358[758 aa] F 0.0
/62.8 4
/4 A0A1B8XZT4_XENTR Nuclear pore complex protein Nup96

7vci[4] D Nup160[1394 aa] F 90.0
/64.0 20
/20 A0A1B8XZT4_XENTR Nuclear pore complex protein Nup96

7vci[1] A NUP85_XENLA Nuclear pore complex protein Nup85[653 aa] O 33.3
/62.9 6
/6 A0A1B8XZT4_XENTR Nuclear pore complex protein Nup96

7vci[2] B Q05AW3_XENLA MGC154553 protein[375 aa] O 28.6
/62.9 7
/7 A0A1B8XZT4_XENTR Nuclear pore complex protein Nup96

7vci[2] S Q642R6_XENLA MGC83295 protein[2011 aa] O 31.2
/62.9 16
/16 A0A1B8XZT4_XENTR Nuclear pore complex protein Nup96

6lk8[1] A Q642R6_XENLA MGC83295 protein[1409 aa] G 75.0
/62.2 4
/4 A0A1L8HBE3_XENLA Nuclear pore complex protein Nup96

6lk8[1] AA A0A1L8GIX3_XENLA outer Nup160[1109 aa] CA 77.8
/62.0 9
/9 A0A1L8HBE3_XENLA Nuclear pore complex protein Nup96

6lk8[1] K A0A1L8HGL2_XENLA Nup358 complex, clamps[169 aa] CA 66.7
/62.0 3
/3 A0A1L8HBE3_XENLA Nuclear pore complex protein Nup96

6lk8[1] Z SEH1A_XENLA Nucleoporin SEH1-A[293 aa] CA 0.0
/62.0 2
/2 A0A1L8HBE3_XENLA Nuclear pore complex protein Nup96

5cww[1] B NUP82_CHATD Nucleoporin NUP82[538 aa] A 33.3
/35.9 27
/29 NU145_CHATD Nucleoporin NUP145N

4ycz[1] C G2Q2S2_THIHA Nup120[195 aa] A 18.2
/33.4 11
/25 G2QES5_THIHA G2QEZ2_THIHA Fusion Protein of Sec13 and Nup145C

7tbi[16] OB Nup82[610 aa] PB 18.8
/30.4 16
/18 Nup116 CTD

3iko[3] A SEC13_YEAST Protein transport protein SEC13[274 aa] B 28.6
/26.4 14
/39 NU145_YEAST Nucleoporin NUP145C

4xmm[2] A SEC13_YEAST Protein transport protein SEC13[274 aa] B 28.6
/26.4 14
/34 NU145_YEAST Nucleoporin NUP145

7n84[36] G SEC13_YEAST Protein transport protein SEC13[274 aa] F 10.0
/24.9 20
/58 NU145_YEAST Nucleoporin 145c

7tbi[80] CB Sec13[274 aa] AB 28.6
/26.4 14
/47 Nup145C

3iko[3] C NUP84_YEAST Nucleoporin NUP84[419 aa] B 27.6
/26.4 29
/38 NU145_YEAST Nucleoporin NUP145C

3jro[1] B NUP84_YEAST Nucleoporin NUP84[379 aa] A 28.6
/26.4 28
/35 SEC13_YEAST NU145_YEAST Fusion Protein of Protein Transport Protein SEC13 ..

4xmm[2] F NUP84_YEAST Nucleoporin NUP84[419 aa] B 28.6
/26.4 28
/37 NU145_YEAST Nucleoporin NUP145

7tbj[64] MC NUP107 NTD[419 aa] QC 31.0
/26.4 29
/37 NUP96

7tbi[8] YA Nup84[622 aa] AB 31.0
/26.4 29
/37 Nup145C

7tbi[8] XA Nup84[669 aa] ZA 31.0
/26.4 29
/37 Nup145C

7n84[36] I NUP84_YEAST Nucleoporin NUP84[649 aa] F 30.0
/24.9 30
/36 NU145_YEAST Nucleoporin 145c

7n84[9] P NUP84_YEAST Nucleoporin NUP84[648 aa] F 37.5
/24.9 8
/16 NU145_YEAST Nucleoporin 145c

7n84[9] A NU188_YEAST Nucleoporin NUP188[1137 aa] M 9.1
/24.9 11
/11 NU145_YEAST Nucleoporin 145c

7n84[9] E NUP85_YEAST Nucleoporin NUP85[675 aa] M 0.0
/24.9 1
/1 NU145_YEAST Nucleoporin 145c

7n9f[9] XA NUP85_YEAST Nucleoporin NUP85[675 aa] YA 33.3
/24.9 3
/17 NU145_YEAST Nucleoporin 145c

7n84[9] K NU120_YEAST Nucleoporin NUP120[1006 aa] M 50.0
/24.9 2
/20 NU145_YEAST Nucleoporin 145c

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

METAL

1817 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

7now[2] E NA
SODIUM ION[1 atoms] B 75.0
/72.8 4
/4 A0A6I8SCP2_XENTR Nuclear pore complex protein Nup98

7now[2] H NA
SODIUM ION[1 atoms] D 100.0
/72.8 4
/4 A0A6I8SCP2_XENTR Nuclear pore complex protein Nup98

7nq6[1] C NA
SODIUM ION[1 atoms] A 80.0
/72.8 5
/5 F6ZMG3_XENTR Nuclear pore complex protein Nup96

7nq6[1] E NA
SODIUM ION[1 atoms] A 0.0
/72.8 1
/1 F6ZMG3_XENTR Nuclear pore complex protein Nup96

7nqa[1] G NA
SODIUM ION[1 atoms] C 100.0
/72.8 1
/1 A0A6I8QG85_XENTR Nuclear pore complex protein Nup98

7nq6[1] F CL
CHLORIDE ION[1 atoms] A 50.0
/72.8 2
/2 F6ZMG3_XENTR Nuclear pore complex protein Nup96

7nq6[1] G CL
CHLORIDE ION[1 atoms] A 100.0
/72.8 1
/1 F6ZMG3_XENTR Nuclear pore complex protein Nup96

7nq6[1] H CL
CHLORIDE ION[1 atoms] A 100.0
/72.8 4
/4 F6ZMG3_XENTR Nuclear pore complex protein Nup96

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

HOMO

1817 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

1ko6[1] C NUP98_HUMAN Nuclear Pore Complex Protein Nup98[148 aa] A 100.0
/100.0 12
/12 NUP98_HUMAN Nuclear Pore Complex Protein Nup98

1ko6[1] A NUP98_HUMAN Nuclear Pore Complex Protein Nup98[152 aa] C 100.0
/100.0 16
/16 NUP98_HUMAN Nuclear Pore Complex Protein Nup98

7peq[8] L NUP98_HUMAN Nuclear pore complex protein Nup96[543 aa] C 100.0
/100.0 1
/1 NUP98_HUMAN Nuclear pore complex protein Nup96

7peq[8] C NUP98_HUMAN Nuclear pore complex protein Nup96[543 aa] L 100.0
/100.0 3
/3 NUP98_HUMAN Nuclear pore complex protein Nup96

7q64[576] G NUP98_HUMAN Nuclear pore complex protein Nup98[34 aa] A 100.0
/100.0 2
/2 NUP98_HUMAN Nuclear pore complex protein Nup98

7q66[21] B NUP98_HUMAN Nuclear pore complex protein Nup98[25 aa] A 100.0
/100.0 6
/6 NUP98_HUMAN Nuclear pore complex protein Nup98

7q66[20] D NUP98_HUMAN Nuclear pore complex protein Nup98[25 aa] B 100.0
/100.0 25
/25 NUP98_HUMAN Nuclear pore complex protein Nup98

7q66[19] B NUP98_HUMAN Nuclear pore complex protein Nup98[25 aa] C 100.0
/100.0 1
/1 NUP98_HUMAN Nuclear pore complex protein Nup98

5hb6[2] B NU145_CHATD Nucleoporin NUP145[143 aa] A 10.5
/35.6 19
/20 NU145_CHATD Nucleoporin NUP145

3bg0[8] C NU145_YEAST Nucleoporin NUP145[420 aa] B 27.8
/26.4 18
/27 NU145_YEAST Nucleoporin NUP145

3bg0[4] F NU145_YEAST Nucleoporin NUP145[423 aa] B 50.0
/26.4 2
/3 NU145_YEAST Nucleoporin NUP145

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

PRECIPITANT

1817 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

5hb6[2] C SO4
SULFATE ION[5 atoms] A 20.0
/35.6 5
/5 NU145_CHATD Nucleoporin NUP145

5hb6[3] D SO4
SULFATE ION[5 atoms] A 50.0
/35.6 6
/6 NU145_CHATD Nucleoporin NUP145

5hb6[4] F SO4
SULFATE ION[5 atoms] A 0.0
/35.6 2
/2 NU145_CHATD Nucleoporin NUP145

5hb6[1] G SO4
SULFATE ION[5 atoms] B 0.0
/37.0 2
/2 NU145_CHATD Nucleoporin NUP145

7now[2] F SO4
SULFATE ION[5 atoms] B 66.7
/72.8 3
/3 A0A6I8SCP2_XENTR Nuclear pore complex protein Nup98

7nq6[1] B MPD
(4S)-2-METHYL-2,4-PENTANEDIOL[8 atoms] A 66.7
/72.8 3
/3 F6ZMG3_XENTR Nuclear pore complex protein Nup96

3kep[1] C EDO
1,2-ETHANEDIOL[4 atoms] A 0.0
/39.1 3
/4 NU145_YEAST Nucleoporin NUP145

3kep[2] D EDO
1,2-ETHANEDIOL[4 atoms] A 50.0
/39.1 4
/4 NU145_YEAST Nucleoporin NUP145

3kep[4] E EDO
1,2-ETHANEDIOL[4 atoms] A 50.0
/39.1 4
/4 NU145_YEAST Nucleoporin NUP145

3kep[2] F EDO
1,2-ETHANEDIOL[4 atoms] A 20.0
/39.1 5
/5 NU145_YEAST Nucleoporin NUP145

3kep[13] G EDO
1,2-ETHANEDIOL[4 atoms] A 60.0
/39.1 5
/5 NU145_YEAST Nucleoporin NUP145

3kep[1] H EDO
1,2-ETHANEDIOL[4 atoms] A 0.0
/39.1 2
/2 NU145_YEAST Nucleoporin NUP145

3kep[1] I EDO
1,2-ETHANEDIOL[4 atoms] B 0.0
/39.4 1
/1 NU145_YEAST Nucleoporin NUP145

3kep[3] L EDO
1,2-ETHANEDIOL[4 atoms] B 28.6
/39.4 7
/7 NU145_YEAST Nucleoporin NUP145

3kep[3] P EDO
1,2-ETHANEDIOL[4 atoms] B 60.0
/39.4 5
/5 NU145_YEAST Nucleoporin NUP145

3kep[2] R EDO
1,2-ETHANEDIOL[4 atoms] B 33.3
/39.4 3
/3 NU145_YEAST Nucleoporin NUP145

3kep[1] S EDO
1,2-ETHANEDIOL[4 atoms] B 33.3
/39.4 3
/3 NU145_YEAST Nucleoporin NUP145

3kes[2] C EDO
1,2-ETHANEDIOL[4 atoms] A 20.0
/39.7 5
/5 NU145_YEAST Nucleoporin NUP145

3kes[2] O EDO
1,2-ETHANEDIOL[4 atoms] B 0.0
/39.3 2
/5 NU145_YEAST Nucleoporin NUP145

3kes[1] Q EDO
1,2-ETHANEDIOL[4 atoms] B 0.0
/39.3 1
/1 NU145_YEAST Nucleoporin NUP145

5hb5[2] C FLC
CITRATE ANION[13 atoms] A 16.7
/35.9 6
/6 NU145_CHATD Nucleoporin NUP145

5hb5[1] D FLC
CITRATE ANION[13 atoms] A 0.0
/35.9 3
/3 NU145_CHATD Nucleoporin NUP145

5hb5[2] E FLC
CITRATE ANION[13 atoms] B 0.0
/35.9 1
/1 NU145_CHATD Nucleoporin NUP145

5hb5[1] F FLC
CITRATE ANION[13 atoms] B 25.0
/35.9 4
/4 NU145_CHATD Nucleoporin NUP145

5hb5[1] I FLC
CITRATE ANION[13 atoms] B 100.0
/35.9 2
/4 NU145_CHATD Nucleoporin NUP145

3nf5[1] C GOL
GLYCEROL[6 atoms] A 40.0
/32.6 5
/5 Q6FU56_CANGA Nucleoporin NUP116

3nf5[1] D GOL
GLYCEROL[6 atoms] B 0.0
/33.6 3
/3 Q6FU56_CANGA Nucleoporin NUP116

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

MONOMER
1817
	pdb_id	a¹	identity[%]²	description
	7r5j	KB	100.0	NUP98_HUMAN Nuclear pore complex protein Nup96
	6lk8	G	62.2	A0A1L8HBE3_XENLA Nuclear pore complex protein Nup96
	2q5y	A	100.0	NUP98_HUMAN Nuclear pore complex protein Nup98
	7byf	F	100.0	Q3TPG3_MOUSE Peptidase S59 domain-containing protein
	7q64	N	100.0	NUP98_HUMAN Nuclear pore complex protein Nup98
	1.a¹:asym_id for the homologue. 2.identity[%]²:sequence identity between the query and the homologue.

HETERO
1817	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	1ko6[2]	B	NU98_HUMAN Nuclear Pore Complex Protein Nup98[6 aa]	A	100.0 /100.0	11 /11	NUP98_HUMAN Nuclear Pore Complex Protein Nup98
	1ko6[1]	B	NU98_HUMAN Nuclear Pore Complex Protein Nup98[6 aa]	C	100.0 /100.0	1 /1	NUP98_HUMAN Nuclear Pore Complex Protein Nup98
	2q5y[2]	B	NUP98_HUMAN Nuclear pore complex protein Nup96[3 aa]	A	100.0 /100.0	11 /11	NUP98_HUMAN Nuclear pore complex protein Nup98
	3bg0[8]	A	SEC13_HUMAN Protein SEC13 homolog[283 aa]	B	22.2 /26.4	9 /39	NU145_YEAST Nucleoporin NUP145
	3bg0[4]	E	SEC13_HUMAN Protein SEC13 homolog[283 aa]	B	0.0 /26.4	2 /2	NU145_YEAST Nucleoporin NUP145
	5a9q[32]	G	SEC13_HUMAN PROTEIN SEC13 HOMOLOG[285 aa]	F	100.0 /100.0	8 /8	NUP98_HUMAN NUCLEAR PORE COMPLEX PROTEIN NUP96
	7peq[32]	D	SEC13_HUMAN Protein SEC13 homolog[285 aa]	C	100.0 /100.0	13 /13	NUP98_HUMAN Nuclear pore complex protein Nup96
	7r5j[64]	OB	SEC13_HUMAN Protein SEC13 homolog[301 aa]	KB	100.0 /100.0	59 /59	NUP98_HUMAN Nuclear pore complex protein Nup96
	3mmy[15]	A	RAE1L_HUMAN mRNA export factor[354 aa]	B	100.0 /100.0	29 /29	NUP98_HUMAN Nuclear pore complex protein Nup98
	7f60[4]	B	RAE1L_HUMAN mRNA export factor[330 aa]	C	100.0 /100.0	25 /25	NUP98_HUMAN Nuclear pore complex protein Nup98-Nup96
	4owr[1]	C	MATRX_VSIVS Matrix protein[176 aa]	B	100.0 /100.0	3 /3	NUP98_HUMAN Nuclear pore complex protein Nup98-Nup96
	5a9q[32]	E	NU107_HUMAN NUCLEAR PORE COMPLEX PROTEIN NUP107[660 aa]	F	100.0 /100.0	7 /7	NUP98_HUMAN NUCLEAR PORE COMPLEX PROTEIN NUP96
	7byf[2]	D	O41931_MHV68 10 protein[399 aa]	B	100.0 /100.0	2 /2	Q3TPG3_MOUSE Peptidase S59 domain-containing protein
	7mni[2]	A	NUP88_HUMAN Nuclear pore complex protein Nup88[409 aa]	B	100.0 /100.0	27 /27	NUP98-2_HUMAN Nuclear pore complex protein Nup98
	7peq[24]	B	NU107_HUMAN Nuclear pore complex protein Nup107[678 aa]	C	100.0 /100.0	4 /4	NUP98_HUMAN Nuclear pore complex protein Nup96
	7peq[8]	F	NUP85_HUMAN Nuclear pore complex protein Nup85[632 aa]	C	100.0 /100.0	1 /1	NUP98_HUMAN Nuclear pore complex protein Nup96
	7r5j[32]	WB	NUP85_HUMAN Nuclear pore complex protein Nup85[655 aa]	LB	100.0 /100.0	2 /2	NUP98_HUMAN Nuclear pore complex protein Nup96
	7peq[32]	H	NU160_HUMAN Nuclear pore complex protein Nup160[996 aa]	C	100.0 /100.0	32 /32	NUP98_HUMAN Nuclear pore complex protein Nup96
	7r5j[24]	A	RBP2_HUMAN E3 SUMO-protein ligase RanBP2[756 aa]	KB	100.0 /100.0	1 /1	NUP98_HUMAN Nuclear pore complex protein Nup96
	7r5j[16]	C	RBP2_HUMAN E3 SUMO-protein ligase RanBP2[756 aa]	KB	100.0 /100.0	3 /3	NUP98_HUMAN Nuclear pore complex protein Nup96
	7r5j[8]	D	RBP2_HUMAN E3 SUMO-protein ligase RanBP2[756 aa]	LB	100.0 /100.0	5 /5	NUP98_HUMAN Nuclear pore complex protein Nup96
	7r5k[8]	B	RBP2_HUMAN E3 SUMO-protein ligase RanBP2[756 aa]	KB	100.0 /100.0	7 /7	NUP98_HUMAN Nuclear pore complex protein Nup96
	7r5k[8]	D	RBP2_HUMAN E3 SUMO-protein ligase RanBP2[756 aa]	LB	100.0 /100.0	4 /4	NUP98_HUMAN Nuclear pore complex protein Nup96
	7r5j[64]	EC	NU160_HUMAN Nuclear pore complex protein Nup160[1399 aa]	KB	100.0 /100.0	30 /30	NUP98_HUMAN Nuclear pore complex protein Nup96
	7r5j[64]	GB	NU107_HUMAN Nuclear pore complex protein Nup107[782 aa]	KB	100.0 /100.0	22 /22	NUP98_HUMAN Nuclear pore complex protein Nup96
	7r5j[32]	HB	NU107_HUMAN Nuclear pore complex protein Nup107[782 aa]	KB	100.0 /100.0	4 /4	NUP98_HUMAN Nuclear pore complex protein Nup96
	7r5j[24]	U	NUP93_HUMAN Nuclear pore complex protein Nup93[726 aa]	KB	100.0 /100.0	15 /15	NUP98_HUMAN Nuclear pore complex protein Nup96
	7r5j[8]	V	NUP93_HUMAN Nuclear pore complex protein Nup93[726 aa]	MB	100.0 /100.0	4 /4	NUP98_HUMAN Nuclear pore complex protein Nup96
	7vpg[2]	K	NS6_SARS ORF6 protein[10 aa]	F	100.0 /100.0	1 /1	NUP98_HUMAN Isoform 3 of Nuclear pore complex protein Nup98-Nu..
	7vph[1]	L	NS6_SARS2 ORF6 protein[9 aa]	B	100.0 /100.0	1 /1	NUP98_HUMAN Isoform 3 of Nuclear pore complex protein Nup98-Nu..
	3pbp[4]	A	NUP82_YEAST Nucleoporin NUP82[438 aa]	B	35.0 /30.4	20 /22	NU116_YEAST Nucleoporin NUP116/NSP116
	3tkn[3]	A	NUP82_YEAST Nucleoporin NUP82[451 aa]	C	95.2 /98.0	21 /21	Q6PFD9_MOUSE Nucleoporin 98
	7now[2]	A	Anti-Nup98 nanobody MS98-27[129 aa]	B	88.9 /72.8	18 /18	A0A6I8SCP2_XENTR Nuclear pore complex protein Nup98
	7nqa[2]	B	Anti-Nup98 Nanobody MS98-6[124 aa]	A	68.2 /72.8	22 /22	A0A6I8QG85_XENTR Nuclear pore complex protein Nup98
	5e0q[1]	A	Anti-Nup98 Nanobody TP377[126 aa]	B	78.9 /72.2	19 /19	J7I6Y1_XENTR Nuclear pore complex protein Nup98-Nup96
	7fik[1]	I	A2RV69_XENLA Nuclear pore complex protein[729 aa]	CA	60.0 /63.9	5 /5	A0A1L8HBE3_XENLA Nuclear pore complex protein Nup98-Nup96
	7fik[1]	I	A2RV69_XENLA Nuclear pore complex protein[729 aa]	G	76.5 /66.3	17 /17	A0A1L8HBE3_XENLA Nuclear pore complex protein Nup98-Nup96
	6lk8[2]	DA	Q7ZYJ8_XENLA GATOR complex protein SEC13[287 aa]	CA	53.8 /62.0	13 /13	A0A1L8HBE3_XENLA Nuclear pore complex protein Nup96
	7fik[2]	DA	Q6GNX0_XENLA Protein SEC13 homolog[288 aa]	CA	68.9 /63.9	45 /45	A0A1L8HBE3_XENLA Nuclear pore complex protein Nup98-Nup96
	7tdz[2]	G	Q7ZYJ8_XENLA Protein SEC13 homolog[306 aa]	AA	56.0 /64.0	50 /50	A0A1L8HBE3_XENLA Nuclear pore complex protein Nup96
	7vci[6]	G	Q7ZYJ8_XENLA GATOR complex protein SEC13[294 aa]	F	55.8 /64.0	43 /43	A0A1B8XZT4_XENTR Nuclear pore complex protein Nup96
	6lk8[6]	EA	A2RV69_XENLA Nuclear pore complex protein[727 aa]	CA	80.0 /62.0	10 /10	A0A1L8HBE3_XENLA Nuclear pore complex protein Nup96
	7tdz[2]	A	A2RV69_XENLA Nuclear pore complex protein[789 aa]	AA	100.0 /64.0	7 /7	A0A1L8HBE3_XENLA Nuclear pore complex protein Nup96
	7tdz[1]	A	A2RV69_XENLA Nuclear pore complex protein[789 aa]	BA	54.5 /64.0	11 /11	A0A1L8HBE3_XENLA Nuclear pore complex protein Nup96
	7vci[3]	Q	A2RV69_XENLA Nuclear pore complex protein[780 aa]	F	66.7 /64.0	12 /12	A0A1B8XZT4_XENTR Nuclear pore complex protein Nup96
	7fik[1]	E	outer Nup160[1310 aa]	G	80.0 /66.3	10 /10	A0A1L8HBE3_XENLA Nuclear pore complex protein Nup98-Nup96
	7wb4[1]	H	A0A1L8GIX3_XENLA outer Nup160[1363 aa]	M	0.0 /63.6	1 /1	A0A1L8HBE3_XENLA Nuclear pore complex protein Nup96
	7wb4[1]	I	A0A1L8GIX3_XENLA outer Nup160[1310 aa]	O	83.3 /64.7	6 /6	A0A1L8HBE3_XENLA Nuclear pore complex protein Nup96
	7vop[1]	U	NUP93_XENLA Nuclear pore complex protein Nup93[654 aa]	F	69.2 /62.8	13 /14	A0A1B8XZT4_XENTR Nuclear pore complex protein Nup96
	7wb4[1]	R	NUP93_XENLA Nuclear pore complex protein Nup93[641 aa]	O	100.0 /64.7	1 /1	A0A1L8HBE3_XENLA Nuclear pore complex protein Nup96
	7wb4[1]	Z	ELYS_XENLA Protein ELYS[910 aa]	O	80.0 /64.7	5 /5	A0A1L8HBE3_XENLA Nuclear pore complex protein Nup96
	7tdz[2]	X	A0A1L8GIX3_XENLA Nup160[1352 aa]	AA	80.0 /64.0	15 /15	A0A1L8HBE3_XENLA Nuclear pore complex protein Nup96
	7vci[1]	T	ELYS_XENLA Protein ELYS[1013 aa]	F	100.0 /64.0	10 /10	A0A1B8XZT4_XENTR Nuclear pore complex protein Nup96
	7vci[1]	U	NUP93_XENLA Nuclear pore complex protein Nup93[820 aa]	F	70.6 /64.0	17 /17	A0A1B8XZT4_XENTR Nuclear pore complex protein Nup96
	7fik[1]	AA	outer Nup160[1247 aa]	CA	80.0 /63.9	5 /5	A0A1L8HBE3_XENLA Nuclear pore complex protein Nup98-Nup96
	7fik[1]	P	NUP93_XENLA Nuclear pore complex protein Nup93[593 aa]	CA	66.7 /63.9	6 /6	A0A1L8HBE3_XENLA Nuclear pore complex protein Nup98-Nup96
	7fik[1]	U	A2RV69_XENLA Nuclear pore complex protein[673 aa]	CA	83.3 /63.9	6 /6	A0A1L8HBE3_XENLA Nuclear pore complex protein Nup98-Nup96
	7fik[1]	K	A0A1L8HGL2_XENLA Nup358 complex, clamps[697 aa]	CA	50.0 /63.9	2 /2	A0A1L8HBE3_XENLA Nuclear pore complex protein Nup98-Nup96
	7fik[1]	K	A0A1L8HGL2_XENLA Nup358 complex, clamps[697 aa]	G	66.7 /66.3	3 /3	A0A1L8HBE3_XENLA Nuclear pore complex protein Nup98-Nup96
	7fik[1]	M	A0A1L8HGL2_XENLA Nup358 complex, clamps[654 aa]	G	50.0 /66.3	2 /2	A0A1L8HBE3_XENLA Nuclear pore complex protein Nup98-Nup96
	7tdz[1]	U	A0A1L8HGL2_XENLA Nup358[798 aa]	AA	33.3 /64.0	18 /18	A0A1L8HBE3_XENLA Nuclear pore complex protein Nup96
	7tdz[1]	R	A0A1L8HGL2_XENLA Nup358[798 aa]	BA	5.3 /64.0	19 /19	A0A1L8HBE3_XENLA Nuclear pore complex protein Nup96
	7tdz[1]	T	A0A1L8HGL2_XENLA Nup358[798 aa]	BA	100.0 /64.0	1 /1	A0A1L8HBE3_XENLA Nuclear pore complex protein Nup96
	7vop[1]	V	A0A1L8HGL2_XENLA Nup358[772 aa]	F	42.9 /62.8	7 /7	A0A1B8XZT4_XENTR Nuclear pore complex protein Nup96
	7vop[2]	Y	A0A1L8HGL2_XENLA Nup358[761 aa]	F	37.5 /62.8	24 /24	A0A1B8XZT4_XENTR Nuclear pore complex protein Nup96
	7vop[2]	Z	A0A1L8HGL2_XENLA Nup358[758 aa]	F	0.0 /62.8	4 /4	A0A1B8XZT4_XENTR Nuclear pore complex protein Nup96
	7vci[4]	D	Nup160[1394 aa]	F	90.0 /64.0	20 /20	A0A1B8XZT4_XENTR Nuclear pore complex protein Nup96
	7vci[1]	A	NUP85_XENLA Nuclear pore complex protein Nup85[653 aa]	O	33.3 /62.9	6 /6	A0A1B8XZT4_XENTR Nuclear pore complex protein Nup96
	7vci[2]	B	Q05AW3_XENLA MGC154553 protein[375 aa]	O	28.6 /62.9	7 /7	A0A1B8XZT4_XENTR Nuclear pore complex protein Nup96
	7vci[2]	S	Q642R6_XENLA MGC83295 protein[2011 aa]	O	31.2 /62.9	16 /16	A0A1B8XZT4_XENTR Nuclear pore complex protein Nup96
	6lk8[1]	A	Q642R6_XENLA MGC83295 protein[1409 aa]	G	75.0 /62.2	4 /4	A0A1L8HBE3_XENLA Nuclear pore complex protein Nup96
	6lk8[1]	AA	A0A1L8GIX3_XENLA outer Nup160[1109 aa]	CA	77.8 /62.0	9 /9	A0A1L8HBE3_XENLA Nuclear pore complex protein Nup96
	6lk8[1]	K	A0A1L8HGL2_XENLA Nup358 complex, clamps[169 aa]	CA	66.7 /62.0	3 /3	A0A1L8HBE3_XENLA Nuclear pore complex protein Nup96
	6lk8[1]	Z	SEH1A_XENLA Nucleoporin SEH1-A[293 aa]	CA	0.0 /62.0	2 /2	A0A1L8HBE3_XENLA Nuclear pore complex protein Nup96
	5cww[1]	B	NUP82_CHATD Nucleoporin NUP82[538 aa]	A	33.3 /35.9	27 /29	NU145_CHATD Nucleoporin NUP145N
	4ycz[1]	C	G2Q2S2_THIHA Nup120[195 aa]	A	18.2 /33.4	11 /25	G2QES5_THIHA G2QEZ2_THIHA Fusion Protein of Sec13 and Nup145C
	7tbi[16]	OB	Nup82[610 aa]	PB	18.8 /30.4	16 /18	Nup116 CTD
	3iko[3]	A	SEC13_YEAST Protein transport protein SEC13[274 aa]	B	28.6 /26.4	14 /39	NU145_YEAST Nucleoporin NUP145C
	4xmm[2]	A	SEC13_YEAST Protein transport protein SEC13[274 aa]	B	28.6 /26.4	14 /34	NU145_YEAST Nucleoporin NUP145
	7n84[36]	G	SEC13_YEAST Protein transport protein SEC13[274 aa]	F	10.0 /24.9	20 /58	NU145_YEAST Nucleoporin 145c
	7tbi[80]	CB	Sec13[274 aa]	AB	28.6 /26.4	14 /47	Nup145C
	3iko[3]	C	NUP84_YEAST Nucleoporin NUP84[419 aa]	B	27.6 /26.4	29 /38	NU145_YEAST Nucleoporin NUP145C
	3jro[1]	B	NUP84_YEAST Nucleoporin NUP84[379 aa]	A	28.6 /26.4	28 /35	SEC13_YEAST NU145_YEAST Fusion Protein of Protein Transport Protein SEC13 ..
	4xmm[2]	F	NUP84_YEAST Nucleoporin NUP84[419 aa]	B	28.6 /26.4	28 /37	NU145_YEAST Nucleoporin NUP145
	7tbj[64]	MC	NUP107 NTD[419 aa]	QC	31.0 /26.4	29 /37	NUP96
	7tbi[8]	YA	Nup84[622 aa]	AB	31.0 /26.4	29 /37	Nup145C
	7tbi[8]	XA	Nup84[669 aa]	ZA	31.0 /26.4	29 /37	Nup145C
	7n84[36]	I	NUP84_YEAST Nucleoporin NUP84[649 aa]	F	30.0 /24.9	30 /36	NU145_YEAST Nucleoporin 145c
	7n84[9]	P	NUP84_YEAST Nucleoporin NUP84[648 aa]	F	37.5 /24.9	8 /16	NU145_YEAST Nucleoporin 145c
	7n84[9]	A	NU188_YEAST Nucleoporin NUP188[1137 aa]	M	9.1 /24.9	11 /11	NU145_YEAST Nucleoporin 145c
	7n84[9]	E	NUP85_YEAST Nucleoporin NUP85[675 aa]	M	0.0 /24.9	1 /1	NU145_YEAST Nucleoporin 145c
	7n9f[9]	XA	NUP85_YEAST Nucleoporin NUP85[675 aa]	YA	33.3 /24.9	3 /17	NU145_YEAST Nucleoporin 145c
	7n84[9]	K	NU120_YEAST Nucleoporin NUP120[1006 aa]	M	50.0 /24.9	2 /20	NU145_YEAST Nucleoporin 145c
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
METAL
1817	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	7now[2]	E	NA SODIUM ION[1 atoms]	B	75.0 /72.8	4 /4	A0A6I8SCP2_XENTR Nuclear pore complex protein Nup98
	7now[2]	H	NA SODIUM ION[1 atoms]	D	100.0 /72.8	4 /4	A0A6I8SCP2_XENTR Nuclear pore complex protein Nup98
	7nq6[1]	C	NA SODIUM ION[1 atoms]	A	80.0 /72.8	5 /5	F6ZMG3_XENTR Nuclear pore complex protein Nup96
	7nq6[1]	E	NA SODIUM ION[1 atoms]	A	0.0 /72.8	1 /1	F6ZMG3_XENTR Nuclear pore complex protein Nup96
	7nqa[1]	G	NA SODIUM ION[1 atoms]	C	100.0 /72.8	1 /1	A0A6I8QG85_XENTR Nuclear pore complex protein Nup98
	7nq6[1]	F	CL CHLORIDE ION[1 atoms]	A	50.0 /72.8	2 /2	F6ZMG3_XENTR Nuclear pore complex protein Nup96
	7nq6[1]	G	CL CHLORIDE ION[1 atoms]	A	100.0 /72.8	1 /1	F6ZMG3_XENTR Nuclear pore complex protein Nup96
	7nq6[1]	H	CL CHLORIDE ION[1 atoms]	A	100.0 /72.8	4 /4	F6ZMG3_XENTR Nuclear pore complex protein Nup96
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
HOMO
1817	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	1ko6[1]	C	NUP98_HUMAN Nuclear Pore Complex Protein Nup98[148 aa]	A	100.0 /100.0	12 /12	NUP98_HUMAN Nuclear Pore Complex Protein Nup98
	1ko6[1]	A	NUP98_HUMAN Nuclear Pore Complex Protein Nup98[152 aa]	C	100.0 /100.0	16 /16	NUP98_HUMAN Nuclear Pore Complex Protein Nup98
	7peq[8]	L	NUP98_HUMAN Nuclear pore complex protein Nup96[543 aa]	C	100.0 /100.0	1 /1	NUP98_HUMAN Nuclear pore complex protein Nup96
	7peq[8]	C	NUP98_HUMAN Nuclear pore complex protein Nup96[543 aa]	L	100.0 /100.0	3 /3	NUP98_HUMAN Nuclear pore complex protein Nup96
	7q64[576]	G	NUP98_HUMAN Nuclear pore complex protein Nup98[34 aa]	A	100.0 /100.0	2 /2	NUP98_HUMAN Nuclear pore complex protein Nup98
	7q66[21]	B	NUP98_HUMAN Nuclear pore complex protein Nup98[25 aa]	A	100.0 /100.0	6 /6	NUP98_HUMAN Nuclear pore complex protein Nup98
	7q66[20]	D	NUP98_HUMAN Nuclear pore complex protein Nup98[25 aa]	B	100.0 /100.0	25 /25	NUP98_HUMAN Nuclear pore complex protein Nup98
	7q66[19]	B	NUP98_HUMAN Nuclear pore complex protein Nup98[25 aa]	C	100.0 /100.0	1 /1	NUP98_HUMAN Nuclear pore complex protein Nup98
	5hb6[2]	B	NU145_CHATD Nucleoporin NUP145[143 aa]	A	10.5 /35.6	19 /20	NU145_CHATD Nucleoporin NUP145
	3bg0[8]	C	NU145_YEAST Nucleoporin NUP145[420 aa]	B	27.8 /26.4	18 /27	NU145_YEAST Nucleoporin NUP145
	3bg0[4]	F	NU145_YEAST Nucleoporin NUP145[423 aa]	B	50.0 /26.4	2 /3	NU145_YEAST Nucleoporin NUP145
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
1817	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	5hb6[2]	C	SO4 SULFATE ION[5 atoms]	A	20.0 /35.6	5 /5	NU145_CHATD Nucleoporin NUP145
	5hb6[3]	D	SO4 SULFATE ION[5 atoms]	A	50.0 /35.6	6 /6	NU145_CHATD Nucleoporin NUP145
	5hb6[4]	F	SO4 SULFATE ION[5 atoms]	A	0.0 /35.6	2 /2	NU145_CHATD Nucleoporin NUP145
	5hb6[1]	G	SO4 SULFATE ION[5 atoms]	B	0.0 /37.0	2 /2	NU145_CHATD Nucleoporin NUP145
	7now[2]	F	SO4 SULFATE ION[5 atoms]	B	66.7 /72.8	3 /3	A0A6I8SCP2_XENTR Nuclear pore complex protein Nup98
	7nq6[1]	B	MPD (4S)-2-METHYL-2,4-PENTANEDIOL[8 atoms]	A	66.7 /72.8	3 /3	F6ZMG3_XENTR Nuclear pore complex protein Nup96
	3kep[1]	C	EDO 1,2-ETHANEDIOL[4 atoms]	A	0.0 /39.1	3 /4	NU145_YEAST Nucleoporin NUP145
	3kep[2]	D	EDO 1,2-ETHANEDIOL[4 atoms]	A	50.0 /39.1	4 /4	NU145_YEAST Nucleoporin NUP145
	3kep[4]	E	EDO 1,2-ETHANEDIOL[4 atoms]	A	50.0 /39.1	4 /4	NU145_YEAST Nucleoporin NUP145
	3kep[2]	F	EDO 1,2-ETHANEDIOL[4 atoms]	A	20.0 /39.1	5 /5	NU145_YEAST Nucleoporin NUP145
	3kep[13]	G	EDO 1,2-ETHANEDIOL[4 atoms]	A	60.0 /39.1	5 /5	NU145_YEAST Nucleoporin NUP145
	3kep[1]	H	EDO 1,2-ETHANEDIOL[4 atoms]	A	0.0 /39.1	2 /2	NU145_YEAST Nucleoporin NUP145
	3kep[1]	I	EDO 1,2-ETHANEDIOL[4 atoms]	B	0.0 /39.4	1 /1	NU145_YEAST Nucleoporin NUP145
	3kep[3]	L	EDO 1,2-ETHANEDIOL[4 atoms]	B	28.6 /39.4	7 /7	NU145_YEAST Nucleoporin NUP145
	3kep[3]	P	EDO 1,2-ETHANEDIOL[4 atoms]	B	60.0 /39.4	5 /5	NU145_YEAST Nucleoporin NUP145
	3kep[2]	R	EDO 1,2-ETHANEDIOL[4 atoms]	B	33.3 /39.4	3 /3	NU145_YEAST Nucleoporin NUP145
	3kep[1]	S	EDO 1,2-ETHANEDIOL[4 atoms]	B	33.3 /39.4	3 /3	NU145_YEAST Nucleoporin NUP145
	3kes[2]	C	EDO 1,2-ETHANEDIOL[4 atoms]	A	20.0 /39.7	5 /5	NU145_YEAST Nucleoporin NUP145
	3kes[2]	O	EDO 1,2-ETHANEDIOL[4 atoms]	B	0.0 /39.3	2 /5	NU145_YEAST Nucleoporin NUP145
	3kes[1]	Q	EDO 1,2-ETHANEDIOL[4 atoms]	B	0.0 /39.3	1 /1	NU145_YEAST Nucleoporin NUP145
	5hb5[2]	C	FLC CITRATE ANION[13 atoms]	A	16.7 /35.9	6 /6	NU145_CHATD Nucleoporin NUP145
	5hb5[1]	D	FLC CITRATE ANION[13 atoms]	A	0.0 /35.9	3 /3	NU145_CHATD Nucleoporin NUP145
	5hb5[2]	E	FLC CITRATE ANION[13 atoms]	B	0.0 /35.9	1 /1	NU145_CHATD Nucleoporin NUP145
	5hb5[1]	F	FLC CITRATE ANION[13 atoms]	B	25.0 /35.9	4 /4	NU145_CHATD Nucleoporin NUP145
	5hb5[1]	I	FLC CITRATE ANION[13 atoms]	B	100.0 /35.9	2 /4	NU145_CHATD Nucleoporin NUP145
	3nf5[1]	C	GOL GLYCEROL[6 atoms]	A	40.0 /32.6	5 /5	Q6FU56_CANGA Nucleoporin NUP116
	3nf5[1]	D	GOL GLYCEROL[6 atoms]	B	0.0 /33.6	3 /3	Q6FU56_CANGA Nucleoporin NUP116
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

Contact Molecules for Homologous Proteins

Summary Bars[0.0 %]

UniProt Feature Tables [P52948(NUP98_HUMAN)]