Contact Molecules for Homologous Proteins | ||||
[Full Bars] |
[SiteTable] |
|
[Back to Search Page] |
[Back to HOMCOS] |
[SupCon3D] |
[help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
19566 | 932 | 66 | YP_009725307.1() | |
QUERYSEQ |
SADAQSFLNRVCGVSAARLTPCGTGTSTDVVYRAFDIYNDKVAGFAKFLKTNCCRFQEKDEDDNLIDSYFVVKRHTFSNYQHEETIYNLLKDCPAVAKHDFFKFRIDGDMVPHISRQRLTKYTMADLVYALRHFDEGNCDTLKEILVTYN CCDDDYFNKKDWYDFVENPDILRVYANLGERVRQALLKTVQFCDAMRNAGIVGVLTLDNQDLNGNWYDFGDFIQTTPGSGVPVVDSYYSLLMPILTLTRALTAESHVDTDLTKPYIKWDLLKYDFTEERLKLFDRYFKYWDQTYHPNCVN CLDDRCILHCANFNVLFSTVFPPTSFGPLVRKIFVDGVPFVVSTGYHFRELGVVHNQDVNLHSSRLSFKELLVYAADPAMHAASGNLLLDKRTTCFSVAALTNNVAFQTVKPGNFNKDFYDFAVSKGFFKEGSSVELKHFFFAQDGNAAI SDYDYYRYNLPTMCDIRQLLFVVEVVDKYFDCYDGGCINANQVIVNNLDKSAGFPFNKWGKARLYYDSMSYEDQDALFAYTKRNVIPTITQMNLKYAISAKNRARTVAGVSICSTMTNRQFHQKLLKSIAATRGATVVIGTSKFYGGWHN MLKTVYSDVENPHLMGWDYPKCDRAMPNMLRIMASLVLARKHTTCCSLSHRFYRLANECAQVLSEMVMCGGSLYVKPGGTSSGDATTAYANSVFNICQAVTANVNALLSTDGNKIADKYVRNLQHRLYECLYRNRDVDTDFVNEFYAYLR KHFSMMILSDDAVVCFNSTYASQGLVASIKNFKSVLYYQNNVFMSEAKCWTETDLTKGPHEFCSQHTMLVKQGDDYVYLPYPDPSRILGAGCFVDDIVKTDGTLMIERFVSLAIDAYPLTKHPNQEYADVFHLYLQYIRKLHDELTGHML DMYSVMLTNDNTSRYWEPEFYEAMYTPHTVLQ |
932 | region | name | description |
1-932 | DISORDER | predicted by DISOPRED |
MONOMER | |||||||
932 | |||||||
pdb_id | a1 | identity[%]2 | description | ||||
8gwk | A | 100.0 | R1AB_SARS2 RNA-directed RNA polymerase | ||||
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue. |
HETERO | |||||||
932 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
6m71[61] | B | R1AB_SARS2 Non-structural protein 7[70 aa] | A | 100.0 /100.0 |
12 /12 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7bw4[1] | C | R1AB_SARS2 Non-structural protein 7[65 aa] | A | 100.0 /100.0 |
10 /10 |
R1AB_SARS2 RNA-directed RNA polymerase | |
6m71[1] | C | R1AB_SARS2 Non-structural protein 8[43 aa] | A | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 RNA-directed RNA polymerase | |
6m71[60] | D | R1AB_SARS2 Non-structural protein 8[113 aa] | A | 100.0 /100.0 |
46 /46 |
R1AB_SARS2 RNA-directed RNA polymerase | |
6nur[1] | D | R1A_CVHSA NSP8[109 aa] | A | 100.0 /97.0 |
2 /2 |
R1AB_CVHSA NSP12 | |
6xez[40] | D | R1AB_SARS2 Non-structural protein 8[186 aa] | A | 100.0 /100.0 |
12 /12 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7btf[6] | D | R1AB_SARS2 Non-structural protein 8[104 aa] | A | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7bw4[1] | B | R1AB_SARS2 Non-structural protein 8[115 aa] | A | 100.0 /100.0 |
42 /42 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7l1f[1] | B | R1AB_SARS2 Non-structural protein 8[114 aa] | A | 100.0 /100.0 |
40 /40 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7re3[2] | G | R1AB_SARS2 Non-structural protein 8[186 aa] | A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 RNA-directed RNA polymerase | |
6xez[27] | E | R1AB_SARS2 Helicase[596 aa] | A | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7cxn[1] | H | R1AB_SARS2 Helicase[596 aa] | A | 100.0 /99.9 |
1 /1 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7re3[2] | N | R1AB_SARS2 Helicase[590 aa] | A | 100.0 /100.0 |
10 /10 |
R1AB_SARS2 RNA-directed RNA polymerase | |
6xqb[1] | D | R1AB_SARS2 Non-structural protein 8[31 aa] | A | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7aap[2] | D | R1AB_SARS2 Non-structural protein 8[28 aa] | A | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 12 | |
7bv1[1] | D | R1AB_SARS2 Non-structural protein 8[99 aa] | A | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7cyq[16] | I | R1AB_SARS2 Non-structural protein 9[113 aa] | A | 100.0 /100.0 |
19 /19 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7egq[3] | H | R1AB_SARS2 Proofreading exoribonuclease[523 aa] | A | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7egq[2] | P | R1AB_SARS2 Proofreading exoribonuclease[524 aa] | A | 100.0 /100.0 |
12 /12 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7oyg[2] | B | R1AB_SARS2 SARS-CoV-2 nsp8[81 aa] | A | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 SARS-CoV-2 RNA-dependent RNA polymerase (nsp12) | |
7thm[1] | C | R1AB_SARS2 Non-structural protein 7[37 aa] | A | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7thm[1] | E | R1AB_SARS2 Non-structural protein 9[74 aa] | A | 100.0 /100.0 |
16 /16 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8sq9[1] | E | R1AB_SARS2 Non-structural protein 9[98 aa] | A | 100.0 /100.0 |
20 /20 |
R1AB_SARS2 RNA-directed RNA polymerase | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
NUCLEOTIDE | |||||||
932 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
6xez[9] | G | Product RNA | A | 100.0 /100.0 |
16 /16 |
R1AB_SARS2 RNA-directed RNA polymerase | |
6xez[1] | H | Template RNA | A | 100.0 /100.0 |
21 /21 |
R1AB_SARS2 RNA-directed RNA polymerase | |
6xqb[1] | E | RNA (5'-R(*GP*UP*GP*GP*GP*CP*CP*CP*A)-3') | A | 100.0 /100.0 |
15 /15 |
R1AB_SARS2 RNA-directed RNA polymerase | |
6xqb[1] | F | RNA (5'-R(*GP*UP*GP*GP*GP*CP*CP*CP*A)-3') | A | 100.0 /100.0 |
19 /19 |
R1AB_SARS2 RNA-directed RNA polymerase | |
6yyt[1] | E | RNA product | A | 100.0 /100.0 |
14 /14 |
R1AB_SARS2 nsp12 | |
6yyt[1] | G | RNA product | A | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 nsp12 | |
7aap[1] | E | RNA (5'-R(P*UP*UP*AP*AP*GP*UP*UP*AP*U)-3') | A | 100.0 /100.0 |
16 /16 |
R1AB_SARS2 Non-structural protein 12 | |
7aap[1] | F | RNA (5'-R(P*UP*UP*CP*AP*UP*AP*AP*CP*UP*UP*AP*A)-3'.. | A | 100.0 /100.0 |
23 /23 |
R1AB_SARS2 Non-structural protein 12 | |
7b3b[1] | D | DNA/RNA (5'-R(P*CP*UP*AP*CP*GP*CP*G)-D(P*(RMP))-R(.. | A | 100.0 /100.0 |
14 /14 |
R1AB_SARS2 RNA-directed RNA polymerase nsp12 | |
7b3b[1] | E | RNA (5'-R(P*UP*GP*CP*AP*UP*CP*GP*CP*GP*UP*AP*G)-3'.. | A | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 RNA-directed RNA polymerase nsp12 | |
7b3c[1] | D | DNA/RNA (5'-R(P*CP*UP*AP*CP*GP*CP*A)-D(P*(RMP))-R(.. | A | 100.0 /100.0 |
16 /16 |
R1AB_SARS2 RNA-directed RNA polymerase nsp12 | |
7b3c[1] | E | RNA (5'-R(P*UP*CP*AP*CP*UP*UP*GP*CP*GP*UP*AP*G)-3'.. | A | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 RNA-directed RNA polymerase nsp12 | |
7bv2[1] | D | Primer | A | 100.0 /100.0 |
15 /15 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7bv2[1] | E | Templete | A | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7bzf[1] | E | RNA (31-MER) | A | 100.0 /100.0 |
25 /25 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7bzf[1] | F | RNA (5'-R(*UP*GP*UP*UP*CP*GP*AP*CP*GP*AP*CP*AP*CP*.. | A | 100.0 /100.0 |
13 /13 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7c2k[1] | E | RNA (29-MER) | A | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7c2k[1] | F | RNA (5'-R(*UP*GP*UP*UP*CP*GP*AP*CP*GP*AP*CP*AP*CP*.. | A | 100.0 /100.0 |
17 /17 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7ctt[1] | E | Primer-RNA (5'-R(P*UP*UP*CP*UP*CP*CP*UP*AP*AP*GP*A.. | A | 100.0 /100.0 |
18 /18 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7ctt[1] | F | Template-RNA (5'-R(P*AP*CP*UP*AP*GP*CP*UP*UP*CP*UP.. | A | 100.0 /100.0 |
25 /25 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7cxm[15] | E | RNA (25-MER) | A | 100.0 /99.9 |
10 /10 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7cyq[1] | E | Primer | A | 100.0 /100.0 |
16 /16 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7cyq[1] | F | Template | A | 100.0 /100.0 |
30 /30 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7dfg[2] | A | RNA (5'-R(P*AP*GP*AP*UP*UP*AP*AP*GP*UP*UP*AP*U)-3'.. | C | 100.0 /100.0 |
14 /14 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7dfg[1] | B | RNA (5'-R(P*CP*CP*CP*UP*AP*UP*AP*AP*CP*UP*UP*AP*AP.. | C | 100.0 /100.0 |
30 /30 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7dfh[1] | E | RNA (5'-R(P*GP*CP*UP*AP*UP*GP*UP*G*(LIG))-3') | A | 100.0 /100.0 |
13 /13 |
R1AB_SARS2 RNA-directed RNA polymeras | |
7dfh[1] | F | RNA (5'-R(P*CP*CP*CP*CP*CP*AP*CP*AP*UP*AP*GP*C)-3'.. | A | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 RNA-directed RNA polymeras | |
7doi[1] | E | RNA (5'-R(P*CP*CP*UP*AP*UP*AP*AP*CP*UP*UP*AP*AP*UP.. | A | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7dok[1] | A | RNA (5'-R(P*GP*CP*UP*AP*UP*GP*UP*GP*AP*GP*AP*UP*UP.. | C | 100.0 /100.0 |
14 /14 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7dok[1] | B | RNA (5'-R(P*CP*CP*CP*UP*AP*UP*AP*AP*CP*UP*UP*AP*AP.. | C | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7dte[1] | E | RNA (57-MER) | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7dte[1] | F | RNA (33-MER) | A | 100.0 /100.0 |
15 /15 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7egq[2] | T | Template RNA | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7eiz[2] | H | template | A | 100.0 /100.0 |
21 /21 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7krn[3] | F | RNA (37-MER) | A | 100.0 /100.0 |
20 /20 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7krn[2] | G | RNA (43-MER) | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7krp[1] | F | RNA (36-MER) | A | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7l1f[1] | D | RNA (5'-R(P*CP*UP*AP*AP*GP*AP*AP*GP*CP*UP*AP*UP*U*.. | A | 100.0 /100.0 |
17 /17 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7l1f[1] | E | RNA (5'-R(P*AP*UP*UP*UP*UP*AP*AP*UP*AP*GP*CP*UP*UP.. | A | 100.0 /100.0 |
14 /14 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7oyg[2] | D | RNA (5'-R(P*CP*UP*AP*CP*GP*CP*AP*GP*UP*G)-3') | A | 100.0 /100.0 |
14 /14 |
R1AB_SARS2 SARS-CoV-2 RNA-dependent RNA polymerase (nsp12) | |
7oyg[2] | E | RNA (5'-R(P*UP*GP*CP*AP*CP*UP*GP*CP*GP*UP*AP*G)-3'.. | A | 100.0 /100.0 |
29 /29 |
R1AB_SARS2 SARS-CoV-2 RNA-dependent RNA polymerase (nsp12) | |
7ozu[1] | D | Product RNA | A | 100.0 /100.0 |
14 /14 |
R1AB_SARS2 Replicase polyprotein 1ab | |
7ozu[2] | E | Template RNA | A | 100.0 /100.0 |
30 /30 |
R1AB_SARS2 Replicase polyprotein 1ab | |
7ozv[1] | D | Product RNA | A | 100.0 /100.0 |
12 /12 |
R1AB_SARS2 Replicase polyprotein 1ab | |
7rdx[1] | H | Template RNA | A | 100.0 /100.0 |
34 /34 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7rdy[1] | H | Template RNA | A | 100.0 /100.0 |
32 /32 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7rdz[6] | H | Template RNA | A | 100.0 /100.0 |
31 /31 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7uo4[1] | E | Product RNA (35-MER) | A | 100.0 /100.0 |
16 /16 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7uo4[1] | F | Template RNA (55-MER) | A | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7uo7[1] | D | Product RNA (35-MER) | A | 100.0 /100.0 |
17 /17 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7uo7[1] | E | Template RNA (55-MER) | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7uo9[1] | D | Product RNA (35-MER) | A | 100.0 /100.0 |
13 /13 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7uo9[2] | E | Template RNA (55-MER) | A | 100.0 /100.0 |
34 /34 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7uob[2] | E | Product RNA (35-MER) | A | 100.0 /100.0 |
10 /10 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7uob[1] | F | Template RNA (55-MER) | A | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7uoe[1] | F | Template RNA (55-MER) | A | 100.0 /100.0 |
30 /30 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gw1[3] | F | Template | A | 100.0 /99.9 |
23 /23 |
R1AB_SARS2 Replicase polyprotein 1ab | |
8gwb[1] | H | RNA (5'-R(P*AP*U)-3') | A | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gwb[6] | J | template | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gwe[1] | H | RNA (5'-R(P*AP*UP*UP*A)-3') | A | 100.0 /100.0 |
15 /15 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8sq9[1] | F | Primer RNA | A | 100.0 /100.0 |
14 /14 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8sqj[1] | F | Primer RNA | A | 100.0 /100.0 |
12 /12 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8sqj[1] | G | Template RNA | A | 100.0 /100.0 |
23 /23 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8sqj[1] | H | SARS-CoV-2 5' UTR | A | 100.0 /100.0 |
18 /18 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8sqk[1] | F | Primer RNA | A | 100.0 /100.0 |
12 /12 |
R1AB_SARS2 RNA-directed RNA polymerase nsp12 | |
8sqk[1] | G | Template RNA | A | 100.0 /100.0 |
23 /23 |
R1AB_SARS2 RNA-directed RNA polymerase nsp12 | |
8sqk[1] | H | SARS-CoV-2 5' UTR | A | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 RNA-directed RNA polymerase nsp12 | |
7cxm[2] | F | RNA (26-MER) | A | 100.0 /99.9 |
23 /23 |
R1AB_SARS2 RNA-directed RNA polymerase | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
COMPOUND | |||||||
932 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
6xez[12] | L |
ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms] |
A | 100.0 /100.0 |
11 /11 |
R1AB_SARS2 RNA-directed RNA polymerase | |
6xez[8] | M |
1N7
CHAPSO[35 atoms] |
A | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 RNA-directed RNA polymerase | |
6xez[8] | N |
1N7
CHAPSO[26 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 RNA-directed RNA polymerase | |
6xez[10] | U |
1N7
CHAPSO[36 atoms] |
A | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7aap[2] | M |
GE6
[[(2~{R},3~{S},4~{R},5~{R})-5-(3-aminocarbonyl-5-f.. |
A | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Non-structural protein 12 | |
7bv2[1] | K |
F86
[(2~{R},3~{S},4~{R},5~{R})-5-(4-azanylpyrrolo[2,1-.. |
A | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gwk[1] | T |
F86
[(2~{R},3~{S},4~{R},5~{R})-5-(4-azanylpyrrolo[2,1-.. |
A | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7cyq[1] | L |
GDP
GUANOSINE-5'-DIPHOSPHATE[28 atoms] |
A | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7d4f[1] | G |
H3U
8-(3-(3-aminobenzamido)-4-methylbenzamido)naphthal.. |
D | 100.0 /100.0 |
12 /12 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7d4f[1] | H |
H3U
8-(3-(3-aminobenzamido)-4-methylbenzamido)naphthal.. |
D | 100.0 /100.0 |
12 /12 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7dfg[1] | G |
1RP
6-fluoro-3-oxo-4-(5-O-phosphono-beta-D-ribofuranos.. |
C | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7dfh[1] | N |
RVP
RIBAVIRIN MONOPHOSPHATE[20 atoms] |
A | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 RNA-directed RNA polymeras | |
7doi[2] | O |
HCU
[(2R)-4-(2-azanyl-6-oxidanylidene-3H-purin-9-yl)-2.. |
A | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7uo4[1] | G |
NWX
[[(2~{R},3~{S},4~{R},5~{R})-5-(4-azanylpyrrolo[2,1.. |
A | 100.0 /100.0 |
17 /17 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7uo7[1] | G |
ATP
ADENOSINE-5'-TRIPHOSPHATE[31 atoms] |
A | 100.0 /100.0 |
14 /14 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7uo9[1] | J |
UTP
URIDINE 5'-TRIPHOSPHATE [29 atoms] |
A | 100.0 /100.0 |
12 /12 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7uob[1] | L |
GTP
GUANOSINE-5'-TRIPHOSPHATE[32 atoms] |
A | 100.0 /100.0 |
16 /16 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7uob[4] | M |
GTP
GUANOSINE-5'-TRIPHOSPHATE[32 atoms] |
A | 100.0 /100.0 |
19 /19 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7uob[2] | N |
L2B
3'-DEOXYURIDINE-5'-MONOPHOSPHATE[19 atoms] |
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7uoe[1] | K |
CTP
CYTIDINE-5'-TRIPHOSPHATE[29 atoms] |
A | 100.0 /100.0 |
14 /14 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gw1[2] | T |
U5P
URIDINE-5'-MONOPHOSPHATE[20 atoms] |
A | 100.0 /99.9 |
8 /8 |
R1AB_SARS2 Replicase polyprotein 1ab | |
8gwe[5] | M |
GNP
PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER[32 ato.. |
A | 100.0 /100.0 |
13 /13 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gwm[1] | S |
6GS
2'-deoxy-2'-fluoro-2'-methyluridine 5'-(trihydroge.. |
A | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gy6[1] | E |
GO3
Gossypol[38 atoms] |
A | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gy6[1] | F |
GO3
Gossypol[38 atoms] |
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8sq9[1] | L |
WSB
5'-O-[(S)-hydroxy{[(S)-hydroxy(phosphonooxy)phosph.. |
A | 100.0 /100.0 |
15 /15 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8sq9[1] | O |
WSB
5'-O-[(S)-hydroxy{[(S)-hydroxy(phosphonooxy)phosph.. |
A | 100.0 /100.0 |
12 /12 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8sqj[2] | I |
VSN
5'-O-[(R)-hydroxy(thiophosphonooxy)phosphoryl]guan.. |
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8sqk[1] | J |
VSN
5'-O-[(R)-hydroxy(thiophosphonooxy)phosphoryl]guan.. |
A | 100.0 /100.0 |
17 /17 |
R1AB_SARS2 RNA-directed RNA polymerase nsp12 | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
METAL | |||||||
932 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
6nur[4] | E |
ZN
ZINC ION[1 atoms] |
A | 100.0 /97.0 |
4 /4 |
R1AB_CVHSA NSP12 | |
6nur[4] | F |
ZN
ZINC ION[1 atoms] |
A | 100.0 /97.0 |
4 /4 |
R1AB_CVHSA NSP12 | |
6xez[43] | I |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 RNA-directed RNA polymerase | |
6xez[43] | J |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 RNA-directed RNA polymerase | |
6xqb[8] | G |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 RNA-directed RNA polymerase | |
6xqb[8] | H |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 RNA-directed RNA polymerase | |
6yyt[5] | I |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 nsp12 | |
6yyt[5] | J |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 nsp12 | |
7bw4[1] | E |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7bw4[1] | F |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 RNA-directed RNA polymerase | |
6xez[26] | K |
MG
MAGNESIUM ION[1 atoms] |
A | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 RNA-directed RNA polymerase | |
6xqb[22] | I |
MG
MAGNESIUM ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gwe[1] | N |
MG
MAGNESIUM ION[1 atoms] |
A | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gwk[1] | M |
MG
MAGNESIUM ION[1 atoms] |
A | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7thm[5] | H |
MN
MANGANESE (II) ION[1 atoms] |
A | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 RNA-directed RNA polymerase | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
HOMO | |||||||
932 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
7egq[2] | I | R1AB_SARS2 RNA-directed RNA polymerase[926 aa] | A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7re3[2] | J | R1AB_SARS2 RNA-directed RNA polymerase[927 aa] | A | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 RNA-directed RNA polymerase | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
PRECIPITANT | |||||||
932 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
7aap[2] | K |
POP
PYROPHOSPHATE 2-[9 atoms] |
A | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Non-structural protein 12 | |
7bv2[5] | H |
POP
PYROPHOSPHATE 2-[9 atoms] |
A | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7dfg[4] | M |
POP
PYROPHOSPHATE 2-[9 atoms] |
C | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 RNA-directed RNA polymerase | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. |