HOMCOS(prot_sch_conbars.cgi):

		Contact Molecules for Homologous Proteins
[Summary Bars]	[SiteTable]	Full Bars[40 %]	[Back to Search Page]	[Back to HOMCOS]
[SupCon3D]	[help]	seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]	[show] [download] [help]

PID

QueryLength

Homolgous Sequence in PDB

UniProt Query

TITLE

11352

740

Q92499(DDX1_HUMAN)

RecName: Full=ATP-dependent RNA helicase DDX1; EC=3.6.4.13 ;AltName: Full=DEAD box protein 1;AltName: Full=DEAD box protein retinoblastoma; Short=DBP-RB;

QUERYSEQ

MAAFSEMGVMPEIAQAVEEMDWLLPTDIQAESIPLILGGGDVLMAAETGSGKTGAFSIPVIQIVYETLKDQQEGKKGKTTIKTGASVLNKWQMNPYDRGSAFAIGSDGLCCQSREVKEWHGCRATKGLMKGKHYYEVSCHDQGLCRVGWS
TMQASLDLGTDKFGFGFGGTGKKSHNKQFDNYGEEFTMHDTIGCYLDIDKGHVKFSKNGKDLGLAFEIPPHMKNQALFPACVLKNAELKFNFGEEEFKFPPKDGFVALSKAPDGYIVKSQHSGNAQVTQTKFLPNAPKALIVEPSRELAE
QTLNNIKQFKKYIDNPKLRELLIIGGVAARDQLSVLENGVDIVVGTPGRLDDLVSTGKLNLSQVRFLVLDEADGLLSQGYSDFINRMHNQIPQVTSDGKRLQVIVCSATLHSFDVKKLSEKIMHFPTWVDLKGEDSVPDTVHHVVVPVNP
KTDRLWERLGKSHIRTDDVHAKDNTRPGANSPEMWSEAIKILKGEYAVRAIKEHKMDQAIIFCRTKIDCDNLEQYFIQQGGGPDKKGHQFSCVCLHGDRKPHERKQNLERFKKGDVRFLICTDVAARGIDIHGVPYVINVTLPDEKQNYV
HRIGRVGRAERMGLAISLVATEKEKVWYHVCSSRGKGCYNTRLKEDGGCTIWYNEMQLLSEIEEHLNCTISQVEPDIKVPVDEFDGKVTYGQKRAAGGGSYKGHVDILAPTVQELAALEKEAQTSFLHLGYLPNQLFRTF

[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [Q92499(DDX1_HUMAN)]

740
	region	name	description
	1-740	CHAIN	/note="ATP-dependent RNA helicase DDX1" /id="PRO_0000054986"
	2-428	DOMAIN	/note="Helicase ATP-binding"
	70-247	DOMAIN	/note="B30.2/SPRY"
	493-681	DOMAIN	/note="Helicase C-terminal"
	1-525	REGION	/note="Necessary for interaction with RELA"
	1-448	REGION	/note="Interaction with dsRNA"
	1-295	REGION	/note="Necessary for interaction with HNRNPK"
	525-740	REGION	/note="Necessary for interaction with HNRNPK"
	536-631	REGION	/note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV"
	46-53	BINDING	/ligand="ATP" /ligand_id="ChEBI:CHEBI:30616"
	1-718	DISORDER	predicted by DISOPRED

MONOMER

740

pdb_id a¹ identity[%]² description

8tbx A 100.0 DDX1_HUMAN DDX1_HUMAN ATP-dependent RNA helicase DDX1

4xw3 B 100.0 A3RJH1_HUMAN ATP-dependent RNA helicase DDX1

4xw3 A 100.0 A3RJH1_HUMAN ATP-dependent RNA helicase DDX1

2jgn C 44.9 DDX3X_HUMAN ATP-DEPENDENT RNA HELICASE DDX3X

2hjv A 47.6 DBPA_BACSU ATP-dependent RNA helicase dbpA

2hjv B 47.2 DBPA_BACSU ATP-dependent RNA helicase dbpA

5gi4 B 40.0 DEAD_ECOLI ATP-dependent RNA helicase DeaD

5gi4 A 40.0 DEAD_ECOLI ATP-dependent RNA helicase DeaD

7bbb A 41.5 DBPA_ECOLI ATP-dependent RNA helicase DbpA

1fuk A 42.6 IF4A_YEAST EUKARYOTIC INITIATION FACTOR 4A

5nt7 A 40.2 VASA1_DROME ATP-dependent RNA helicase vasa, isoform A

5nt7 D 40.2 VASA1_DROME ATP-dependent RNA helicase vasa, isoform A

2jgn B 41.7 DDX3X_HUMAN ATP-DEPENDENT RNA HELICASE DDX3X

3ear A 40.2 Q72GF3_THET2 Hera

7ymf B 40.9 DDX3X_HUMAN ATP-dependent RNA helicase DDX3X

2kbf A 46.1 DBP5_YEAST ATP-dependent RNA helicase DBP5

3gfp A 46.1 DBP5_YEAST DEAD box protein 5

5gju A 40.4 DEAD_ECOLI ATP-dependent RNA helicase DeaD

3i32 A 41.1 Q72GF3_THET2 Heat resistant RNA dependent ATPase

3eaq A 42.5 Q72GF3_THET2 Heat resistant RNA dependent ATPase

2rb4 A 41.7 DDX25_HUMAN ATP-dependent RNA helicase DDX25

3eas A 42.5 Q72GF3_THET2 Hera

2jgn A 40.2 DDX3X_HUMAN ATP-DEPENDENT RNA HELICASE DDX3X

2rb4 B 42.2 DDX25_HUMAN ATP-dependent RNA helicase DDX25

3eas B 41.9 Q72GF3_THET2 Hera

3eaq B 41.9 Q72GF3_THET2 Heat resistant RNA dependent ATPase

6yvh F 40.6 IF4A3_HUMAN Eukaryotic initiation factor 4A-III

7ohx I 43.4 HAS1_YEAST ATP-dependent RNA helicase HAS1

5z3g Y 43.4 HAS1_YEAST ATP-dependent RNA helicase HAS1

7ohw J 43.4 HAS1_YEAST ATP-dependent RNA helicase HAS1

6c0f IA 43.4 HAS1_YEAST ATP-dependent RNA helicase HAS1

7ohr G 43.4 HAS1_YEAST ATP-dependent RNA helicase HAS1

7ohv G 43.4 HAS1_YEAST ATP-dependent RNA helicase HAS1

7ohs J 43.4 HAS1_YEAST ATP-dependent RNA helicase HAS1

7r6q B 43.4 HAS1_YEAST ATP-dependent RNA helicase HAS1

8e5t U 43.4 HAS1_YEAST ATP-dependent RNA helicase HAS1

6cb1 JA 43.4 A0A250WER3_YEASX ATP-dependent RNA helicase HAS1

3peu A 46.0 DBP5_YEAST ATP-dependent RNA helicase DBP5

3pev A 46.0 DBP5_YEAST ATP-dependent RNA helicase DBP5

7r7a AB 44.0 HAS1_YEAST ATP-dependent RNA helicase HAS1

7nac AB 44.0 HAS1_YEAST ATP-dependent RNA helicase HAS1

6em4 EA 44.3 HAS1_YEAST ATP-dependent RNA helicase HAS1

6em3 AA 44.3 HAS1_YEAST ATP-dependent RNA helicase HAS1

6em5 GA 44.3 HAS1_YEAST ATP-dependent RNA helicase HAS1

6em1 NA 44.3 HAS1_YEAST ATP-dependent RNA helicase HAS1

6elz HA 44.3 HAS1_YEAST ATP-dependent RNA helicase HAS1

8eti J 41.9 HAS1_SCHPO ATP-dependent RNA helicase has1

8eup J 41.8 S6CCW7_SCHPM RNA helicase

1.a¹:asym_id for the homologue. 2.identity[%]²:sequence identity between the query and the homologue.

HETERO

740 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

3peu B GLE1_YEAST Nucleoporin GLE1[295 aa] A 36.4
/46.0 11
/24 DBP5_YEAST ATP-dependent RNA helicase DBP5

3peu B GLE1_YEAST Nucleoporin GLE1[295 aa] A 40.0
/46.0 10
/14 DBP5_YEAST ATP-dependent RNA helicase DBP5

3pev B GLE1_YEAST Nucleoporin GLE1[295 aa] A 40.0
/46.0 10
/23 DBP5_YEAST ATP-dependent RNA helicase DBP5

3pev B GLE1_YEAST Nucleoporin GLE1[295 aa] A 40.0
/46.0 10
/15 DBP5_YEAST ATP-dependent RNA helicase DBP5

6elz FA CIC1_YEAST Proteasome-interacting protein CIC1[257 aa] HA 0.0
/44.3 1
/15 HAS1_YEAST ATP-dependent RNA helicase HAS1

6em1 LA CIC1_YEAST Proteasome-interacting protein CIC1[257 aa] NA 0.0
/44.3 1
/15 HAS1_YEAST ATP-dependent RNA helicase HAS1

8eti GA RL36B_SCHPO 60S ribosomal protein L36-B[85 aa] J 0.0
/41.9 3
/3 HAS1_SCHPO ATP-dependent RNA helicase has1

8eup DA RL36B_SCHPO 60S ribosomal protein L36-B[98 aa] J 25.0
/41.8 4
/4 S6CCW7_SCHPM RNA helicase

6yvh A CWC22_HUMAN Pre-mRNA-splicing factor CWC22 homolog[274 aa] F 42.9
/40.6 7
/23 IF4A3_HUMAN Eukaryotic initiation factor 4A-III

6yvh E CWC22_HUMAN Pre-mRNA-splicing factor CWC22 homolog[272 aa] F 50.0
/40.6 12
/12 IF4A3_HUMAN Eukaryotic initiation factor 4A-III

5nt7 B OSKA_DROME Maternal effect protein oskar[92 aa] A 34.8
/40.2 23
/23 VASA1_DROME ATP-dependent RNA helicase vasa, isoform A

5nt7 C OSKA_DROME Maternal effect protein oskar[92 aa] D 34.8
/40.2 23
/23 VASA1_DROME ATP-dependent RNA helicase vasa, isoform A

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

NUCLEOTIDE

740 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

6elz A 25S ribosomal RNA HA 0.0
/44.3 1
/5 HAS1_YEAST ATP-dependent RNA helicase HAS1

8eti A RNA (1564-MER) J 20.0
/41.9 5
/6 HAS1_SCHPO ATP-dependent RNA helicase has1

8eup A RNA (1422-MER) J 28.6
/41.8 7
/10 S6CCW7_SCHPM RNA helicase

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

COMPOUND

740 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

8tbx B ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms] A 100.0
/100.0 15
/15 DDX1_HUMAN DDX1_HUMAN ATP-dependent RNA helicase DDX1

5gju B AMP
ADENOSINE MONOPHOSPHATE[23 atoms] A 72.7
/40.4 11
/11 DEAD_ECOLI ATP-dependent RNA helicase DeaD

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

METAL

740 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

1fuk B ZN
ZINC ION[1 atoms] A 33.3
/42.6 3
/3 IF4A_YEAST EUKARYOTIC INITIATION FACTOR 4A

2rb4 F ZN
ZINC ION[1 atoms] A 50.0
/41.7 2
/2 DDX25_HUMAN ATP-dependent RNA helicase DDX25

8tbx D ZN
ZINC ION[1 atoms] A 100.0
/100.0 4
/4 DDX1_HUMAN DDX1_HUMAN ATP-dependent RNA helicase DDX1

8tbx C MG
MAGNESIUM ION[1 atoms] A 100.0
/100.0 3
/3 DDX1_HUMAN DDX1_HUMAN ATP-dependent RNA helicase DDX1

2rb4 C CL
CHLORIDE ION[1 atoms] A 100.0
/41.7 1
/1 DDX25_HUMAN ATP-dependent RNA helicase DDX25

2rb4 D CL
CHLORIDE ION[1 atoms] A 50.0
/41.7 2
/2 DDX25_HUMAN ATP-dependent RNA helicase DDX25

3eaq C CL
CHLORIDE ION[1 atoms] A 100.0
/42.5 3
/3 Q72GF3_THET2 Heat resistant RNA dependent ATPase

3eaq D CL
CHLORIDE ION[1 atoms] B 0.0
/41.9 1
/3 Q72GF3_THET2 Heat resistant RNA dependent ATPase

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

PRECIPITANT

740 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

2rb4 E SO4
SULFATE ION[5 atoms] A 0.0
/41.7 2
/2 DDX25_HUMAN ATP-dependent RNA helicase DDX25

2rb4 G SO4
SULFATE ION[5 atoms] B 0.0
/42.2 2
/2 DDX25_HUMAN ATP-dependent RNA helicase DDX25

3peu C SO4
SULFATE ION[5 atoms] A 100.0
/46.0 2
/2 DBP5_YEAST ATP-dependent RNA helicase DBP5

3peu C SO4
SULFATE ION[5 atoms] A 100.0
/46.0 2
/2 DBP5_YEAST ATP-dependent RNA helicase DBP5

3pev C SO4
SULFATE ION[5 atoms] A 100.0
/46.0 2
/2 DBP5_YEAST ATP-dependent RNA helicase DBP5

3pev C SO4
SULFATE ION[5 atoms] A 100.0
/46.0 2
/2 DBP5_YEAST ATP-dependent RNA helicase DBP5

3peu D GOL
GLYCEROL[6 atoms] A 57.1
/46.0 7
/7 DBP5_YEAST ATP-dependent RNA helicase DBP5

3peu D GOL
GLYCEROL[6 atoms] A 57.1
/46.0 7
/7 DBP5_YEAST ATP-dependent RNA helicase DBP5

3pev D GOL
GLYCEROL[6 atoms] A 50.0
/46.0 8
/8 DBP5_YEAST ATP-dependent RNA helicase DBP5

3pev D GOL
GLYCEROL[6 atoms] A 50.0
/46.0 8
/8 DBP5_YEAST ATP-dependent RNA helicase DBP5

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

MONOMER
740
	pdb_id	a¹	identity[%]²	description
	8tbx	A	100.0	DDX1_HUMAN DDX1_HUMAN ATP-dependent RNA helicase DDX1
	4xw3	B	100.0	A3RJH1_HUMAN ATP-dependent RNA helicase DDX1
	4xw3	A	100.0	A3RJH1_HUMAN ATP-dependent RNA helicase DDX1
	2jgn	C	44.9	DDX3X_HUMAN ATP-DEPENDENT RNA HELICASE DDX3X
	2hjv	A	47.6	DBPA_BACSU ATP-dependent RNA helicase dbpA
	2hjv	B	47.2	DBPA_BACSU ATP-dependent RNA helicase dbpA
	5gi4	B	40.0	DEAD_ECOLI ATP-dependent RNA helicase DeaD
	5gi4	A	40.0	DEAD_ECOLI ATP-dependent RNA helicase DeaD
	7bbb	A	41.5	DBPA_ECOLI ATP-dependent RNA helicase DbpA
	1fuk	A	42.6	IF4A_YEAST EUKARYOTIC INITIATION FACTOR 4A
	5nt7	A	40.2	VASA1_DROME ATP-dependent RNA helicase vasa, isoform A
	5nt7	D	40.2	VASA1_DROME ATP-dependent RNA helicase vasa, isoform A
	2jgn	B	41.7	DDX3X_HUMAN ATP-DEPENDENT RNA HELICASE DDX3X
	3ear	A	40.2	Q72GF3_THET2 Hera
	7ymf	B	40.9	DDX3X_HUMAN ATP-dependent RNA helicase DDX3X
	2kbf	A	46.1	DBP5_YEAST ATP-dependent RNA helicase DBP5
	3gfp	A	46.1	DBP5_YEAST DEAD box protein 5
	5gju	A	40.4	DEAD_ECOLI ATP-dependent RNA helicase DeaD
	3i32	A	41.1	Q72GF3_THET2 Heat resistant RNA dependent ATPase
	3eaq	A	42.5	Q72GF3_THET2 Heat resistant RNA dependent ATPase
	2rb4	A	41.7	DDX25_HUMAN ATP-dependent RNA helicase DDX25
	3eas	A	42.5	Q72GF3_THET2 Hera
	2jgn	A	40.2	DDX3X_HUMAN ATP-DEPENDENT RNA HELICASE DDX3X
	2rb4	B	42.2	DDX25_HUMAN ATP-dependent RNA helicase DDX25
	3eas	B	41.9	Q72GF3_THET2 Hera
	3eaq	B	41.9	Q72GF3_THET2 Heat resistant RNA dependent ATPase
	6yvh	F	40.6	IF4A3_HUMAN Eukaryotic initiation factor 4A-III
	7ohx	I	43.4	HAS1_YEAST ATP-dependent RNA helicase HAS1
	5z3g	Y	43.4	HAS1_YEAST ATP-dependent RNA helicase HAS1
	7ohw	J	43.4	HAS1_YEAST ATP-dependent RNA helicase HAS1
	6c0f	IA	43.4	HAS1_YEAST ATP-dependent RNA helicase HAS1
	7ohr	G	43.4	HAS1_YEAST ATP-dependent RNA helicase HAS1
	7ohv	G	43.4	HAS1_YEAST ATP-dependent RNA helicase HAS1
	7ohs	J	43.4	HAS1_YEAST ATP-dependent RNA helicase HAS1
	7r6q	B	43.4	HAS1_YEAST ATP-dependent RNA helicase HAS1
	8e5t	U	43.4	HAS1_YEAST ATP-dependent RNA helicase HAS1
	6cb1	JA	43.4	A0A250WER3_YEASX ATP-dependent RNA helicase HAS1
	3peu	A	46.0	DBP5_YEAST ATP-dependent RNA helicase DBP5
	3pev	A	46.0	DBP5_YEAST ATP-dependent RNA helicase DBP5
	7r7a	AB	44.0	HAS1_YEAST ATP-dependent RNA helicase HAS1
	7nac	AB	44.0	HAS1_YEAST ATP-dependent RNA helicase HAS1
	6em4	EA	44.3	HAS1_YEAST ATP-dependent RNA helicase HAS1
	6em3	AA	44.3	HAS1_YEAST ATP-dependent RNA helicase HAS1
	6em5	GA	44.3	HAS1_YEAST ATP-dependent RNA helicase HAS1
	6em1	NA	44.3	HAS1_YEAST ATP-dependent RNA helicase HAS1
	6elz	HA	44.3	HAS1_YEAST ATP-dependent RNA helicase HAS1
	8eti	J	41.9	HAS1_SCHPO ATP-dependent RNA helicase has1
	8eup	J	41.8	S6CCW7_SCHPM RNA helicase
	1.a¹:asym_id for the homologue. 2.identity[%]²:sequence identity between the query and the homologue.

HETERO
740	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	3peu	B	GLE1_YEAST Nucleoporin GLE1[295 aa]	A	36.4 /46.0	11 /24	DBP5_YEAST ATP-dependent RNA helicase DBP5
	3peu	B	GLE1_YEAST Nucleoporin GLE1[295 aa]	A	40.0 /46.0	10 /14	DBP5_YEAST ATP-dependent RNA helicase DBP5
	3pev	B	GLE1_YEAST Nucleoporin GLE1[295 aa]	A	40.0 /46.0	10 /23	DBP5_YEAST ATP-dependent RNA helicase DBP5
	3pev	B	GLE1_YEAST Nucleoporin GLE1[295 aa]	A	40.0 /46.0	10 /15	DBP5_YEAST ATP-dependent RNA helicase DBP5
	6elz	FA	CIC1_YEAST Proteasome-interacting protein CIC1[257 aa]	HA	0.0 /44.3	1 /15	HAS1_YEAST ATP-dependent RNA helicase HAS1
	6em1	LA	CIC1_YEAST Proteasome-interacting protein CIC1[257 aa]	NA	0.0 /44.3	1 /15	HAS1_YEAST ATP-dependent RNA helicase HAS1
	8eti	GA	RL36B_SCHPO 60S ribosomal protein L36-B[85 aa]	J	0.0 /41.9	3 /3	HAS1_SCHPO ATP-dependent RNA helicase has1
	8eup	DA	RL36B_SCHPO 60S ribosomal protein L36-B[98 aa]	J	25.0 /41.8	4 /4	S6CCW7_SCHPM RNA helicase
	6yvh	A	CWC22_HUMAN Pre-mRNA-splicing factor CWC22 homolog[274 aa]	F	42.9 /40.6	7 /23	IF4A3_HUMAN Eukaryotic initiation factor 4A-III
	6yvh	E	CWC22_HUMAN Pre-mRNA-splicing factor CWC22 homolog[272 aa]	F	50.0 /40.6	12 /12	IF4A3_HUMAN Eukaryotic initiation factor 4A-III
	5nt7	B	OSKA_DROME Maternal effect protein oskar[92 aa]	A	34.8 /40.2	23 /23	VASA1_DROME ATP-dependent RNA helicase vasa, isoform A
	5nt7	C	OSKA_DROME Maternal effect protein oskar[92 aa]	D	34.8 /40.2	23 /23	VASA1_DROME ATP-dependent RNA helicase vasa, isoform A
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
NUCLEOTIDE
740	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	6elz	A	25S ribosomal RNA	HA	0.0 /44.3	1 /5	HAS1_YEAST ATP-dependent RNA helicase HAS1
	8eti	A	RNA (1564-MER)	J	20.0 /41.9	5 /6	HAS1_SCHPO ATP-dependent RNA helicase has1
	8eup	A	RNA (1422-MER)	J	28.6 /41.8	7 /10	S6CCW7_SCHPM RNA helicase
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
COMPOUND
740	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	8tbx	B	ADP ADENOSINE-5'-DIPHOSPHATE[27 atoms]	A	100.0 /100.0	15 /15	DDX1_HUMAN DDX1_HUMAN ATP-dependent RNA helicase DDX1
	5gju	B	AMP ADENOSINE MONOPHOSPHATE[23 atoms]	A	72.7 /40.4	11 /11	DEAD_ECOLI ATP-dependent RNA helicase DeaD
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
METAL
740	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	1fuk	B	ZN ZINC ION[1 atoms]	A	33.3 /42.6	3 /3	IF4A_YEAST EUKARYOTIC INITIATION FACTOR 4A
	2rb4	F	ZN ZINC ION[1 atoms]	A	50.0 /41.7	2 /2	DDX25_HUMAN ATP-dependent RNA helicase DDX25
	8tbx	D	ZN ZINC ION[1 atoms]	A	100.0 /100.0	4 /4	DDX1_HUMAN DDX1_HUMAN ATP-dependent RNA helicase DDX1
	8tbx	C	MG MAGNESIUM ION[1 atoms]	A	100.0 /100.0	3 /3	DDX1_HUMAN DDX1_HUMAN ATP-dependent RNA helicase DDX1
	2rb4	C	CL CHLORIDE ION[1 atoms]	A	100.0 /41.7	1 /1	DDX25_HUMAN ATP-dependent RNA helicase DDX25
	2rb4	D	CL CHLORIDE ION[1 atoms]	A	50.0 /41.7	2 /2	DDX25_HUMAN ATP-dependent RNA helicase DDX25
	3eaq	C	CL CHLORIDE ION[1 atoms]	A	100.0 /42.5	3 /3	Q72GF3_THET2 Heat resistant RNA dependent ATPase
	3eaq	D	CL CHLORIDE ION[1 atoms]	B	0.0 /41.9	1 /3	Q72GF3_THET2 Heat resistant RNA dependent ATPase
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
740	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	2rb4	E	SO4 SULFATE ION[5 atoms]	A	0.0 /41.7	2 /2	DDX25_HUMAN ATP-dependent RNA helicase DDX25
	2rb4	G	SO4 SULFATE ION[5 atoms]	B	0.0 /42.2	2 /2	DDX25_HUMAN ATP-dependent RNA helicase DDX25
	3peu	C	SO4 SULFATE ION[5 atoms]	A	100.0 /46.0	2 /2	DBP5_YEAST ATP-dependent RNA helicase DBP5
	3peu	C	SO4 SULFATE ION[5 atoms]	A	100.0 /46.0	2 /2	DBP5_YEAST ATP-dependent RNA helicase DBP5
	3pev	C	SO4 SULFATE ION[5 atoms]	A	100.0 /46.0	2 /2	DBP5_YEAST ATP-dependent RNA helicase DBP5
	3pev	C	SO4 SULFATE ION[5 atoms]	A	100.0 /46.0	2 /2	DBP5_YEAST ATP-dependent RNA helicase DBP5
	3peu	D	GOL GLYCEROL[6 atoms]	A	57.1 /46.0	7 /7	DBP5_YEAST ATP-dependent RNA helicase DBP5
	3peu	D	GOL GLYCEROL[6 atoms]	A	57.1 /46.0	7 /7	DBP5_YEAST ATP-dependent RNA helicase DBP5
	3pev	D	GOL GLYCEROL[6 atoms]	A	50.0 /46.0	8 /8	DBP5_YEAST ATP-dependent RNA helicase DBP5
	3pev	D	GOL GLYCEROL[6 atoms]	A	50.0 /46.0	8 /8	DBP5_YEAST ATP-dependent RNA helicase DBP5
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

Contact Molecules for Homologous Proteins

Full Bars[40 %]

UniProt Feature Tables [Q92499(DDX1_HUMAN)]