Contact Molecules for Homologous Proteins | ||||
![]() [Summary Bars] |
![]() [SiteTable] |
|
![]() [Back to Search Page] |
![]() [Back to HOMCOS] |
![]() [SupCon3D] |
![]() [help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | ![]() [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
11352 | 740 | 50 | Q92499(DDX1_HUMAN) | RecName: Full=ATP-dependent RNA helicase DDX1; EC=3.6.4.13 ;AltName: Full=DEAD box protein 1;AltName: Full=DEAD box protein retinoblastoma; Short=DBP-RB; |
QUERYSEQ |
MAAFSEMGVMPEIAQAVEEMDWLLPTDIQAESIPLILGGGDVLMAAETGSGKTGAFSIPVIQIVYETLKDQQEGKKGKTTIKTGASVLNKWQMNPYDRGSAFAIGSDGLCCQSREVKEWHGCRATKGLMKGKHYYEVSCHDQGLCRVGWS TMQASLDLGTDKFGFGFGGTGKKSHNKQFDNYGEEFTMHDTIGCYLDIDKGHVKFSKNGKDLGLAFEIPPHMKNQALFPACVLKNAELKFNFGEEEFKFPPKDGFVALSKAPDGYIVKSQHSGNAQVTQTKFLPNAPKALIVEPSRELAE QTLNNIKQFKKYIDNPKLRELLIIGGVAARDQLSVLENGVDIVVGTPGRLDDLVSTGKLNLSQVRFLVLDEADGLLSQGYSDFINRMHNQIPQVTSDGKRLQVIVCSATLHSFDVKKLSEKIMHFPTWVDLKGEDSVPDTVHHVVVPVNP KTDRLWERLGKSHIRTDDVHAKDNTRPGANSPEMWSEAIKILKGEYAVRAIKEHKMDQAIIFCRTKIDCDNLEQYFIQQGGGPDKKGHQFSCVCLHGDRKPHERKQNLERFKKGDVRFLICTDVAARGIDIHGVPYVINVTLPDEKQNYV HRIGRVGRAERMGLAISLVATEKEKVWYHVCSSRGKGCYNTRLKEDGGCTIWYNEMQLLSEIEEHLNCTISQVEPDIKVPVDEFDGKVTYGQKRAAGGGSYKGHVDILAPTVQELAALEKEAQTSFLHLGYLPNQLFRTF |
740 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
region | name | description |
![]() |
1-740 | CHAIN | /note="ATP-dependent RNA helicase DDX1" /id="PRO_0000054986" |
![]() ![]() |
2-428 | DOMAIN | /note="Helicase ATP-binding" |
![]() ![]() ![]() |
70-247 | DOMAIN | /note="B30.2/SPRY" |
![]() ![]() ![]() |
493-681 | DOMAIN | /note="Helicase C-terminal" |
![]() ![]() |
1-525 | REGION | /note="Necessary for interaction with RELA" |
![]() ![]() |
1-448 | REGION | /note="Interaction with dsRNA" |
![]() ![]() |
1-295 | REGION | /note="Necessary for interaction with HNRNPK" |
![]() ![]() |
525-740 | REGION | /note="Necessary for interaction with HNRNPK" |
![]() ![]() ![]() |
536-631 | REGION | /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" |
![]() ![]() ![]() |
46-53 | BINDING | /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
1-718 | DISORDER | predicted by DISOPRED |
![]() |
|||||||
740 | |||||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
pdb_id | a1 | identity[%]2 | description | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | 100.0 | DDX1_HUMAN DDX1_HUMAN ATP-dependent RNA helicase DDX1 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 100.0 | A3RJH1_HUMAN ATP-dependent RNA helicase DDX1 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | 100.0 | A3RJH1_HUMAN ATP-dependent RNA helicase DDX1 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | 44.9 | DDX3X_HUMAN ATP-DEPENDENT RNA HELICASE DDX3X | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | 47.6 | DBPA_BACSU ATP-dependent RNA helicase dbpA | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 47.2 | DBPA_BACSU ATP-dependent RNA helicase dbpA | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 40.0 | DEAD_ECOLI ATP-dependent RNA helicase DeaD | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | 40.0 | DEAD_ECOLI ATP-dependent RNA helicase DeaD | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | 41.5 | DBPA_ECOLI ATP-dependent RNA helicase DbpA | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | 42.6 | IF4A_YEAST EUKARYOTIC INITIATION FACTOR 4A | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | 40.2 | VASA1_DROME ATP-dependent RNA helicase vasa, isoform A | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | 40.2 | VASA1_DROME ATP-dependent RNA helicase vasa, isoform A | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 41.7 | DDX3X_HUMAN ATP-DEPENDENT RNA HELICASE DDX3X | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | 40.2 | Q72GF3_THET2 Hera | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 40.9 | DDX3X_HUMAN ATP-dependent RNA helicase DDX3X | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | 46.1 | DBP5_YEAST ATP-dependent RNA helicase DBP5 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | 46.1 | DBP5_YEAST DEAD box protein 5 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | 40.4 | DEAD_ECOLI ATP-dependent RNA helicase DeaD | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | 41.1 | Q72GF3_THET2 Heat resistant RNA dependent ATPase | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | 42.5 | Q72GF3_THET2 Heat resistant RNA dependent ATPase | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | 41.7 | DDX25_HUMAN ATP-dependent RNA helicase DDX25 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | 42.5 | Q72GF3_THET2 Hera | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | 40.2 | DDX3X_HUMAN ATP-DEPENDENT RNA HELICASE DDX3X | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 42.2 | DDX25_HUMAN ATP-dependent RNA helicase DDX25 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 41.9 | Q72GF3_THET2 Hera | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 41.9 | Q72GF3_THET2 Heat resistant RNA dependent ATPase | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | 46.1 | DBP10_YEAST ATP-dependent RNA helicase DBP10 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | 40.6 | IF4A3_HUMAN Eukaryotic initiation factor 4A-III | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
I | 43.4 | HAS1_YEAST ATP-dependent RNA helicase HAS1 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
Y | 43.4 | HAS1_YEAST ATP-dependent RNA helicase HAS1 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
J | 43.4 | HAS1_YEAST ATP-dependent RNA helicase HAS1 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
G | 43.4 | HAS1_YEAST ATP-dependent RNA helicase HAS1 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
G | 43.4 | HAS1_YEAST ATP-dependent RNA helicase HAS1 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
IA | 43.4 | HAS1_YEAST ATP-dependent RNA helicase HAS1 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
J | 43.4 | HAS1_YEAST ATP-dependent RNA helicase HAS1 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
U | 43.4 | HAS1_YEAST ATP-dependent RNA helicase HAS1 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
JA | 43.4 | A0A250WER3_YEASX ATP-dependent RNA helicase HAS1 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 43.4 | HAS1_YEAST ATP-dependent RNA helicase HAS1 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | 46.0 | DBP5_YEAST ATP-dependent RNA helicase DBP5 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | 46.0 | DBP5_YEAST ATP-dependent RNA helicase DBP5 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
J | 44.0 | HAS1_YEAST ATP-dependent RNA helicase HAS1 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
AB | 44.0 | HAS1_YEAST ATP-dependent RNA helicase HAS1 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
AB | 44.0 | HAS1_YEAST ATP-dependent RNA helicase HAS1 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
GA | 44.3 | HAS1_YEAST ATP-dependent RNA helicase HAS1 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
EA | 44.3 | HAS1_YEAST ATP-dependent RNA helicase HAS1 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
AA | 44.3 | HAS1_YEAST ATP-dependent RNA helicase HAS1 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
NA | 44.3 | HAS1_YEAST ATP-dependent RNA helicase HAS1 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
HA | 44.3 | HAS1_YEAST ATP-dependent RNA helicase HAS1 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
J | 41.9 | HAS1_SCHPO ATP-dependent RNA helicase has1 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
J | 41.8 | S6CCW7_SCHPM RNA helicase | |||
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue. |
![]() |
|||||||
740 | pdb_id | contact mol | homologue | ||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
a3 | description | a4 | identity[%]5 | Ncon6 | description | |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
AA | RL23A_YEAST 60S ribosomal protein L23-A[122 aa] | C | 25.0 /46.1 |
4 /8 |
DBP10_YEAST ATP-dependent RNA helicase DBP10 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | GLE1_YEAST Nucleoporin GLE1[295 aa] | A | 36.4 /46.0 |
11 /24 |
DBP5_YEAST ATP-dependent RNA helicase DBP5 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | GLE1_YEAST Nucleoporin GLE1[295 aa] | A | 40.0 /46.0 |
10 /14 |
DBP5_YEAST ATP-dependent RNA helicase DBP5 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | GLE1_YEAST Nucleoporin GLE1[295 aa] | A | 40.0 /46.0 |
10 /23 |
DBP5_YEAST ATP-dependent RNA helicase DBP5 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | GLE1_YEAST Nucleoporin GLE1[295 aa] | A | 40.0 /46.0 |
10 /15 |
DBP5_YEAST ATP-dependent RNA helicase DBP5 |
![]() ![]() ![]() ![]() ![]() |
![]() |
FA | CIC1_YEAST Proteasome-interacting protein CIC1[257 aa] | HA | 0.0 /44.3 |
1 /15 |
HAS1_YEAST ATP-dependent RNA helicase HAS1 |
![]() ![]() ![]() ![]() ![]() |
![]() |
LA | CIC1_YEAST Proteasome-interacting protein CIC1[257 aa] | NA | 0.0 /44.3 |
1 /15 |
HAS1_YEAST ATP-dependent RNA helicase HAS1 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
GA | RL36B_SCHPO 60S ribosomal protein L36-B[85 aa] | J | 0.0 /41.9 |
3 /3 |
HAS1_SCHPO ATP-dependent RNA helicase has1 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
DA | RL36B_SCHPO 60S ribosomal protein L36-B[98 aa] | J | 25.0 /41.8 |
4 /4 |
S6CCW7_SCHPM RNA helicase |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | CWC22_HUMAN Pre-mRNA-splicing factor CWC22 homolog[274 aa] | F | 42.9 /40.6 |
7 /23 |
IF4A3_HUMAN Eukaryotic initiation factor 4A-III |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | CWC22_HUMAN Pre-mRNA-splicing factor CWC22 homolog[272 aa] | F | 50.0 /40.6 |
12 /12 |
IF4A3_HUMAN Eukaryotic initiation factor 4A-III |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | OSKA_DROME Maternal effect protein oskar[92 aa] | A | 34.8 /40.2 |
23 /23 |
VASA1_DROME ATP-dependent RNA helicase vasa, isoform A |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | OSKA_DROME Maternal effect protein oskar[92 aa] | D | 34.8 /40.2 |
23 /23 |
VASA1_DROME ATP-dependent RNA helicase vasa, isoform A |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
![]() |
|||||||
740 | pdb_id | contact mol | homologue | ||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
a3 | description | a4 | identity[%]5 | Ncon6 | description | |
![]() ![]() ![]() ![]() ![]() |
![]() |
A | 25S ribosomal RNA | HA | 0.0 /44.3 |
1 /5 |
HAS1_YEAST ATP-dependent RNA helicase HAS1 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | RNA (1564-MER) | J | 20.0 /41.9 |
5 /6 |
HAS1_SCHPO ATP-dependent RNA helicase has1 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | RNA (1422-MER) | J | 28.6 /41.8 |
7 /10 |
S6CCW7_SCHPM RNA helicase |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
![]() |
|||||||
740 | pdb_id | contact mol | homologue | ||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
a3 | description | a4 | identity[%]5 | Ncon6 | description | |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B |
ADP
|
A | 100.0 /100.0 |
15 /15 |
DDX1_HUMAN DDX1_HUMAN ATP-dependent RNA helicase DDX1 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B |
AMP
|
A | 72.7 /40.4 |
11 /11 |
DEAD_ECOLI ATP-dependent RNA helicase DeaD |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
![]() |
|||||||
740 | pdb_id | contact mol | homologue | ||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
a3 | description | a4 | identity[%]5 | Ncon6 | description | |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B |
ZN
|
A | 33.3 /42.6 |
3 /3 |
IF4A_YEAST EUKARYOTIC INITIATION FACTOR 4A |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F |
ZN
|
A | 50.0 /41.7 |
2 /2 |
DDX25_HUMAN ATP-dependent RNA helicase DDX25 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D |
ZN
|
A | 100.0 /100.0 |
4 /4 |
DDX1_HUMAN DDX1_HUMAN ATP-dependent RNA helicase DDX1 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C |
MG
|
A | 100.0 /100.0 |
3 /3 |
DDX1_HUMAN DDX1_HUMAN ATP-dependent RNA helicase DDX1 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C |
CL
|
A | 100.0 /41.7 |
1 /1 |
DDX25_HUMAN ATP-dependent RNA helicase DDX25 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D |
CL
|
A | 50.0 /41.7 |
2 /2 |
DDX25_HUMAN ATP-dependent RNA helicase DDX25 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C |
CL
|
A | 100.0 /42.5 |
3 /3 |
Q72GF3_THET2 Heat resistant RNA dependent ATPase |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D |
CL
|
B | 0.0 /41.9 |
1 /3 |
Q72GF3_THET2 Heat resistant RNA dependent ATPase |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
![]() |
|||||||
740 | pdb_id | contact mol | homologue | ||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
a3 | description | a4 | identity[%]5 | Ncon6 | description | |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E |
SO4
|
A | 0.0 /41.7 |
2 /2 |
DDX25_HUMAN ATP-dependent RNA helicase DDX25 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
G |
SO4
|
B | 0.0 /42.2 |
2 /2 |
DDX25_HUMAN ATP-dependent RNA helicase DDX25 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C |
SO4
|
A | 100.0 /46.0 |
2 /2 |
DBP5_YEAST ATP-dependent RNA helicase DBP5 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C |
SO4
|
A | 100.0 /46.0 |
2 /2 |
DBP5_YEAST ATP-dependent RNA helicase DBP5 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C |
SO4
|
A | 100.0 /46.0 |
2 /2 |
DBP5_YEAST ATP-dependent RNA helicase DBP5 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C |
SO4
|
A | 100.0 /46.0 |
2 /2 |
DBP5_YEAST ATP-dependent RNA helicase DBP5 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D |
GOL
|
A | 57.1 /46.0 |
7 /7 |
DBP5_YEAST ATP-dependent RNA helicase DBP5 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D |
GOL
|
A | 57.1 /46.0 |
7 /7 |
DBP5_YEAST ATP-dependent RNA helicase DBP5 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D |
GOL
|
A | 50.0 /46.0 |
8 /8 |
DBP5_YEAST ATP-dependent RNA helicase DBP5 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D |
GOL
|
A | 50.0 /46.0 |
8 /8 |
DBP5_YEAST ATP-dependent RNA helicase DBP5 |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. |