HOMCOS(prot_sch_conbars.cgi):

#WARNING:no index is registered index "YP_009725299.1" in "https://rest.uniprot.org/uniprotkb/" url "https://rest.uniprot.org/uniprotkb/YP_009725299.1.txt".
Please visit the UniProt website(https://www.uniprot.org), and get a proper ID/AC for your query protein.

		Contact Molecules for Homologous Proteins
[Summary Bars]	[SiteTable]	Full Bars[0.0 %]	[Back to Search Page]	[Back to HOMCOS]
[SupCon3D]	[help]	seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]	[show] [download] [help]

PID

QueryLength

Homolgous Sequence in PDB

UniProt Query

TITLE

13602

1945

500

YP_009725299.1()

QUERYSEQ

APTKVTFGDDTVIEVQGYKSVNITFELDERIDKVLNEKCSAYTVELGTEVNEFACVVADAVIKTLQPVSELLTPLGIDLDEWSMATYYLFDESGEFKLASHMYCSFYPPDEDEEEGDCEEEEFEPSTQYEYGTEDDYQGKPLEFGATSAA
LQPEEEQEEDWLDDDSQQTVGQQDGSEDNQTTTIQTIVEVQPQLEMELTPVVQTIEVNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVV
GPNVNKGEDIQLLKSAYENFNQHEVLLAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEMKSEKQVEQKIAEIPKEEVKPFITESKPSVEQRKQDDKKIKACVEEVTTTLEETKFLTENLLLYIDINGNLHPDSA
TLVSDIDITFLKKDAPYIVGDVVQEGVLTAVVIPTKKAGGTTEMLAKALRKVPTDNYITTYPGQGLNGYTVEEAKTVLKKCKSAFYILPSIISNEKQEILGTVSWNLREMLAHAEETRKLMPVCVETKAIVSTIQRKYKGIKIQEGVVDY
GARFYFYTSKTTVASLINTLNDLNETLVTMPLGYVTHGLNLEEAARYMRSLKVPATVSVSSPDAVTAYNGYLTSSSKTPEEHFIETISLAGSYKDWSYSGQSTQLGIEFLKRGDKSVYYTSNPTTFHLDGEVITFDNLKTLLSLREVRTI
KVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYC
NKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVFY
KENSYTTTIKPVTYKLDGVVCTEIDPKLDNYYKKDNSYFTEQPIDLVPNQPYPNASFDNFKFVCDNIKFADDLNQLTGYKKPASRELKVTFFPDLNGDVVAIDYKHYTPSFKKGAKLLHKPIVWHVNNATNKATYKPNTWCIRCLWSTKP
VETSNSFDVLKSEDAQGMDNLACEDLKPVSEEVVENPTIQKDVLECNVKTTEVVGDIILKPANNSLKITEEVGHTDLMAAYVDNSSLTIKKPNELSRVLGLKTLATHGLAAVNSVPWDTIANYAKPFLNKVVSTTTNIVTRCLNRVCTNY
MPYFFTLLLQLCTFTRSTNSRIKASMPTTIAKNTVKSVGKFCLEASFNYLKSPNFSKLINIIIWFLLLSVCLGSLIYSTAALGVLMSNLGMPSYCTGYREGYLNSTNVTIATYCTGSIPCSVCLSGLDSLDTYPSLETIQITISSFKWDL
TAFGLVAEWFLAYILFTRFFYVLGLAAIMQLFFSYFAVHFISNSWLMWLIINLVQMAPISAMVRMYIFFASFYYVWKSYVHVVDGCNSSTCMMCYKRNRATRVECTTIVNGVRRSFYVYANGGKGFCKLHNWNCVNCDTFCAGSTFISDE
VARDLSLQFKRPINPTDQSSYIVDSVTVKNGSIHLYFDKAGQKTYERHSLSHFVNLDNLRANNTKGSLPINVIVFDGKSKCEESSAKSASVYYSQLMCQPILLLDQALVSDVGDSAEVAVKMFDAYVNTFSSTFNVPMEKLKTLVATAEA
ELAKNVSLDNVLSTFISAARQGFVDSDVETKDVVECLKLSHQSDIEVTGDSCNNYMLTYNKVENMTPRDLGACIDCSARHINAQVAKSHNIALIWNVKDFMSLSEQLRKQIRSAAKKNNLPFKLTCATTRQVVNVVTTKIALKGG

[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [YP_009725299.1()]

1945
	region	name	description
	1-1945	DISORDER	predicted by DISOPRED

MONOMER

1945

pdb_id a¹ identity[%]² description

6wuu A 99.7 R1AB_SARS2 Non-structural protein 3

6wuu B 99.4 R1AB_SARS2 Non-structural protein 3

6wuu D 99.7 R1AB_SARS2 Non-structural protein 3

6wuu C 99.7 R1AB_SARS2 Non-structural protein 3

6wx4 A 99.7 R1AB_SARS2 Non-structural protein 3

7llf A 100.0 R1A_SARS2 Non-structural protein 3

7los A 100.0 R1A_SARS2 Non-structural protein 3

7los B 100.0 R1A_SARS2 Non-structural protein 3

7llf B 100.0 R1A_SARS2 Non-structural protein 3

7llz A 100.0 R1A_SARS2 Non-structural protein 3

7llz B 100.0 R1A_SARS2 Non-structural protein 3

7lbr B 100.0 R1A_SARS2 Non-structural protein 3

7lbs B 100.0 R1A_SARS2 Non-structural protein 3

7lbs A 100.0 R1A_SARS2 Non-structural protein 3

7lbr A 100.0 R1A_SARS2 Non-structural protein 3

8uvm B 100.0 R1AB_SARS2 Papain-like protease nsp3

6wzu A 100.0 R1AB_SARS2 Non-structural protein 3

7nfv A 100.0 R1A_SARS2 Papain-like protease nsp3

7jrn A 100.0 R1A_SARS2 Non-structural protein 3

7ofu A 100.0 R1A_SARS2 Papain-like protease nsp3

7oft A 100.0 R1A_SARS2 Papain-like protease nsp3

7ofs A 100.0 R1A_SARS2 Papain-like protease nsp3

7jrn B 100.0 R1A_SARS2 Non-structural protein 3

7d6h A 99.7 R1A_SARS2 Papain-like protease

8g62 A 100.0 R1A_SARS2 Non-structural protein 3

8cx9 B 100.0 R1A_SARS2 Papain-like protease nsp3

8cx9 A 100.0 R1A_SARS2 Papain-like protease nsp3

7rzc A 100.0 R1A_SARS2 Non-structural protein 3

7sdr B 100.0 R1A_SARS2 Non-structural protein 3

7sdr A 100.0 R1A_SARS2 Non-structural protein 3

8vec A 99.7 R1AB_SARS2 Papain-like protease nsp3

7rzc B 100.0 R1A_SARS2 Non-structural protein 3

6wrh A 99.7 R1AB_SARS2 Non-structural protein 3

7cjm A 99.7 R1AB_SARS2 Non-structural protein 3

7sqe B 99.7 R1A_SARS2 Papain-like protease

7e35 B 99.7 R1AB_SARS2 Non-structural protein 3

7d47 A 99.7 R1A_SARS2 Non-structural protein 3

8g62 C 100.0 R1A_SARS2 Non-structural protein 3

8iho A 100.0 R1A_SARS2 Papain-like protease nsp3

8g62 B 100.0 R1A_SARS2 Non-structural protein 3

7qch A 100.0 R1A_SARS2 Papain-like protease nsp3

7sgw A 100.0 R1A_SARS2 Non-structural protein 3

7qcg A 100.0 R1A_SARS2 Papain-like protease nsp3

7qcm A 100.0 R1A_SARS2 Papain-like protease nsp3

7qck A 100.0 R1A_SARS2 Papain-like protease nsp3

7qcj A 100.0 R1A_SARS2 Papain-like protease nsp3

7qci A 100.0 R1A_SARS2 Papain-like protease nsp3

8uvm C 100.0 R1AB_SARS2 Papain-like protease nsp3

8uvm A 100.0 R1AB_SARS2 Papain-like protease nsp3

7nt4 B 100.0 R1AB_SARS2 Non-structural protein 3

6xa9 A 100.0 R1AB_SARS2 Non-structural protein 3

6xa9 C 100.0 R1AB_SARS2 Non-structural protein 3

7ybg A 99.1 R1A_SARS2 Papain-like protease nsp3

7sqe A 99.7 R1A_SARS2 Papain-like protease

7rzc C 100.0 R1A_SARS2 Non-structural protein 3

7jit A 99.7 R1A_SARS2 Papain-like protease

7m1y A 99.7 R1A_SARS2 Papain-like protease

7jn2 A 100.0 R1A_SARS2 Papain-like protease

7rbr A 99.7 R1A_SARS2 Papain-like protease

8cx9 C 100.0 R1A_SARS2 Papain-like protease nsp3

7sgu A 99.7 R1A_SARS2 Papain-like protease

8uuy A 100.0 R1A_SARS2 Papain-like protease nsp3

8uug A 100.0 R1AB_SARS2 Papain-like protease nsp3

8uuf A 100.0 R1A_SARS2 Papain-like protease nsp3

7kok A 99.7 R1A_SARS2 Papain-like protease

7rbs C 99.7 R1A_SARS2 Papain-like protease

7rbs E 99.7 R1A_SARS2 Papain-like protease

7rbs I 99.7 R1A_SARS2 Papain-like protease

7rbs G 99.7 R1A_SARS2 Papain-like protease

7cjd A 99.7 R1AB_SARS2 Non-structural protein 3

7koj A 99.7 R1A_SARS2 Papain-like protease

7jir A 99.7 R1A_SARS2 Papain-like protease

6xg3 A 99.7 R1AB_SARS2 Non-structural protein 3

8eua A 100.0 R1AB_SARS2 Papain-like protease nsp3

8fwo A 100.0 R1AB_SARS2 Papain-like protease nsp3

7sdr C 100.0 R1A_SARS2 Non-structural protein 3

8uvm D 100.0 R1AB_SARS2 Papain-like protease nsp3

8uob A 100.0 R1A_SARS2 Papain-like protease nsp3

7rbs A 99.7 R1A_SARS2 Papain-like protease

7m1y B 99.7 R1A_SARS2 Papain-like protease

7d7k A 99.7 R1AB_SARS2 Non-structural protein 3

7d7k B 99.7 R1AB_SARS2 Non-structural protein 3

7d7l A 99.7 R1AB_SARS2 Non-structural protein 3

7d7l B 99.7 R1AB_SARS2 Non-structural protein 3

7jiv A 99.7 R1A_SARS2 Papain-like protease

8cx9 D 100.0 R1A_SARS2 Papain-like protease nsp3

8fwn A 99.7 R1AB_SARS2 Papain-like protease nsp3

7cjd C 99.7 R1AB_SARS2 Non-structural protein 3

7uv5 A 99.4 R1A_SARS2 Papain-like protease nsp3

7sqe C 99.7 R1A_SARS2 Papain-like protease

7cjd D 99.7 R1AB_SARS2 Non-structural protein 3

6xaa A 100.0 R1AB_SARS2 Non-structural protein 3

6w9c A 100.0 R1A_SARS2 Non-structural protein 3

6w9c C 100.0 R1A_SARS2 Non-structural protein 3

7kol A 100.0 R1A_SARS2 Papain-like protease

7nt4 A 100.0 R1AB_SARS2 Non-structural protein 3

8uuv A 100.0 R1A_SARS2 Papain-like protease nsp3

8uuh A 100.0 R1A_SARS2 Papain-like protease nsp3

6xa9 E 100.0 R1AB_SARS2 Non-structural protein 3

7krx A 99.7 R1A_SARS2 Papain-like protease

8iho B 100.0 R1A_SARS2 Papain-like protease nsp3

6w9c B 100.0 R1A_SARS2 Non-structural protein 3

7cmd C 100.0 R1AB_SARS2 Non-structural protein 3

7jiw A 100.0 R1A_SARS2 Papain-like protease

7cmd B 100.0 R1AB_SARS2 Non-structural protein 3

8uuu A 100.0 R1A_SARS2 Papain-like protease nsp3

7sgv A 99.7 R1A_SARS2 Papain-like protease

7cmd D 100.0 R1AB_SARS2 Non-structural protein 3

7cmd A 100.0 R1AB_SARS2 Non-structural protein 3

7d47 B 99.7 R1A_SARS2 Non-structural protein 3

7tzj A 99.7 R1A_SARS2 Papain-like protease

7tzj B 99.7 R1A_SARS2 Papain-like protease

7cjd B 99.7 R1AB_SARS2 Non-structural protein 3

8uuw A 100.0 R1A_SARS2 Papain-like protease nsp3

7e35 A 99.7 R1AB_SARS2 Non-structural protein 3

6yva A 99.6 R1A_SARS2 Replicase polyprotein 1a

8f2e A 100.0 R1AB_SARS2 Papain-like protease nsp3

8ilc A 100.0 R1A_SARS2 Papain-like protease nsp3

5tl6 A 82.9 R1AB_CVHSA Replicase polyprotein 1ab

4mm3 B 82.9 R1A_CVHSA Papain-like proteinase

5tl7 B 82.9 R1AB_CVHSA Replicase polyprotein 1ab

4m0w A 82.3 R1A_CVHSA Replicase polyprotein 1a

5e6j A 82.0 R1AB_CVHSA Replicase polyprotein 1ab

7lfv B 82.8 R1A_SARS papain-like protease

2fe8 A 82.8 R1AB_CVHSA Replicase polyprotein 1ab

5y3q A 82.8 R1A_CVHSA Replicase polyprotein 1a

5y3e A 82.8 R1A_CVHSA Replicase polyprotein 1a

2fe8 B 82.7 R1AB_CVHSA Replicase polyprotein 1ab

5tl7 D 82.7 R1AB_CVHSA Replicase polyprotein 1ab

5e6j D 82.7 R1AB_CVHSA Replicase polyprotein 1ab

3e9s A 82.7 R1A_CVHSA Non-structural protein 3

5tl6 B 83.0 R1AB_CVHSA Replicase polyprotein 1ab

2fe8 C 82.7 R1AB_CVHSA Replicase polyprotein 1ab

3mj5 A 82.7 R1A_CVHSA Replicase polyprotein 1a

7lfv A 82.7 R1A_SARS papain-like protease

7skr A 82.1 Q0QDZ2_SARS 3C-like proteinase

7skq A 82.1 Q0QDZ2_SARS 3C-like proteinase

4ow0 A 82.6 R1A_CVHSA papain-like protease

7lfu A 83.0 R1A_SARS papain-like protease

4ovz A 82.5 R1A_CVHSA Papain-like proteinase

7skq B 82.2 Q0QDZ2_SARS 3C-like proteinase

8hbl A 99.2 R1A_SARS2 Non-structural protein 3

8ufm A 99.2 R1A_SARS2 Papain-like protease nsp3

8gqc A 99.1 R1A_SARS2 Papain-like protease nsp3

3mj5 B 81.3 R1A_CVHSA Replicase polyprotein 1a

4ow0 B 81.1 R1A_CVHSA papain-like protease

4ovz B 81.3 R1A_CVHSA Papain-like proteinase

8ufl A 75.3 R1A_SARS Papain-like protease nsp3

8ufl B 75.4 R1A_SARS Papain-like protease nsp3

2wct A 76.3 R1A_CVHSA NON-STRUCTURAL PROTEIN 3

2wct B 76.3 R1A_CVHSA NON-STRUCTURAL PROTEIN 3

2w2g A 76.3 R1A_CVHSA NON-STRUCTURAL PROTEIN 3

2w2g B 75.0 R1A_CVHSA NON-STRUCTURAL PROTEIN 3

2wct C 75.8 R1A_CVHSA NON-STRUCTURAL PROTEIN 3

2wct D 75.4 R1A_CVHSA NON-STRUCTURAL PROTEIN 3

6z72 A 100.0 R1AB_SARS2 Replicase polyprotein 1ab

6z5t A 100.0 R1AB_SARS2 Replicase polyprotein 1ab

6z72 C 100.0 R1AB_SARS2 Replicase polyprotein 1ab

6z6i C 100.0 R1AB_SARS2 Replicase polyprotein 1ab

6z5t B 100.0 R1AB_SARS2 Replicase polyprotein 1ab

6z6i D 100.0 R1AB_SARS2 Replicase polyprotein 1ab

6z6i B 100.0 R1AB_SARS2 Replicase polyprotein 1ab

6z72 B 100.0 R1AB_SARS2 Replicase polyprotein 1ab

6z72 D 100.0 R1AB_SARS2 Replicase polyprotein 1ab

6z6i A 100.0 R1AB_SARS2 Replicase polyprotein 1ab

8azd A 100.0 R1A_SARS2 Papain-like protease nsp3

8azd B 100.0 R1A_SARS2 Papain-like protease nsp3

8azp B 100.0 R1A_SARS2 Papain-like protease nsp3

8azp A 100.0 R1A_SARS2 Papain-like protease nsp3

8azo B 100.0 R1A_SARS2 Papain-like protease nsp3

8azm B 100.0 R1A_SARS2 Papain-like protease nsp3

8azl B 100.0 R1A_SARS2 Papain-like protease nsp3

8azl A 100.0 R1A_SARS2 Papain-like protease nsp3

8azi B 100.0 R1A_SARS2 Papain-like protease nsp3

8azi A 100.0 R1A_SARS2 Papain-like protease nsp3

8azo A 100.0 R1A_SARS2 Papain-like protease nsp3

8azm A 100.0 R1A_SARS2 Papain-like protease nsp3

6wey A 100.0 R1AB_SARS2 Non-structural protein 3

7cz4 A 100.0 R1A_SARS2 Non-structural protein 3

7qg7 A 100.0 R1AB_SARS2 Papain-like protease nsp3

7bf6 B 100.0 R1AB_SARS2 Papain-like protease nsp3

6woj B 100.0 R1AB_SARS2 Non-structural protein 3

6woj D 100.0 R1AB_SARS2 Non-structural protein 3

6ywm A 100.0 R1AB_SARS2 NSP3 macrodomain

6ywk C 100.0 R1AB_SARS2 NSP3 macrodomain

6ywl C 100.0 R1AB_SARS2 NSP3 macrodomain

7bf5 E 100.0 R1AB_SARS2 NSP3 macrodomain

7bf3 C 100.0 R1AB_SARS2 NSP3 macrodomain

7bf6 A 100.0 R1AB_SARS2 Papain-like protease nsp3

7bf5 B 100.0 R1AB_SARS2 NSP3 macrodomain

7bf4 A 100.0 R1AB_SARS2 NSP3 macrodomain

7bf5 A 100.0 R1AB_SARS2 NSP3 macrodomain

5rvm A 100.0 R1AB_SARS2 Non-structural protein 3

6ywk B 100.0 R1AB_SARS2 NSP3 macrodomain

6ywl A 100.0 R1AB_SARS2 NSP3 macrodomain

6ywk A 100.0 R1AB_SARS2 NSP3 macrodomain

7bf3 E 100.0 R1AB_SARS2 NSP3 macrodomain

7bf3 B 100.0 R1AB_SARS2 NSP3 macrodomain

6ywl E 100.0 R1AB_SARS2 NSP3 macrodomain

6ywl B 100.0 R1AB_SARS2 NSP3 macrodomain

6ywk E 100.0 R1AB_SARS2 NSP3 macrodomain

6ywk D 100.0 R1AB_SARS2 NSP3 macrodomain

7bf5 D 100.0 R1AB_SARS2 NSP3 macrodomain

7bf5 C 100.0 R1AB_SARS2 NSP3 macrodomain

7bf3 D 100.0 R1AB_SARS2 NSP3 macrodomain

7bf3 A 100.0 R1AB_SARS2 NSP3 macrodomain

7qg7 B 100.0 R1AB_SARS2 Papain-like protease nsp3

6woj C 100.0 R1AB_SARS2 Non-structural protein 3

6woj A 100.0 R1AB_SARS2 Non-structural protein 3

7kr0 A 100.0 R1AB_SARS2 Non-structural protein 3

8azc A 100.0 R1A_SARS2 Papain-like protease nsp3

6ywm B 100.0 R1AB_SARS2 NSP3 macrodomain

6w6y A 100.0 R1AB_SARS2 Non-structural protein 3

6wen A 100.0 R1AB_SARS2 Non-structural protein 3

8gia A 100.0 R1AB_SARS2 Non-structural protein 3

5rvv A 100.0 R1AB_SARS2 Non-structural protein 3

5rvu A 100.0 R1AB_SARS2 Non-structural protein 3

5rvt A 100.0 R1AB_SARS2 Non-structural protein 3

5rvs A 100.0 R1AB_SARS2 Non-structural protein 3

5rvr A 100.0 R1AB_SARS2 Non-structural protein 3

5rvq A 100.0 R1AB_SARS2 Non-structural protein 3

5rvp A 100.0 R1AB_SARS2 Non-structural protein 3

5rvo A 100.0 R1AB_SARS2 Non-structural protein 3

5rvn A 100.0 R1AB_SARS2 Non-structural protein 3

5rvl A 100.0 R1AB_SARS2 Non-structural protein 3

5rvk A 100.0 R1AB_SARS2 Non-structural protein 3

5rvj A 100.0 R1AB_SARS2 Non-structural protein 3

7kr1 A 100.0 R1AB_SARS2 Non-structural protein 3

6ywl D 100.0 R1AB_SARS2 NSP3 macrodomain

7c33 A 100.0 R1A_SARS2 Non-structural protein 3

5sq6 B 100.0 R1AB_SARS2 Non-structural protein 3

5s74 B 100.0 R1AB_SARS2 Non-structural protein 3

5s43 B 100.0 R1AB_SARS2 Non-structural protein 3

5s3x B 100.0 R1AB_SARS2 Non-structural protein 3

5s2n B 100.0 R1AB_SARS2 Non-structural protein 3

5ss4 B 100.0 R1AB_SARS2 Non-structural protein 3

5rsf B 100.0 R1AB_SARS2 Non-structural protein 3

5s3u B 100.0 R1AB_SARS2 Non-structural protein 3

5s3p B 100.0 R1AB_SARS2 Non-structural protein 3

5s3m B 100.0 R1AB_SARS2 Non-structural protein 3

5s3k B 100.0 R1AB_SARS2 Non-structural protein 3

5s2l B 100.0 R1AB_SARS2 Non-structural protein 3

5s2k B 100.0 R1AB_SARS2 Non-structural protein 3

5rvd B 100.0 R1AB_SARS2 Non-structural protein 3

5run B 100.0 R1AB_SARS2 Non-structural protein 3

5ru9 B 100.0 R1AB_SARS2 Non-structural protein 3

5rtv B 100.0 R1AB_SARS2 Non-structural protein 3

5rti B 100.0 R1AB_SARS2 Non-structural protein 3

5rt5 B 100.0 R1AB_SARS2 Non-structural protein 3

5s40 B 100.0 R1AB_SARS2 Non-structural protein 3

5s42 B 100.0 R1AB_SARS2 Non-structural protein 3

5s73 B 100.0 R1AB_SARS2 Non-structural protein 3

5s4k B 100.0 R1AB_SARS2 Non-structural protein 3

5s41 B 100.0 R1AB_SARS2 Non-structural protein 3

5s4j B 100.0 R1AB_SARS2 Non-structural protein 3

5s4i B 100.0 R1AB_SARS2 Non-structural protein 3

5s4h B 100.0 R1AB_SARS2 Non-structural protein 3

5s4g B 100.0 R1AB_SARS2 Non-structural protein 3

5s4f B 100.0 R1AB_SARS2 Non-structural protein 3

5s44 B 100.0 R1AB_SARS2 Non-structural protein 3

5s3z B 100.0 R1AB_SARS2 Non-structural protein 3

5s3y B 100.0 R1AB_SARS2 Non-structural protein 3

5s3v B 100.0 R1AB_SARS2 Non-structural protein 3

5s3w B 100.0 R1AB_SARS2 Non-structural protein 3

5s3t B 100.0 R1AB_SARS2 Non-structural protein 3

5s3s B 100.0 R1AB_SARS2 Non-structural protein 3

5s3r B 100.0 R1AB_SARS2 Non-structural protein 3

5s3q B 100.0 R1AB_SARS2 Non-structural protein 3

5s3o B 100.0 R1AB_SARS2 Non-structural protein 3

5s3n B 100.0 R1AB_SARS2 Non-structural protein 3

5s3l B 100.0 R1AB_SARS2 Non-structural protein 3

5s3j B 100.0 R1AB_SARS2 Non-structural protein 3

5s3a B 100.0 R1AB_SARS2 Non-structural protein 3

5s3i B 100.0 R1AB_SARS2 Non-structural protein 3

5s3h B 100.0 R1AB_SARS2 Non-structural protein 3

5s3g B 100.0 R1AB_SARS2 Non-structural protein 3

5s3f B 100.0 R1AB_SARS2 Non-structural protein 3

5s3e B 100.0 R1AB_SARS2 Non-structural protein 3

5s3d B 100.0 R1AB_SARS2 Non-structural protein 3

5s3c B 100.0 R1AB_SARS2 Non-structural protein 3

5s3b B 100.0 R1AB_SARS2 Non-structural protein 3

5s39 B 100.0 R1AB_SARS2 Non-structural protein 3

5s38 B 100.0 R1AB_SARS2 Non-structural protein 3

5s37 B 100.0 R1AB_SARS2 Non-structural protein 3

5s36 B 100.0 R1AB_SARS2 Non-structural protein 3

5s35 B 100.0 R1AB_SARS2 Non-structural protein 3

5s33 B 100.0 R1AB_SARS2 Non-structural protein 3

5s32 B 100.0 R1AB_SARS2 Non-structural protein 3

5s31 B 100.0 R1AB_SARS2 Non-structural protein 3

5s30 B 100.0 R1AB_SARS2 Non-structural protein 3

5s2z B 100.0 R1AB_SARS2 Non-structural protein 3

5s2y B 100.0 R1AB_SARS2 Non-structural protein 3

5s2x B 100.0 R1AB_SARS2 Non-structural protein 3

5s2w B 100.0 R1AB_SARS2 Non-structural protein 3

5s2v B 100.0 R1AB_SARS2 Non-structural protein 3

5s2u B 100.0 R1AB_SARS2 Non-structural protein 3

5s2t B 100.0 R1AB_SARS2 Non-structural protein 3

5s2s B 100.0 R1AB_SARS2 Non-structural protein 3

5s2r B 100.0 R1AB_SARS2 Non-structural protein 3

5s2q B 100.0 R1AB_SARS2 Non-structural protein 3

5s2p B 100.0 R1AB_SARS2 Non-structural protein 3

5s2o B 100.0 R1AB_SARS2 Non-structural protein 3

5s2m B 100.0 R1AB_SARS2 Non-structural protein 3

5s2j B 100.0 R1AB_SARS2 Non-structural protein 3

5s2i B 100.0 R1AB_SARS2 Non-structural protein 3

5s2h B 100.0 R1AB_SARS2 Non-structural protein 3

5s2g B 100.0 R1AB_SARS2 Non-structural protein 3

5s2f B 100.0 R1AB_SARS2 Non-structural protein 3

5s2e B 100.0 R1AB_SARS2 Non-structural protein 3

5s2d B 100.0 R1AB_SARS2 Non-structural protein 3

5spz B 100.0 R1AB_SARS2 Non-structural protein 3

5spm B 100.0 R1AB_SARS2 Non-structural protein 3

5sp2 B 100.0 R1AB_SARS2 Non-structural protein 3

5spf B 100.0 R1AB_SARS2 Non-structural protein 3

7tww B 100.0 R1AB_SARS2 Non-structural protein 3

7twh B 100.0 R1AB_SARS2 Non-structural protein 3

5ssb B 100.0 R1AB_SARS2 Non-structural protein 3

5srx B 100.0 R1AB_SARS2 Non-structural protein 3

5srq B 100.0 R1AB_SARS2 Non-structural protein 3

5sr4 B 100.0 R1AB_SARS2 Non-structural protein 3

5sqx B 100.0 R1AB_SARS2 Non-structural protein 3

5sqr B 100.0 R1AB_SARS2 Non-structural protein 3

5sqk B 100.0 R1AB_SARS2 Non-structural protein 3

5sqd B 100.0 R1AB_SARS2 Non-structural protein 3

5sps B 100.0 R1AB_SARS2 Non-structural protein 3

5sot B 100.0 R1AB_SARS2 Non-structural protein 3

5s1o B 100.0 R1AB_SARS2 Non-structural protein 3

5rvf B 100.0 R1AB_SARS2 Non-structural protein 3

7fr6 B 100.0 R1AB_SARS2 Non-structural protein 3

7fr3 B 100.0 R1AB_SARS2 Non-structural protein 3

5ssk B 100.0 R1AB_SARS2 Non-structural protein 3

5ssn B 100.0 R1AB_SARS2 Non-structural protein 3

5ssm B 100.0 R1AB_SARS2 Non-structural protein 3

5ssl B 100.0 R1AB_SARS2 Non-structural protein 3

5ssj B 100.0 R1AB_SARS2 Non-structural protein 3

5ssi B 100.0 R1AB_SARS2 Non-structural protein 3

5ssh B 100.0 R1AB_SARS2 Non-structural protein 3

5ssr B 100.0 R1AB_SARS2 Non-structural protein 3

5ssq B 100.0 R1AB_SARS2 Non-structural protein 3

5ssp B 100.0 R1AB_SARS2 Non-structural protein 3

5sso B 100.0 R1AB_SARS2 Non-structural protein 3

5ss6 B 100.0 R1AB_SARS2 Non-structural protein 3

5ss5 B 100.0 R1AB_SARS2 Non-structural protein 3

5ssg B 100.0 R1AB_SARS2 Non-structural protein 3

5ssf B 100.0 R1AB_SARS2 Non-structural protein 3

5sse B 100.0 R1AB_SARS2 Non-structural protein 3

5ssd B 100.0 R1AB_SARS2 Non-structural protein 3

5ssc B 100.0 R1AB_SARS2 Non-structural protein 3

5ssa B 100.0 R1AB_SARS2 Non-structural protein 3

5ss9 B 100.0 R1AB_SARS2 Non-structural protein 3

5ss8 B 100.0 R1AB_SARS2 Non-structural protein 3

5ss7 B 100.0 R1AB_SARS2 Non-structural protein 3

5srs B 100.0 R1AB_SARS2 Non-structural protein 3

5srr B 100.0 R1AB_SARS2 Non-structural protein 3

5ss3 B 100.0 R1AB_SARS2 Non-structural protein 3

5ss2 B 100.0 R1AB_SARS2 Non-structural protein 3

5ss1 B 100.0 R1AB_SARS2 Non-structural protein 3

5ss0 B 100.0 R1AB_SARS2 Non-structural protein 3

5srz B 100.0 R1AB_SARS2 Non-structural protein 3

5sry B 100.0 R1AB_SARS2 Non-structural protein 3

5srw B 100.0 R1AB_SARS2 Non-structural protein 3

5srv B 100.0 R1AB_SARS2 Non-structural protein 3

5sru B 100.0 R1AB_SARS2 Non-structural protein 3

5srt B 100.0 R1AB_SARS2 Non-structural protein 3

5srd B 100.0 R1AB_SARS2 Non-structural protein 3

5src B 100.0 R1AB_SARS2 Non-structural protein 3

5srn B 100.0 R1AB_SARS2 Non-structural protein 3

5srm B 100.0 R1AB_SARS2 Non-structural protein 3

5srl B 100.0 R1AB_SARS2 Non-structural protein 3

5srj B 100.0 R1AB_SARS2 Non-structural protein 3

5sri B 100.0 R1AB_SARS2 Non-structural protein 3

5srh B 100.0 R1AB_SARS2 Non-structural protein 3

5srg B 100.0 R1AB_SARS2 Non-structural protein 3

5srf B 100.0 R1AB_SARS2 Non-structural protein 3

5sre B 100.0 R1AB_SARS2 Non-structural protein 3

5sqz B 100.0 R1AB_SARS2 Non-structural protein 3

5sqy B 100.0 R1AB_SARS2 Non-structural protein 3

5sra B 100.0 R1AB_SARS2 Non-structural protein 3

5sr9 B 100.0 R1AB_SARS2 Non-structural protein 3

5sr8 B 100.0 R1AB_SARS2 Non-structural protein 3

5sr7 B 100.0 R1AB_SARS2 Non-structural protein 3

5sr6 B 100.0 R1AB_SARS2 Non-structural protein 3

5sr5 B 100.0 R1AB_SARS2 Non-structural protein 3

5sr3 B 100.0 R1AB_SARS2 Non-structural protein 3

5sr2 B 100.0 R1AB_SARS2 Non-structural protein 3

5sr1 B 100.0 R1AB_SARS2 Non-structural protein 3

5sr0 B 100.0 R1AB_SARS2 Non-structural protein 3

5sqm B 100.0 R1AB_SARS2 Non-structural protein 3

5sql B 100.0 R1AB_SARS2 Non-structural protein 3

5sqw B 100.0 R1AB_SARS2 Non-structural protein 3

5sqv B 100.0 R1AB_SARS2 Non-structural protein 3

5squ B 100.0 R1AB_SARS2 Non-structural protein 3

5sqt B 100.0 R1AB_SARS2 Non-structural protein 3

5sqs B 100.0 R1AB_SARS2 Non-structural protein 3

5sqq B 100.0 R1AB_SARS2 Non-structural protein 3

5sqp B 100.0 R1AB_SARS2 Non-structural protein 3

5sqo B 100.0 R1AB_SARS2 Non-structural protein 3

5sqn B 100.0 R1AB_SARS2 Non-structural protein 3

5sq8 B 100.0 R1AB_SARS2 Non-structural protein 3

5sq7 B 100.0 R1AB_SARS2 Non-structural protein 3

5sqj B 100.0 R1AB_SARS2 Non-structural protein 3

5sqi B 100.0 R1AB_SARS2 Non-structural protein 3

5sqh B 100.0 R1AB_SARS2 Non-structural protein 3

5sqg B 100.0 R1AB_SARS2 Non-structural protein 3

5sqf B 100.0 R1AB_SARS2 Non-structural protein 3

5sqe B 100.0 R1AB_SARS2 Non-structural protein 3

5sqc B 100.0 R1AB_SARS2 Non-structural protein 3

5sqb B 100.0 R1AB_SARS2 Non-structural protein 3

5sqa B 100.0 R1AB_SARS2 Non-structural protein 3

5sq9 B 100.0 R1AB_SARS2 Non-structural protein 3

5spu B 100.0 R1AB_SARS2 Non-structural protein 3

5spt B 100.0 R1AB_SARS2 Non-structural protein 3

5sq5 B 100.0 R1AB_SARS2 Non-structural protein 3

5sq4 B 100.0 R1AB_SARS2 Non-structural protein 3

5sq3 B 100.0 R1AB_SARS2 Non-structural protein 3

5sq2 B 100.0 R1AB_SARS2 Non-structural protein 3

5sq1 B 100.0 R1AB_SARS2 Non-structural protein 3

5sq0 B 100.0 R1AB_SARS2 Non-structural protein 3

5spy B 100.0 R1AB_SARS2 Non-structural protein 3

5spx B 100.0 R1AB_SARS2 Non-structural protein 3

5spw B 100.0 R1AB_SARS2 Non-structural protein 3

5spv B 100.0 R1AB_SARS2 Non-structural protein 3

5sph B 100.0 R1AB_SARS2 Non-structural protein 3

5spg B 100.0 R1AB_SARS2 Non-structural protein 3

5spr B 100.0 R1AB_SARS2 Non-structural protein 3

5spq B 100.0 R1AB_SARS2 Non-structural protein 3

5spp B 100.0 R1AB_SARS2 Non-structural protein 3

5spo B 100.0 R1AB_SARS2 Non-structural protein 3

5spn B 100.0 R1AB_SARS2 Non-structural protein 3

5spl B 100.0 R1AB_SARS2 Non-structural protein 3

5spk B 100.0 R1AB_SARS2 Non-structural protein 3

5spj B 100.0 R1AB_SARS2 Non-structural protein 3

5spi B 100.0 R1AB_SARS2 Non-structural protein 3

5sp1 B 100.0 R1AB_SARS2 Non-structural protein 3

5sp0 B 100.0 R1AB_SARS2 Non-structural protein 3

5spe B 100.0 R1AB_SARS2 Non-structural protein 3

5spd B 100.0 R1AB_SARS2 Non-structural protein 3

5spc B 100.0 R1AB_SARS2 Non-structural protein 3

5spb B 100.0 R1AB_SARS2 Non-structural protein 3

5sp9 B 100.0 R1AB_SARS2 Non-structural protein 3

5sp8 B 100.0 R1AB_SARS2 Non-structural protein 3

5sp7 B 100.0 R1AB_SARS2 Non-structural protein 3

5sp6 B 100.0 R1AB_SARS2 Non-structural protein 3

5sp4 B 100.0 R1AB_SARS2 Non-structural protein 3

5sp3 B 100.0 R1AB_SARS2 Non-structural protein 3

5soo B 100.0 R1AB_SARS2 Non-structural protein 3

5son B 100.0 R1AB_SARS2 Non-structural protein 3

5soz B 100.0 R1AB_SARS2 Non-structural protein 3

5soy B 100.0 R1AB_SARS2 Non-structural protein 3

5sox B 100.0 R1AB_SARS2 Non-structural protein 3

5sow B 100.0 R1AB_SARS2 Non-structural protein 3

5sov B 100.0 R1AB_SARS2 Non-structural protein 3

5sou B 100.0 R1AB_SARS2 Non-structural protein 3

5sos B 100.0 R1AB_SARS2 Non-structural protein 3

5sor B 100.0 R1AB_SARS2 Non-structural protein 3

5soq B 100.0 R1AB_SARS2 Non-structural protein 3

5sop B 100.0 R1AB_SARS2 Non-structural protein 3

5sok B 100.0 R1AB_SARS2 Non-structural protein 3

5s4d B 100.0 R1AB_SARS2 Non-structural protein 3

5s34 B 100.0 R1AB_SARS2 Non-structural protein 3

5s2b B 100.0 R1AB_SARS2 Non-structural protein 3

5s2a B 100.0 R1AB_SARS2 Non-structural protein 3

5s28 B 100.0 R1AB_SARS2 Non-structural protein 3

5s27 B 100.0 R1AB_SARS2 Non-structural protein 3

5s26 B 100.0 R1AB_SARS2 Non-structural protein 3

5s24 B 100.0 R1AB_SARS2 Non-structural protein 3

5s22 B 100.0 R1AB_SARS2 Non-structural protein 3

5s2c B 100.0 R1AB_SARS2 Non-structural protein 3

5s29 B 100.0 R1AB_SARS2 Non-structural protein 3

5s1c B 100.0 R1AB_SARS2 Non-structural protein 3

5s1e B 100.0 R1AB_SARS2 Non-structural protein 3

5s1a B 100.0 R1AB_SARS2 Non-structural protein 3

5s20 B 100.0 R1AB_SARS2 Non-structural protein 3

5s1y B 100.0 R1AB_SARS2 Non-structural protein 3

5s1w B 100.0 R1AB_SARS2 Non-structural protein 3

5s1u B 100.0 R1AB_SARS2 Non-structural protein 3

5s1s B 100.0 R1AB_SARS2 Non-structural protein 3

5s1q B 100.0 R1AB_SARS2 Non-structural protein 3

5s1m B 100.0 R1AB_SARS2 Non-structural protein 3

5s1k B 100.0 R1AB_SARS2 Non-structural protein 3

5s1i B 100.0 R1AB_SARS2 Non-structural protein 3

5s1g B 100.0 R1AB_SARS2 Non-structural protein 3

5rve B 100.0 R1AB_SARS2 Non-structural protein 3

5s18 B 100.0 R1AB_SARS2 Non-structural protein 3

5rvi B 100.0 R1AB_SARS2 Non-structural protein 3

5rvh B 100.0 R1AB_SARS2 Non-structural protein 3

5rvg B 100.0 R1AB_SARS2 Non-structural protein 3

5rv1 B 100.0 R1AB_SARS2 Non-structural protein 3

5rv2 B 100.0 R1AB_SARS2 Non-structural protein 3

5rv0 B 100.0 R1AB_SARS2 Non-structural protein 3

5rvc B 100.0 R1AB_SARS2 Non-structural protein 3

5rvb B 100.0 R1AB_SARS2 Non-structural protein 3

5rva B 100.0 R1AB_SARS2 Non-structural protein 3

5rv9 B 100.0 R1AB_SARS2 Non-structural protein 3

5rv8 B 100.0 R1AB_SARS2 Non-structural protein 3

5rv7 B 100.0 R1AB_SARS2 Non-structural protein 3

5rv6 B 100.0 R1AB_SARS2 Non-structural protein 3

5rv5 B 100.0 R1AB_SARS2 Non-structural protein 3

5rv4 B 100.0 R1AB_SARS2 Non-structural protein 3

5rv3 B 100.0 R1AB_SARS2 Non-structural protein 3

1.a¹:asym_id for the homologue. 2.identity[%]²:sequence identity between the query and the homologue.

HETERO

1945 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

5tl6 D ISG15_HUMAN Ubiquitin-like protein ISG15[78 aa] A 100.0
/82.9 21
/21 R1AB_CVHSA Replicase polyprotein 1ab

5tl6 C ISG15_HUMAN Ubiquitin-like protein ISG15[79 aa] B 95.5
/83.0 22
/22 R1AB_CVHSA Replicase polyprotein 1ab

6xa9 B ISG15_HUMAN ISG15 CTD-propargylamide[80 aa] A 100.0
/100.0 22
/22 R1AB_SARS2 Non-structural protein 3

6xa9 D ISG15_HUMAN ISG15 CTD-propargylamide[79 aa] C 100.0
/100.0 22
/22 R1AB_SARS2 Non-structural protein 3

6xa9 F ISG15_HUMAN ISG15 CTD-propargylamide[79 aa] E 100.0
/100.0 24
/24 R1AB_SARS2 Non-structural protein 3

8cx9 G RL40_HUMAN Ubiquitin variant UbV.CV2.1[75 aa] A 100.0
/100.0 12
/12 R1A_SARS2 Papain-like protease nsp3

8cx9 H RL40_HUMAN Ubiquitin variant UbV.CV2.1[75 aa] A 100.0
/100.0 6
/6 R1A_SARS2 Papain-like protease nsp3

8cx9 E RL40_HUMAN Ubiquitin variant UbV.CV2.1[74 aa] B 100.0
/100.0 13
/13 R1A_SARS2 Papain-like protease nsp3

8cx9 F RL40_HUMAN Ubiquitin variant UbV.CV2.1[75 aa] B 100.0
/100.0 6
/6 R1A_SARS2 Papain-like protease nsp3

8cx9 I RL40_HUMAN Ubiquitin variant UbV.CV2.1[73 aa] C 100.0
/100.0 12
/12 R1A_SARS2 Papain-like protease nsp3

8cx9 J RL40_HUMAN Ubiquitin variant UbV.CV2.1[74 aa] C 100.0
/100.0 7
/7 R1A_SARS2 Papain-like protease nsp3

8cx9 K RL40_HUMAN Ubiquitin variant UbV.CV2.1[74 aa] D 100.0
/100.0 11
/11 R1A_SARS2 Papain-like protease nsp3

8cx9 L RL40_HUMAN Ubiquitin variant UbV.CV2.1[74 aa] D 100.0
/100.0 5
/5 R1A_SARS2 Papain-like protease nsp3

8iho C covalent inhibitor[4 aa] A 100.0
/100.0 18
/18 R1A_SARS2 Papain-like protease nsp3

8iho D covalent inhibitor[4 aa] A 100.0
/100.0 1
/1 R1A_SARS2 Papain-like protease nsp3

8iho D covalent inhibitor[4 aa] B 100.0
/100.0 16
/16 R1A_SARS2 Papain-like protease nsp3

7rbs B ISG15_HUMAN Ubiquitin-like protein ISG15[157 aa] A 96.7
/99.7 30
/30 R1A_SARS2 Papain-like protease

7rbs D ISG15_HUMAN Ubiquitin-like protein ISG15[157 aa] C 96.3
/99.7 27
/27 R1A_SARS2 Papain-like protease

7rbs F ISG15_HUMAN Ubiquitin-like protein ISG15[157 aa] E 96.6
/99.7 29
/29 R1A_SARS2 Papain-like protease

7rbs H ISG15_HUMAN Ubiquitin-like protein ISG15[157 aa] G 96.4
/99.7 28
/28 R1A_SARS2 Papain-like protease

7rbs J ISG15_HUMAN Ubiquitin-like protein ISG15[157 aa] I 96.7
/99.7 30
/30 R1A_SARS2 Papain-like protease

6yva B ISG15_MOUSE Ubiquitin-like protein ISG15[155 aa] A 96.6
/99.6 29
/29 R1A_SARS2 Replicase polyprotein 1a

4m0w B RS27A_BOVIN Ubiquitin[76 aa] A 88.5
/82.3 26
/26 R1A_CVHSA Replicase polyprotein 1a

4mm3 A UBC_HUMAN Ubiquitin[76 aa] B 88.0
/82.9 25
/25 R1A_CVHSA Papain-like proteinase

5e6j B UBC_HUMAN ubiquitin[76 aa] A 92.0
/82.0 25
/25 R1AB_CVHSA Replicase polyprotein 1ab

5e6j C UBB_HUMAN Polyubiquitin-B[75 aa] A 63.6
/82.0 11
/11 R1AB_CVHSA Replicase polyprotein 1ab

5e6j E UBC_HUMAN ubiquitin[76 aa] D 92.0
/82.7 25
/25 R1AB_CVHSA Replicase polyprotein 1ab

5e6j F UBB_HUMAN Polyubiquitin-B[75 aa] D 70.0
/82.7 10
/10 R1AB_CVHSA Replicase polyprotein 1ab

6xaa B J3QS39_HUMAN Ubiquitin-propargylamide[76 aa] A 100.0
/100.0 25
/25 R1AB_SARS2 Non-structural protein 3

7rbr B UBB_HUMAN Ubiquitin[76 aa] A 96.2
/99.7 26
/26 R1A_SARS2 Papain-like protease

7uv5 B UBC_HUMAN Ubiquitin[76 aa] A 96.3
/99.4 27
/27 R1A_SARS2 Papain-like protease nsp3

7uv5 C UBB_HUMAN Ubiquitin[41 aa] A 100.0
/99.4 10
/10 R1A_SARS2 Papain-like protease nsp3

6wuu E VIR250[5 aa] A 100.0
/99.7 18
/18 R1AB_SARS2 Non-structural protein 3

6wuu F VIR250[5 aa] B 100.0
/99.4 16
/16 R1AB_SARS2 Non-structural protein 3

6wuu G VIR250[5 aa] C 100.0
/99.7 16
/16 R1AB_SARS2 Non-structural protein 3

6wuu H VIR250[5 aa] D 100.0
/99.7 17
/17 R1AB_SARS2 Non-structural protein 3

6wx4 B VIR251[5 aa] A 100.0
/99.7 16
/16 R1AB_SARS2 Non-structural protein 3

7lfu B Papain-like protease peptide inhibitor VIR250[5 aa.. A 100.0
/83.0 16
/16 R1A_SARS papain-like protease

7lfv D Papain-like protease peptide inhibitor VIR251[5 aa.. A 100.0
/82.7 17
/17 R1A_SARS papain-like protease

7lfv C Papain-like protease peptide inhibitor VIR251[5 aa.. B 100.0
/82.8 15
/15 R1A_SARS papain-like protease

5tl7 A ISG15_MOUSE Ubiquitin-like protein ISG15[77 aa] B 92.6
/82.9 27
/27 R1AB_CVHSA Replicase polyprotein 1ab

5tl7 C ISG15_MOUSE Ubiquitin-like protein ISG15[77 aa] D 91.7
/82.7 24
/24 R1AB_CVHSA Replicase polyprotein 1ab

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

COMPOUND

1945 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

5rv9 D EKZ
4-tert-butylbenzene-1,2-diol[12 atoms] B 100.0
/100.0 5
/5 R1AB_SARS2 Non-structural protein 3

5rvi D CLW
CHLORZOXAZONE[11 atoms] B 100.0
/100.0 5
/5 R1AB_SARS2 Non-structural protein 3

5rvj B 4JQ
6-amino-2H-chromen-2-one[12 atoms] A 100.0
/100.0 6
/6 R1AB_SARS2 Non-structural protein 3

5rvk B 2AK
7-bromo-5-methyl-1H-indole-2,3-dione[13 atoms] A 100.0
/100.0 6
/6 R1AB_SARS2 Non-structural protein 3

5rvl B BVF
4-METHYLPYRIDIN-2-AMINE[8 atoms] A 100.0
/100.0 6
/6 R1AB_SARS2 Non-structural protein 3

5rvm B HBD
4-HYDROXYBENZAMIDE[10 atoms] A 100.0
/100.0 6
/6 R1AB_SARS2 Non-structural protein 3

5rvn B ANN
4-METHOXYBENZOIC ACID[11 atoms] A 100.0
/100.0 5
/5 R1AB_SARS2 Non-structural protein 3

5rvo B AQO
2-AMINOQUINAZOLIN-4(3H)-ONE[12 atoms] A 100.0
/100.0 5
/5 R1AB_SARS2 Non-structural protein 3

5rvp B 1SQ
ISOQUINOLIN-1-AMINE[11 atoms] A 100.0
/100.0 6
/6 R1AB_SARS2 Non-structural protein 3

5rvq B 4BY
5-methyl-1H-indole-2-carboxylic acid[13 atoms] A 100.0
/100.0 8
/8 R1AB_SARS2 Non-structural protein 3

5rvr B LZ1
1H-indazole[9 atoms] A 100.0
/100.0 4
/4 R1AB_SARS2 Non-structural protein 3

5rvs B 0LO
5-phenylpyridine-3-carboxylic acid[15 atoms] A 100.0
/100.0 7
/7 R1AB_SARS2 Non-structural protein 3

5rvt B 4BL
6-methyl-1H-indole-2-carboxylic acid[13 atoms] A 100.0
/100.0 6
/6 R1AB_SARS2 Non-structural protein 3

5rvu B 6P3
6-phenylpyridine-3-carboxylic acid[15 atoms] A 100.0
/100.0 8
/8 R1AB_SARS2 Non-structural protein 3

5rvv B WB1
6-methyl-1H-indole-3-carboxylic acid[13 atoms] A 100.0
/100.0 9
/9 R1AB_SARS2 Non-structural protein 3

5s1a D WPS
5-amino-3-methyl-1H-pyrazole-4-carbonitrile[9 atom.. B 100.0
/100.0 6
/6 R1AB_SARS2 Non-structural protein 3

5s27 C WSM
4-(3-aminopropyl)-2H-1,4-benzoxazin-3(4H)-one[15 a.. B 100.0
/100.0 6
/6 R1AB_SARS2 Non-structural protein 3

5s2d C U0P
N'-cyclopropyl-N-methyl-N-[(5-methyl-1,2-oxazol-3-.. B 100.0
/100.0 5
/5 R1AB_SARS2 Non-structural protein 3

5s2h C VWV
ethyl (1,1-dioxo-1lambda~6~,4-thiazinan-4-yl)aceta.. B 100.0
/100.0 7
/7 R1AB_SARS2 Non-structural protein 3

5s2i C LUY
~{N}-(2-phenylethyl)-1~{H}-benzimidazol-2-amine[18.. B 100.0
/100.0 7
/7 R1AB_SARS2 Non-structural protein 3

5s2j C JGG
N-[(4-cyanophenyl)methyl]morpholine-4-carboxamide[.. B 100.0
/100.0 6
/6 R1AB_SARS2 Non-structural protein 3

5s2l D VZS
N-(2-methoxy-5-methylphenyl)-N'-4H-1,2,4-triazol-4.. B 100.0
/100.0 5
/5 R1AB_SARS2 Non-structural protein 3

5s2u C VXD
N-(3-chloro-2-methylphenyl)glycinamide[13 atoms] B 100.0
/100.0 4
/4 R1AB_SARS2 Non-structural protein 3

5s2v C W0G
(3R)-1-(2-fluorophenyl)-3-(methylamino)pyrrolidin-.. B 100.0
/100.0 4
/4 R1AB_SARS2 Non-structural protein 3

5s2x C W0J
(3R)-N-methyl-1-(pyridazin-3-yl)piperidin-3-amine[.. B 100.0
/100.0 5
/5 R1AB_SARS2 Non-structural protein 3

5s2y C W0M
(2R)-2-(4-chlorophenoxy)propanamide[13 atoms] B 100.0
/100.0 5
/5 R1AB_SARS2 Non-structural protein 3

5s31 C W0S
1-(3,4,5-trimethoxyphenyl)methanamine[14 atoms] B 100.0
/100.0 5
/5 R1AB_SARS2 Non-structural protein 3

5s36 D 7ZC
1-(5-methoxy-1H-indol-3-yl)-N,N-dimethyl-methanami.. B 100.0
/100.0 6
/6 R1AB_SARS2 Non-structural protein 3

5s3i C W1P
5-methyl-2-phenyl-2,4-dihydro-3H-pyrazol-3-one[13 .. B 100.0
/100.0 6
/6 R1AB_SARS2 Non-structural protein 3

5s3q D W2A
(2R,3R)-2-methyl-1-(methylsulfonyl)piperidine-3-ca.. B 100.0
/100.0 4
/4 R1AB_SARS2 Non-structural protein 3

5s3q E W2A
(2R,3R)-2-methyl-1-(methylsulfonyl)piperidine-3-ca.. B 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 3

5s3r C W24
(2S,3S)-N,2-dimethyl-1-(methylsulfonyl)piperidine-.. B 100.0
/100.0 6
/6 R1AB_SARS2 Non-structural protein 3

5s3t E W2G
(1R,2S)-2-(thiophen-3-yl)cyclopentane-1-carboxylic.. B 100.0
/100.0 5
/5 R1AB_SARS2 Non-structural protein 3

5s3v C W2M
(2R)-1',4'-dihydro-2'H-spiro[pyrrolidine-2,3'-quin.. B 100.0
/100.0 6
/6 R1AB_SARS2 Non-structural protein 3

5s3w C W2S
(3R,4R)-4-(2-methylphenyl)oxolane-3-carboxylic aci.. B 100.0
/100.0 5
/5 R1AB_SARS2 Non-structural protein 3

5s3y C W2Y
(2S,3S)-2-methyl-1-(methylsulfonyl)piperidine-3-ca.. B 100.0
/100.0 7
/7 R1AB_SARS2 Non-structural protein 3

5s43 C UUJ
5-bromo-2-hydroxybenzonitrile[10 atoms] B 100.0
/100.0 6
/6 R1AB_SARS2 Non-structural protein 3

5s4k C W44
(2S,5R,6R)-7-methyl-2,3,4,5,6,7-hexahydro-1H-2,6-m.. B 100.0
/100.0 6
/6 R1AB_SARS2 Non-structural protein 3

6w6y C AMP
ADENOSINE MONOPHOSPHATE[23 atoms] A 100.0
/100.0 16
/16 R1AB_SARS2 Non-structural protein 3

6woj E APR
ADENOSINE-5-DIPHOSPHORIBOSE[36 atoms] A 100.0
/100.0 21
/21 R1AB_SARS2 Non-structural protein 3

6woj F APR
ADENOSINE-5-DIPHOSPHORIBOSE[36 atoms] B 100.0
/100.0 22
/22 R1AB_SARS2 Non-structural protein 3

6woj G APR
ADENOSINE-5-DIPHOSPHORIBOSE[36 atoms] C 100.0
/100.0 22
/22 R1AB_SARS2 Non-structural protein 3

6woj H APR
ADENOSINE-5-DIPHOSPHORIBOSE[36 atoms] D 100.0
/100.0 23
/23 R1AB_SARS2 Non-structural protein 3

6ywl F APR
ADENOSINE-5-DIPHOSPHORIBOSE[36 atoms] A 100.0
/100.0 22
/22 R1AB_SARS2 NSP3 macrodomain

6ywl M APR
ADENOSINE-5-DIPHOSPHORIBOSE[36 atoms] B 100.0
/100.0 24
/24 R1AB_SARS2 NSP3 macrodomain

6ywl P APR
ADENOSINE-5-DIPHOSPHORIBOSE[36 atoms] C 100.0
/100.0 24
/24 R1AB_SARS2 NSP3 macrodomain

6ywl T APR
ADENOSINE-5-DIPHOSPHORIBOSE[36 atoms] D 100.0
/100.0 22
/22 R1AB_SARS2 NSP3 macrodomain

6ywl X APR
ADENOSINE-5-DIPHOSPHORIBOSE[36 atoms] E 100.0
/100.0 23
/23 R1AB_SARS2 NSP3 macrodomain

6z5t C APR
ADENOSINE-5-DIPHOSPHORIBOSE[36 atoms] A 100.0
/100.0 20
/20 R1AB_SARS2 Replicase polyprotein 1ab

6z5t E APR
ADENOSINE-5-DIPHOSPHORIBOSE[36 atoms] B 100.0
/100.0 20
/20 R1AB_SARS2 Replicase polyprotein 1ab

7c33 E APR
ADENOSINE-5-DIPHOSPHORIBOSE[36 atoms] A 100.0
/100.0 22
/22 R1A_SARS2 Non-structural protein 3

7cz4 C APR
ADENOSINE-5-DIPHOSPHORIBOSE[36 atoms] A 100.0
/100.0 21
/21 R1A_SARS2 Non-structural protein 3

8azd C APR
ADENOSINE-5-DIPHOSPHORIBOSE[36 atoms] A 100.0
/100.0 22
/22 R1A_SARS2 Papain-like protease nsp3

8azd D APR
ADENOSINE-5-DIPHOSPHORIBOSE[36 atoms] B 100.0
/100.0 23
/23 R1A_SARS2 Papain-like protease nsp3

6z6i E A1R
5'-O-[(S)-{[(S)-{[(2R,3R,4S)-3,4-DIHYDROXYPYRROLID.. A 100.0
/100.0 22
/22 R1AB_SARS2 Replicase polyprotein 1ab

6z6i J A1R
5'-O-[(S)-{[(S)-{[(2R,3R,4S)-3,4-DIHYDROXYPYRROLID.. A 100.0
/100.0 5
/5 R1AB_SARS2 Replicase polyprotein 1ab

6z6i M A1R
5'-O-[(S)-{[(S)-{[(2R,3R,4S)-3,4-DIHYDROXYPYRROLID.. B 100.0
/100.0 23
/23 R1AB_SARS2 Replicase polyprotein 1ab

6z6i R A1R
5'-O-[(S)-{[(S)-{[(2R,3R,4S)-3,4-DIHYDROXYPYRROLID.. C 100.0
/100.0 23
/23 R1AB_SARS2 Replicase polyprotein 1ab

6z6i X A1R
5'-O-[(S)-{[(S)-{[(2R,3R,4S)-3,4-DIHYDROXYPYRROLID.. C 100.0
/100.0 5
/5 R1AB_SARS2 Replicase polyprotein 1ab

6z6i CA A1R
5'-O-[(S)-{[(S)-{[(2R,3R,4S)-3,4-DIHYDROXYPYRROLID.. D 100.0
/100.0 23
/23 R1AB_SARS2 Replicase polyprotein 1ab

6z6i O MPO
3[N-MORPHOLINO]PROPANE SULFONIC ACID[13 atoms] B 100.0
/100.0 3
/3 R1AB_SARS2 Replicase polyprotein 1ab

8azc C MPO
3[N-MORPHOLINO]PROPANE SULFONIC ACID[13 atoms] A 100.0
/100.0 3
/3 R1A_SARS2 Papain-like protease nsp3

6z72 E A3R
Adenosine Diphosphate (Hydroxymethyl)pyrrolidine m.. A 100.0
/100.0 23
/23 R1AB_SARS2 Replicase polyprotein 1ab

6z72 J A3R
Adenosine Diphosphate (Hydroxymethyl)pyrrolidine m.. B 100.0
/100.0 23
/23 R1AB_SARS2 Replicase polyprotein 1ab

6z72 M A3R
Adenosine Diphosphate (Hydroxymethyl)pyrrolidine m.. C 100.0
/100.0 20
/20 R1AB_SARS2 Replicase polyprotein 1ab

6z72 Q A3R
Adenosine Diphosphate (Hydroxymethyl)pyrrolidine m.. D 100.0
/100.0 22
/22 R1AB_SARS2 Replicase polyprotein 1ab

6z72 R MLT
D-MALATE[9 atoms] D 100.0
/100.0 3
/3 R1AB_SARS2 Replicase polyprotein 1ab

7bf3 I ADN
ADENOSINE[19 atoms] A 100.0
/100.0 11
/11 R1AB_SARS2 NSP3 macrodomain

7bf3 L ADN
ADENOSINE[19 atoms] B 100.0
/100.0 6
/6 R1AB_SARS2 NSP3 macrodomain

7bf4 B 5GP
GUANOSINE-5'-MONOPHOSPHATE[24 atoms] A 100.0
/100.0 7
/7 R1AB_SARS2 NSP3 macrodomain

7bf5 G A2R
[(2R,3R,4R,5R)-5-(6-AMINO-9H-PURIN-9-YL)-3-HYDROXY.. A 100.0
/100.0 23
/23 R1AB_SARS2 NSP3 macrodomain

7bf5 J A2R
[(2R,3R,4R,5R)-5-(6-AMINO-9H-PURIN-9-YL)-3-HYDROXY.. B 100.0
/100.0 21
/21 R1AB_SARS2 NSP3 macrodomain

7bf5 M A2R
[(2R,3R,4R,5R)-5-(6-AMINO-9H-PURIN-9-YL)-3-HYDROXY.. C 100.0
/100.0 22
/22 R1AB_SARS2 NSP3 macrodomain

7bf5 V A2R
[(2R,3R,4R,5R)-5-(6-AMINO-9H-PURIN-9-YL)-3-HYDROXY.. E 100.0
/100.0 21
/21 R1AB_SARS2 NSP3 macrodomain

7bf6 D U08
(2~{R},3~{R},4~{S},5~{R})-2-(4-azanylpyrrolo[2,1-f.. A 100.0
/100.0 13
/13 R1AB_SARS2 Papain-like protease nsp3

7bf6 H U08
(2~{R},3~{R},4~{S},5~{R})-2-(4-azanylpyrrolo[2,1-f.. B 100.0
/100.0 14
/14 R1AB_SARS2 Papain-like protease nsp3

7qg7 C U08
(2~{R},3~{R},4~{S},5~{R})-2-(4-azanylpyrrolo[2,1-f.. A 100.0
/100.0 14
/14 R1AB_SARS2 Papain-like protease nsp3

7qg7 F U08
(2~{R},3~{R},4~{S},5~{R})-2-(4-azanylpyrrolo[2,1-f.. B 100.0
/100.0 13
/13 R1AB_SARS2 Papain-like protease nsp3

7jiv B VBY
5-(acryloylamino)-2-methyl-N-[(1R)-1-(naphthalen-1.. A 100.0
/99.7 11
/11 R1A_SARS2 Papain-like protease

7jiw B VBY
5-(acryloylamino)-2-methyl-N-[(1R)-1-(naphthalen-1.. A 100.0
/100.0 11
/11 R1A_SARS2 Papain-like protease

7kok B Y96
5-[(E)-(hydroxyimino)methyl]-2-methyl-N-[(1R)-1-(n.. A 100.0
/99.7 10
/10 R1A_SARS2 Papain-like protease

7kol B Y96
5-[(E)-(hydroxyimino)methyl]-2-methyl-N-[(1R)-1-(n.. A 100.0
/100.0 11
/11 R1A_SARS2 Papain-like protease

7lbr F XT7
5-[(azetidin-3-yl)amino]-N-[(1R)-1-{3-[5-({[(1S,3R.. A 100.0
/100.0 11
/11 R1A_SARS2 Non-structural protein 3

7lbr K XT7
5-[(azetidin-3-yl)amino]-N-[(1R)-1-{3-[5-({[(1S,3R.. B 100.0
/100.0 13
/13 R1A_SARS2 Non-structural protein 3

7lbs C XR8
5-[(azetidin-3-yl)amino]-2-methyl-N-[(1R)-1-(3-{5-.. A 100.0
/100.0 12
/12 R1A_SARS2 Non-structural protein 3

7lbs J XR8
5-[(azetidin-3-yl)amino]-2-methyl-N-[(1R)-1-(3-{5-.. B 100.0
/100.0 11
/11 R1A_SARS2 Non-structural protein 3

7llf I Y54
5-[(azetidin-3-yl)amino]-N-[(1R)-1-{3-[5-({[(1R,3S.. A 100.0
/100.0 11
/11 R1A_SARS2 Non-structural protein 3

7llf N Y54
5-[(azetidin-3-yl)amino]-N-[(1R)-1-{3-[5-({[(1R,3S.. B 100.0
/100.0 11
/11 R1A_SARS2 Non-structural protein 3

7llz C Y61
N-[(1R)-1-(3-{5-[(acetylamino)methyl]thiophen-2-yl.. A 100.0
/100.0 11
/11 R1A_SARS2 Non-structural protein 3

7llz H Y61
N-[(1R)-1-(3-{5-[(acetylamino)methyl]thiophen-2-yl.. B 100.0
/100.0 11
/11 R1A_SARS2 Non-structural protein 3

7los E Y97
5-(azetidin-3-ylamino)-2-methyl-~{N}-[(1~{R})-1-[3.. A 100.0
/100.0 11
/11 R1A_SARS2 Non-structural protein 3

7los L Y97
5-(azetidin-3-ylamino)-2-methyl-~{N}-[(1~{R})-1-[3.. B 100.0
/100.0 12
/12 R1A_SARS2 Non-structural protein 3

7nt4 C PRL
PROFLAVIN[16 atoms] A 100.0
/100.0 5
/5 R1AB_SARS2 Non-structural protein 3

7nt4 D PRL
PROFLAVIN[16 atoms] A 100.0
/100.0 8
/8 R1AB_SARS2 Non-structural protein 3

7nt4 E PRL
PROFLAVIN[16 atoms] A 100.0
/100.0 5
/5 R1AB_SARS2 Non-structural protein 3

7nt4 M PRL
PROFLAVIN[16 atoms] B 100.0
/100.0 5
/5 R1AB_SARS2 Non-structural protein 3

7nt4 N PRL
PROFLAVIN[16 atoms] B 100.0
/100.0 5
/5 R1AB_SARS2 Non-structural protein 3

7nt4 O PRL
PROFLAVIN[16 atoms] B 100.0
/100.0 8
/8 R1AB_SARS2 Non-structural protein 3

7ofs E YRL
4-(2-hydroxyethyl)phenol[10 atoms] A 100.0
/100.0 10
/10 R1A_SARS2 Papain-like protease nsp3

7oft K HBA
P-HYDROXYBENZALDEHYDE[9 atoms] A 100.0
/100.0 9
/9 R1A_SARS2 Papain-like protease nsp3

7ofu B HE9
methyl 3,4-bis(oxidanyl)benzoate[12 atoms] A 100.0
/100.0 3
/3 R1A_SARS2 Papain-like protease nsp3

7qcg B DZI
3,4,5-tris(oxidanyl)-N-[(E)-1H-pyrrol-2-ylmethylid.. A 100.0
/100.0 7
/7 R1A_SARS2 Papain-like protease nsp3

7qch B A5I
N-(3,5-dimetoxy-4-hydroxybenzyliden)thiosemicarbaz.. A 100.0
/100.0 10
/10 R1A_SARS2 Papain-like protease nsp3

7qci B A6Q
N-(3,4-dihydroxybenzylidene)-thiosemicarbazone[16 .. A 100.0
/100.0 10
/10 R1A_SARS2 Papain-like protease nsp3

7qcj F A4O
N-(2,4-dihydroxybenzylidene)-thiosemicarbazone[14 .. A 100.0
/100.0 10
/10 R1A_SARS2 Papain-like protease nsp3

7qck B A7L
N-(2,5-dihydroxybenzylidene)-thiosemicarbazone[16 .. A 100.0
/100.0 9
/9 R1A_SARS2 Papain-like protease nsp3

7sdr D JW9
4-({methyl[(1R)-1-(naphthalen-1-yl)ethyl]amino}met.. A 100.0
/100.0 12
/12 R1A_SARS2 Non-structural protein 3

7sdr G JW9
4-({methyl[(1R)-1-(naphthalen-1-yl)ethyl]amino}met.. B 100.0
/100.0 11
/11 R1A_SARS2 Non-structural protein 3

7sdr N JW9
4-({methyl[(1R)-1-(naphthalen-1-yl)ethyl]amino}met.. C 100.0
/100.0 11
/11 R1A_SARS2 Non-structural protein 3

7sgv B L30
N-(naphthalen-1-yl)pyridine-3-carboxamide[19 atoms.. A 100.0
/99.7 9
/9 R1A_SARS2 Papain-like protease

7sgw B L30
N-(naphthalen-1-yl)pyridine-3-carboxamide[19 atoms.. A 100.0
/100.0 9
/9 R1A_SARS2 Non-structural protein 3

8azi C OHR
2'-deoxyadenosine 5'-diphosphoribose [35 atoms] A 100.0
/100.0 22
/22 R1A_SARS2 Papain-like protease nsp3

8azi D OHR
2'-deoxyadenosine 5'-diphosphoribose [35 atoms] B 100.0
/100.0 22
/22 R1A_SARS2 Papain-like protease nsp3

8azl C OI3
2'-deoxyadenosine 5'-fluoro-diphosphoribose [36 at.. A 100.0
/100.0 23
/23 R1A_SARS2 Papain-like protease nsp3

8azl D OI3
2'-deoxyadenosine 5'-fluoro-diphosphoribose [36 at.. B 100.0
/100.0 22
/22 R1A_SARS2 Papain-like protease nsp3

8azm C OI6
8-bromoadenosine 5'-diphosphoribose [37 atoms] A 100.0
/100.0 22
/22 R1A_SARS2 Papain-like protease nsp3

8azm D OI6
8-bromoadenosine 5'-diphosphoribose [37 atoms] B 100.0
/100.0 21
/21 R1A_SARS2 Papain-like protease nsp3

8azo C OIG
beta-ethyl-adenosine diphosphate[29 atoms] A 100.0
/100.0 14
/14 R1A_SARS2 Papain-like protease nsp3

8azo D OIG
beta-ethyl-adenosine diphosphate[29 atoms] B 100.0
/100.0 15
/15 R1A_SARS2 Papain-like protease nsp3

8azp C OH9
beta-methyl-adenosine diphosphate[28 atoms] A 100.0
/100.0 17
/17 R1A_SARS2 Papain-like protease nsp3

8azp D OH9
beta-methyl-adenosine diphosphate[28 atoms] B 100.0
/100.0 16
/16 R1A_SARS2 Papain-like protease nsp3

8eua B WUK
methyl 4-{2-[3-(2-{[(1R)-1-(naphthalen-1-yl)ethyl].. A 100.0
/100.0 18
/18 R1AB_SARS2 Papain-like protease nsp3

8g62 E YOO
3-methoxy-5-(1-methylpiperidin-4-yl)-N-[4-(pyrroli.. A 100.0
/100.0 10
/10 R1A_SARS2 Non-structural protein 3

8g62 F YOO
3-methoxy-5-(1-methylpiperidin-4-yl)-N-[4-(pyrroli.. A 100.0
/100.0 10
/10 R1A_SARS2 Non-structural protein 3

8g62 M YOO
3-methoxy-5-(1-methylpiperidin-4-yl)-N-[4-(pyrroli.. A 100.0
/100.0 4
/4 R1A_SARS2 Non-structural protein 3

8g62 O YOO
3-methoxy-5-(1-methylpiperidin-4-yl)-N-[4-(pyrroli.. B 100.0
/100.0 9
/9 R1A_SARS2 Non-structural protein 3

8g62 U YOO
3-methoxy-5-(1-methylpiperidin-4-yl)-N-[4-(pyrroli.. C 100.0
/100.0 4
/4 R1A_SARS2 Non-structural protein 3

8g62 W YOO
3-methoxy-5-(1-methylpiperidin-4-yl)-N-[4-(pyrroli.. C 100.0
/100.0 8
/8 R1A_SARS2 Non-structural protein 3

8gia C ZJ3
[(2R,3S,4R,5R)-5-(6-amino-9H-purin-9-yl)-3,4-dihyd.. A 100.0
/100.0 23
/23 R1AB_SARS2 Non-structural protein 3

8uob B XB5
5-[2-(dimethylamino)ethoxy]-N-{(1R)-1-[(3M,5P)-3-(.. A 100.0
/100.0 13
/13 R1A_SARS2 Papain-like protease nsp3

8uuf B XWO
N-{(1R)-1-[(3M,5P)-3,5-bis(1-methyl-1H-pyrazol-4-y.. A 100.0
/100.0 13
/13 R1A_SARS2 Papain-like protease nsp3

8uug B XXW
N-[(1R)-1-{(3M,5M)-3-[1-(difluoromethyl)-1H-pyrazo.. A 100.0
/100.0 14
/14 R1AB_SARS2 Papain-like protease nsp3

8uuh B XYI
5-[2-(dimethylamino)ethoxy]-2-methyl-N-[(1R)-1-{(3.. A 100.0
/100.0 15
/15 R1A_SARS2 Papain-like protease nsp3

8uuu B XYR
N-{(1R)-1-[(3P,5M)-3-[1-(difluoromethyl)-1H-pyrazo.. A 100.0
/100.0 15
/15 R1A_SARS2 Papain-like protease nsp3

8uuv B Y2I
N-{(1R)-1-[(3P,5P)-3-(1-cyclopropyl-1H-pyrazol-4-y.. A 100.0
/100.0 15
/15 R1A_SARS2 Papain-like protease nsp3

8uuw B Y2N
5-[2-(dimethylamino)ethoxy]-2-methyl-N-{(1R)-1-[(3.. A 100.0
/100.0 14
/14 R1A_SARS2 Papain-like protease nsp3

8uvm E Y3R
ethyl 4-oxo-4-(2-{3-[2-({(1S)-1-[(3P)-3-(thiophen-.. A 100.0
/100.0 19
/19 R1AB_SARS2 Papain-like protease nsp3

8uvm I Y3R
ethyl 4-oxo-4-(2-{3-[2-({(1S)-1-[(3P)-3-(thiophen-.. B 100.0
/100.0 18
/18 R1AB_SARS2 Papain-like protease nsp3

8uvm M Y3R
ethyl 4-oxo-4-(2-{3-[2-({(1S)-1-[(3P)-3-(thiophen-.. C 100.0
/100.0 18
/18 R1AB_SARS2 Papain-like protease nsp3

8uvm Q Y3R
ethyl 4-oxo-4-(2-{3-[2-({(1S)-1-[(3P)-3-(thiophen-.. D 100.0
/100.0 18
/18 R1AB_SARS2 Papain-like protease nsp3

7e35 D GYX
N-[(3-acetamidophenyl)methyl]-1-[(1R)-1-naphthalen.. A 100.0
/99.7 11
/11 R1AB_SARS2 Non-structural protein 3

7e35 F GYX
N-[(3-acetamidophenyl)methyl]-1-[(1R)-1-naphthalen.. A 100.0
/99.7 7
/7 R1AB_SARS2 Non-structural protein 3

7e35 D GYX
N-[(3-acetamidophenyl)methyl]-1-[(1R)-1-naphthalen.. B 100.0
/99.7 2
/2 R1AB_SARS2 Non-structural protein 3

7e35 F GYX
N-[(3-acetamidophenyl)methyl]-1-[(1R)-1-naphthalen.. B 100.0
/99.7 10
/10 R1AB_SARS2 Non-structural protein 3

7jit B Y95
5-[(carbamoylcarbamoyl)amino]-2-methyl-N-[(1R)-1-(.. A 100.0
/99.7 11
/11 R1A_SARS2 Papain-like protease

7koj B Y94
2-methyl-N-[(1R)-1-(naphthalen-1-yl)ethyl]-5-{[(pr.. A 100.0
/99.7 11
/11 R1A_SARS2 Papain-like protease

7sgu B 9EI
5-amino-N-(naphthalen-1-yl)pyridine-3-carboxamide[.. A 100.0
/99.7 8
/8 R1A_SARS2 Papain-like protease

7d7k D CFF
CAFFEINE[14 atoms] A 100.0
/99.7 4
/4 R1AB_SARS2 Non-structural protein 3

7d7k P CFF
CAFFEINE[14 atoms] B 100.0
/99.7 5
/5 R1AB_SARS2 Non-structural protein 3

7d7l D CFF
CAFFEINE[14 atoms] A 100.0
/99.7 4
/4 R1AB_SARS2 Non-structural protein 3

7d7l O CFF
CAFFEINE[14 atoms] B 100.0
/99.7 4
/4 R1AB_SARS2 Non-structural protein 3

7d7l E GXU
1-(2-methoxyethyl)-2-methyl-3-(pyrazin-2-ylmethyl).. A 100.0
/99.7 9
/9 R1AB_SARS2 Non-structural protein 3

7d7l F GXU
1-(2-methoxyethyl)-2-methyl-3-(pyrazin-2-ylmethyl).. A 100.0
/99.7 4
/4 R1AB_SARS2 Non-structural protein 3

7d7l P GXU
1-(2-methoxyethyl)-2-methyl-3-(pyrazin-2-ylmethyl).. B 100.0
/99.7 9
/9 R1AB_SARS2 Non-structural protein 3

7d7l Q GXU
1-(2-methoxyethyl)-2-methyl-3-(pyrazin-2-ylmethyl).. B 100.0
/99.7 3
/3 R1AB_SARS2 Non-structural protein 3

7d7l R GXU
1-(2-methoxyethyl)-2-methyl-3-(pyrazin-2-ylmethyl).. B 100.0
/99.7 4
/4 R1AB_SARS2 Non-structural protein 3

7m1y C 9JT
N-phenyl-2-selanylbenzamide[16 atoms] A 100.0
/99.7 7
/7 R1A_SARS2 Papain-like protease

7m1y S 9JT
N-phenyl-2-selanylbenzamide[16 atoms] B 100.0
/99.7 6
/6 R1A_SARS2 Papain-like protease

7rzc D JWX
(1R)-N-[(1H-indol-3-yl)methyl]-N-methyl-1-(naphtha.. A 100.0
/100.0 10
/10 R1A_SARS2 Non-structural protein 3

7rzc I JWX
(1R)-N-[(1H-indol-3-yl)methyl]-N-methyl-1-(naphtha.. B 100.0
/100.0 13
/13 R1A_SARS2 Non-structural protein 3

7rzc R JWX
(1R)-N-[(1H-indol-3-yl)methyl]-N-methyl-1-(naphtha.. C 100.0
/100.0 12
/12 R1A_SARS2 Non-structural protein 3

7sqe D JWX
(1R)-N-[(1H-indol-3-yl)methyl]-N-methyl-1-(naphtha.. A 100.0
/99.7 12
/12 R1A_SARS2 Papain-like protease

7sqe I JWX
(1R)-N-[(1H-indol-3-yl)methyl]-N-methyl-1-(naphtha.. B 100.0
/99.7 13
/13 R1A_SARS2 Papain-like protease

7sqe P JWX
(1R)-N-[(1H-indol-3-yl)methyl]-N-methyl-1-(naphtha.. C 100.0
/99.7 12
/12 R1A_SARS2 Papain-like protease

7jn2 B Y41
3-amino-2-methyl-N-[(1R)-1-(naphthalen-1-yl)ethyl].. A 100.0
/100.0 9
/9 R1A_SARS2 Papain-like protease

7krx B Y41
3-amino-2-methyl-N-[(1R)-1-(naphthalen-1-yl)ethyl].. A 100.0
/99.7 11
/11 R1A_SARS2 Papain-like protease

4ow0 D S88
N-[(3-fluorophenyl)methyl]-1-[(1R)-1-naphthalen-1-.. A 100.0
/82.6 10
/10 R1A_CVHSA papain-like protease

4ow0 I S88
N-[(3-fluorophenyl)methyl]-1-[(1R)-1-naphthalen-1-.. B 100.0
/81.1 10
/10 R1A_CVHSA papain-like protease

7tzj C S88
N-[(3-fluorophenyl)methyl]-1-[(1R)-1-naphthalen-1-.. A 100.0
/99.7 10
/10 R1A_SARS2 Papain-like protease

7tzj I S88
N-[(3-fluorophenyl)methyl]-1-[(1R)-1-naphthalen-1-.. B 100.0
/99.7 11
/11 R1A_SARS2 Papain-like protease

7ybg C MLA
MALONIC ACID[7 atoms] A 83.3
/99.1 6
/6 R1A_SARS2 Papain-like protease nsp3

4m0w E NHE
2-[N-CYCLOHEXYLAMINO]ETHANE SULFONIC ACID[13 atoms.. A 85.7
/82.3 7
/7 R1A_CVHSA Replicase polyprotein 1a

4m0w F NHE
2-[N-CYCLOHEXYLAMINO]ETHANE SULFONIC ACID[13 atoms.. A 83.3
/82.3 6
/6 R1A_CVHSA Replicase polyprotein 1a

3e9s B TTT
5-amino-2-methyl-N-[(1R)-1-naphthalen-1-ylethyl]be.. A 100.0
/82.7 10
/10 R1A_CVHSA Non-structural protein 3

7cjm B TTT
5-amino-2-methyl-N-[(1R)-1-naphthalen-1-ylethyl]be.. A 100.0
/99.7 10
/10 R1AB_SARS2 Non-structural protein 3

7cmd E TTT
5-amino-2-methyl-N-[(1R)-1-naphthalen-1-ylethyl]be.. A 100.0
/100.0 10
/10 R1AB_SARS2 Non-structural protein 3

7cmd I TTT
5-amino-2-methyl-N-[(1R)-1-naphthalen-1-ylethyl]be.. B 100.0
/100.0 10
/10 R1AB_SARS2 Non-structural protein 3

7cmd M TTT
5-amino-2-methyl-N-[(1R)-1-naphthalen-1-ylethyl]be.. C 100.0
/100.0 10
/10 R1AB_SARS2 Non-structural protein 3

7cmd O TTT
5-amino-2-methyl-N-[(1R)-1-naphthalen-1-ylethyl]be.. D 100.0
/100.0 9
/9 R1AB_SARS2 Non-structural protein 3

7jir B TTT
5-amino-2-methyl-N-[(1R)-1-naphthalen-1-ylethyl]be.. A 100.0
/99.7 11
/11 R1A_SARS2 Papain-like protease

7jrn C TTT
5-amino-2-methyl-N-[(1R)-1-naphthalen-1-ylethyl]be.. A 100.0
/100.0 11
/11 R1A_SARS2 Non-structural protein 3

7jrn G TTT
5-amino-2-methyl-N-[(1R)-1-naphthalen-1-ylethyl]be.. B 100.0
/100.0 10
/10 R1A_SARS2 Non-structural protein 3

7skq E TTT
5-amino-2-methyl-N-[(1R)-1-naphthalen-1-ylethyl]be.. A 100.0
/82.1 10
/10 Q0QDZ2_SARS 3C-like proteinase

7skq F TTT
5-amino-2-methyl-N-[(1R)-1-naphthalen-1-ylethyl]be.. B 100.0
/82.2 9
/9 Q0QDZ2_SARS 3C-like proteinase

7skr B 9OZ
N-[(2-methoxypyridin-4-yl)methyl]-2-[(1R)-1-(napht.. A 100.0
/82.1 10
/10 Q0QDZ2_SARS 3C-like proteinase

7skr B 9OZ
N-[(2-methoxypyridin-4-yl)methyl]-2-[(1R)-1-(napht.. A 100.0
/82.1 10
/10 Q0QDZ2_SARS 3C-like proteinase

3mj5 C GRM
N-(1,3-benzodioxol-5-ylmethyl)-1-[(1R)-1-naphthale.. A 100.0
/82.7 9
/9 R1A_CVHSA Replicase polyprotein 1a

3mj5 E GRM
N-(1,3-benzodioxol-5-ylmethyl)-1-[(1R)-1-naphthale.. A 100.0
/82.7 4
/4 R1A_CVHSA Replicase polyprotein 1a

3mj5 C GRM
N-(1,3-benzodioxol-5-ylmethyl)-1-[(1R)-1-naphthale.. B 100.0
/81.3 4
/4 R1A_CVHSA Replicase polyprotein 1a

3mj5 E GRM
N-(1,3-benzodioxol-5-ylmethyl)-1-[(1R)-1-naphthale.. B 100.0
/81.3 11
/11 R1A_CVHSA Replicase polyprotein 1a

4ovz D P85
N-[(4-fluorophenyl)methyl]-1-[(1R)-1-naphthalen-1-.. A 100.0
/82.5 11
/11 R1A_CVHSA Papain-like proteinase

4ovz G P85
N-[(4-fluorophenyl)methyl]-1-[(1R)-1-naphthalen-1-.. B 100.0
/81.3 11
/11 R1A_CVHSA Papain-like proteinase

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

METAL

1945 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

2fe8 E BR
BROMIDE ION[1 atoms] A 75.0
/82.8 4
/4 R1AB_CVHSA Replicase polyprotein 1ab

2fe8 E BR
BROMIDE ION[1 atoms] A 75.0
/82.8 4
/4 R1AB_CVHSA Replicase polyprotein 1ab

2fe8 F BR
BROMIDE ION[1 atoms] A 100.0
/82.8 3
/3 R1AB_CVHSA Replicase polyprotein 1ab

2fe8 F BR
BROMIDE ION[1 atoms] A 100.0
/82.8 3
/3 R1AB_CVHSA Replicase polyprotein 1ab

2fe8 G BR
BROMIDE ION[1 atoms] A 100.0
/82.8 4
/4 R1AB_CVHSA Replicase polyprotein 1ab

2fe8 G BR
BROMIDE ION[1 atoms] A 100.0
/82.8 4
/4 R1AB_CVHSA Replicase polyprotein 1ab

2fe8 J BR
BROMIDE ION[1 atoms] B 75.0
/82.7 4
/4 R1AB_CVHSA Replicase polyprotein 1ab

2fe8 J BR
BROMIDE ION[1 atoms] B 75.0
/82.7 4
/4 R1AB_CVHSA Replicase polyprotein 1ab

2fe8 K BR
BROMIDE ION[1 atoms] B 100.0
/82.7 3
/3 R1AB_CVHSA Replicase polyprotein 1ab

2fe8 K BR
BROMIDE ION[1 atoms] B 100.0
/82.7 3
/3 R1AB_CVHSA Replicase polyprotein 1ab

2fe8 L BR
BROMIDE ION[1 atoms] B 100.0
/82.7 4
/4 R1AB_CVHSA Replicase polyprotein 1ab

2fe8 L BR
BROMIDE ION[1 atoms] B 100.0
/82.7 4
/4 R1AB_CVHSA Replicase polyprotein 1ab

2fe8 O BR
BROMIDE ION[1 atoms] C 75.0
/82.7 4
/4 R1AB_CVHSA Replicase polyprotein 1ab

2fe8 O BR
BROMIDE ION[1 atoms] C 75.0
/82.7 4
/4 R1AB_CVHSA Replicase polyprotein 1ab

2fe8 P BR
BROMIDE ION[1 atoms] C 100.0
/82.7 3
/3 R1AB_CVHSA Replicase polyprotein 1ab

2fe8 P BR
BROMIDE ION[1 atoms] C 100.0
/82.7 3
/3 R1AB_CVHSA Replicase polyprotein 1ab

2fe8 Q BR
BROMIDE ION[1 atoms] C 100.0
/82.7 4
/4 R1AB_CVHSA Replicase polyprotein 1ab

2fe8 Q BR
BROMIDE ION[1 atoms] C 100.0
/82.7 4
/4 R1AB_CVHSA Replicase polyprotein 1ab

8cx9 N BR
BROMIDE ION[1 atoms] A 100.0
/100.0 3
/3 R1A_SARS2 Papain-like protease nsp3

8cx9 P BR
BROMIDE ION[1 atoms] B 100.0
/100.0 3
/3 R1A_SARS2 Papain-like protease nsp3

8cx9 Q BR
BROMIDE ION[1 atoms] B 100.0
/100.0 3
/3 R1A_SARS2 Papain-like protease nsp3

8cx9 V BR
BROMIDE ION[1 atoms] D 100.0
/100.0 3
/3 R1A_SARS2 Papain-like protease nsp3

3e9s D CL
CHLORIDE ION[1 atoms] A 100.0
/82.7 2
/2 R1A_CVHSA Non-structural protein 3

3e9s E CL
CHLORIDE ION[1 atoms] A 75.0
/82.7 4
/4 R1A_CVHSA Non-structural protein 3

6w9c E CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 7
/7 R1A_SARS2 Non-structural protein 3

6w9c G CL
CHLORIDE ION[1 atoms] B 100.0
/100.0 5
/5 R1A_SARS2 Non-structural protein 3

6w9c J CL
CHLORIDE ION[1 atoms] C 100.0
/100.0 6
/6 R1A_SARS2 Non-structural protein 3

6wen B CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 3

6wrh F CL
CHLORIDE ION[1 atoms] A 100.0
/99.7 3
/3 R1AB_SARS2 Non-structural protein 3

6wrh G CL
CHLORIDE ION[1 atoms] A 100.0
/99.7 6
/6 R1AB_SARS2 Non-structural protein 3

6wzu F CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 3

6wzu G CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 6
/6 R1AB_SARS2 Non-structural protein 3

6xg3 D CL
CHLORIDE ION[1 atoms] A 100.0
/99.7 6
/6 R1AB_SARS2 Non-structural protein 3

6xg3 D CL
CHLORIDE ION[1 atoms] A 100.0
/99.7 6
/6 R1AB_SARS2 Non-structural protein 3

7jir G CL
CHLORIDE ION[1 atoms] A 100.0
/99.7 6
/6 R1A_SARS2 Papain-like protease

7jir H CL
CHLORIDE ION[1 atoms] A 100.0
/99.7 4
/4 R1A_SARS2 Papain-like protease

7jir I CL
CHLORIDE ION[1 atoms] A 100.0
/99.7 1
/1 R1A_SARS2 Papain-like protease

7jir J CL
CHLORIDE ION[1 atoms] A 100.0
/99.7 3
/3 R1A_SARS2 Papain-like protease

7jit G CL
CHLORIDE ION[1 atoms] A 100.0
/99.7 6
/6 R1A_SARS2 Papain-like protease

7jit H CL
CHLORIDE ION[1 atoms] A 100.0
/99.7 4
/4 R1A_SARS2 Papain-like protease

7jit I CL
CHLORIDE ION[1 atoms] A 100.0
/99.7 1
/1 R1A_SARS2 Papain-like protease

7jiv H CL
CHLORIDE ION[1 atoms] A 100.0
/99.7 6
/6 R1A_SARS2 Papain-like protease

7jiv I CL
CHLORIDE ION[1 atoms] A 100.0
/99.7 4
/4 R1A_SARS2 Papain-like protease

7jiv J CL
CHLORIDE ION[1 atoms] A 100.0
/99.7 1
/1 R1A_SARS2 Papain-like protease

7jiw G CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 4
/4 R1A_SARS2 Papain-like protease

7jiw H CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 1
/1 R1A_SARS2 Papain-like protease

7jiw I CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 5
/5 R1A_SARS2 Papain-like protease

7jiw J CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 2
/2 R1A_SARS2 Papain-like protease

7jn2 H CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 6
/6 R1A_SARS2 Papain-like protease

7jn2 I CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 4
/4 R1A_SARS2 Papain-like protease

7jn2 J CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 1
/1 R1A_SARS2 Papain-like protease

7jn2 K CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 4
/4 R1A_SARS2 Papain-like protease

7koj G CL
CHLORIDE ION[1 atoms] A 100.0
/99.7 4
/4 R1A_SARS2 Papain-like protease

7koj H CL
CHLORIDE ION[1 atoms] A 100.0
/99.7 1
/1 R1A_SARS2 Papain-like protease

7koj I CL
CHLORIDE ION[1 atoms] A 100.0
/99.7 3
/3 R1A_SARS2 Papain-like protease

7kok G CL
CHLORIDE ION[1 atoms] A 100.0
/99.7 6
/6 R1A_SARS2 Papain-like protease

7kok H CL
CHLORIDE ION[1 atoms] A 100.0
/99.7 4
/4 R1A_SARS2 Papain-like protease

7kok I CL
CHLORIDE ION[1 atoms] A 100.0
/99.7 1
/1 R1A_SARS2 Papain-like protease

7kol G CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 4
/4 R1A_SARS2 Papain-like protease

7kol H CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 1
/1 R1A_SARS2 Papain-like protease

7kol I CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 2
/2 R1A_SARS2 Papain-like protease

7kol J CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 5
/5 R1A_SARS2 Papain-like protease

7krx G CL
CHLORIDE ION[1 atoms] A 100.0
/99.7 4
/4 R1A_SARS2 Papain-like protease

7krx H CL
CHLORIDE ION[1 atoms] A 100.0
/99.7 1
/1 R1A_SARS2 Papain-like protease

7lfv FA CL
CHLORIDE ION[1 atoms] B 100.0
/82.8 1
/1 R1A_SARS papain-like protease

7los M CL
CHLORIDE ION[1 atoms] B 100.0
/100.0 1
/1 R1A_SARS2 Non-structural protein 3

7m1y E CL
CHLORIDE ION[1 atoms] A 100.0
/99.7 4
/4 R1A_SARS2 Papain-like protease

7m1y U CL
CHLORIDE ION[1 atoms] B 100.0
/99.7 4
/4 R1A_SARS2 Papain-like protease

7nfv D CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 3
/3 R1A_SARS2 Papain-like protease nsp3

7nfv F CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 4
/4 R1A_SARS2 Papain-like protease nsp3

7ofs C CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 4
/4 R1A_SARS2 Papain-like protease nsp3

7ofs D CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 4
/4 R1A_SARS2 Papain-like protease nsp3

7ofs F CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 4
/4 R1A_SARS2 Papain-like protease nsp3

7oft C CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 3
/3 R1A_SARS2 Papain-like protease nsp3

7oft D CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 4
/4 R1A_SARS2 Papain-like protease nsp3

7oft E CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 3
/3 R1A_SARS2 Papain-like protease nsp3

7oft F CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 2
/2 R1A_SARS2 Papain-like protease nsp3

7oft G CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 4
/4 R1A_SARS2 Papain-like protease nsp3

7oft H CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 4
/4 R1A_SARS2 Papain-like protease nsp3

7oft I CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 2
/2 R1A_SARS2 Papain-like protease nsp3

7oft J CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 2
/2 R1A_SARS2 Papain-like protease nsp3

7ofu J CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 3
/3 R1A_SARS2 Papain-like protease nsp3

7qcg F CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 3
/3 R1A_SARS2 Papain-like protease nsp3

7qch K CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 3
/3 R1A_SARS2 Papain-like protease nsp3

7qci K CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 3
/3 R1A_SARS2 Papain-like protease nsp3

7qcj L CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 2
/2 R1A_SARS2 Papain-like protease nsp3

7qcj M CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 3
/3 R1A_SARS2 Papain-like protease nsp3

7qcj N CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 1
/1 R1A_SARS2 Papain-like protease nsp3

7qcj O CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 3
/3 R1A_SARS2 Papain-like protease nsp3

7qcj P CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 4
/4 R1A_SARS2 Papain-like protease nsp3

7qck J CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 3
/3 R1A_SARS2 Papain-like protease nsp3

7qck K CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 2
/2 R1A_SARS2 Papain-like protease nsp3

7qck L CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 1
/1 R1A_SARS2 Papain-like protease nsp3

7qcm I CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 3
/3 R1A_SARS2 Papain-like protease nsp3

7qcm J CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 2
/2 R1A_SARS2 Papain-like protease nsp3

7qcm K CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 2
/2 R1A_SARS2 Papain-like protease nsp3

7rbr D CL
CHLORIDE ION[1 atoms] A 100.0
/99.7 2
/2 R1A_SARS2 Papain-like protease

7rbr E CL
CHLORIDE ION[1 atoms] A 100.0
/99.7 6
/6 R1A_SARS2 Papain-like protease

7rzc F CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 3
/3 R1A_SARS2 Non-structural protein 3

7rzc K CL
CHLORIDE ION[1 atoms] B 100.0
/100.0 6
/6 R1A_SARS2 Non-structural protein 3

7rzc Q CL
CHLORIDE ION[1 atoms] B 100.0
/100.0 3
/3 R1A_SARS2 Non-structural protein 3

7rzc T CL
CHLORIDE ION[1 atoms] C 100.0
/100.0 7
/7 R1A_SARS2 Non-structural protein 3

7sdr I CL
CHLORIDE ION[1 atoms] B 100.0
/100.0 2
/2 R1A_SARS2 Non-structural protein 3

7sgu D CL
CHLORIDE ION[1 atoms] A 100.0
/99.7 4
/4 R1A_SARS2 Papain-like protease

7sgu E CL
CHLORIDE ION[1 atoms] A 100.0
/99.7 3
/3 R1A_SARS2 Papain-like protease

7sgv D CL
CHLORIDE ION[1 atoms] A 100.0
/99.7 3
/3 R1A_SARS2 Papain-like protease

7sgv E CL
CHLORIDE ION[1 atoms] A 100.0
/99.7 4
/4 R1A_SARS2 Papain-like protease

7sgv F CL
CHLORIDE ION[1 atoms] A 80.0
/99.7 5
/5 R1A_SARS2 Papain-like protease

7sgv G CL
CHLORIDE ION[1 atoms] A 100.0
/99.7 4
/4 R1A_SARS2 Papain-like protease

7sgw D CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 3
/3 R1A_SARS2 Non-structural protein 3

7sqe F CL
CHLORIDE ION[1 atoms] A 100.0
/99.7 3
/3 R1A_SARS2 Papain-like protease

7sqe G CL
CHLORIDE ION[1 atoms] A 80.0
/99.7 5
/5 R1A_SARS2 Papain-like protease

7sqe K CL
CHLORIDE ION[1 atoms] B 75.0
/99.7 4
/4 R1A_SARS2 Papain-like protease

7sqe O CL
CHLORIDE ION[1 atoms] B 100.0
/99.7 2
/2 R1A_SARS2 Papain-like protease

7sqe R CL
CHLORIDE ION[1 atoms] C 83.3
/99.7 6
/6 R1A_SARS2 Papain-like protease

7sqe S CL
CHLORIDE ION[1 atoms] C 100.0
/99.7 3
/3 R1A_SARS2 Papain-like protease

7ybg G CL
CHLORIDE ION[1 atoms] A 100.0
/99.1 3
/3 R1A_SARS2 Papain-like protease nsp3

8azc B CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 3
/3 R1A_SARS2 Papain-like protease nsp3

8cx9 W CL
CHLORIDE ION[1 atoms] D 100.0
/100.0 3
/3 R1A_SARS2 Papain-like protease nsp3

8fwn K CL
CHLORIDE ION[1 atoms] A 100.0
/99.7 5
/5 R1AB_SARS2 Papain-like protease nsp3

8fwo F CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 3
/3 R1AB_SARS2 Papain-like protease nsp3

8fwo G CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 6
/6 R1AB_SARS2 Papain-like protease nsp3

8fwo H CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 1
/1 R1AB_SARS2 Papain-like protease nsp3

8g62 H CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 3
/3 R1A_SARS2 Non-structural protein 3

8g62 I CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 4
/4 R1A_SARS2 Non-structural protein 3

8g62 Q CL
CHLORIDE ION[1 atoms] B 100.0
/100.0 4
/4 R1A_SARS2 Non-structural protein 3

8g62 R CL
CHLORIDE ION[1 atoms] B 100.0
/100.0 3
/3 R1A_SARS2 Non-structural protein 3

8g62 X CL
CHLORIDE ION[1 atoms] C 100.0
/100.0 4
/4 R1A_SARS2 Non-structural protein 3

8g62 Y CL
CHLORIDE ION[1 atoms] C 100.0
/100.0 4
/4 R1A_SARS2 Non-structural protein 3

8ilc G CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 2
/2 R1A_SARS2 Papain-like protease nsp3

8ilc H CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 1
/1 R1A_SARS2 Papain-like protease nsp3

8ufl C CL
CHLORIDE ION[1 atoms] A 100.0
/75.3 1
/1 R1A_SARS Papain-like protease nsp3

8ufl D CL
CHLORIDE ION[1 atoms] A 100.0
/75.3 1
/1 R1A_SARS Papain-like protease nsp3

8ufl E CL
CHLORIDE ION[1 atoms] A 0.0
/75.3 1
/1 R1A_SARS Papain-like protease nsp3

8ufl F CL
CHLORIDE ION[1 atoms] A 50.0
/75.3 2
/2 R1A_SARS Papain-like protease nsp3

8ufl G CL
CHLORIDE ION[1 atoms] A 25.0
/75.3 4
/4 R1A_SARS Papain-like protease nsp3

8ufl H CL
CHLORIDE ION[1 atoms] A 100.0
/75.3 1
/1 R1A_SARS Papain-like protease nsp3

8ufl I CL
CHLORIDE ION[1 atoms] A 100.0
/75.3 2
/2 R1A_SARS Papain-like protease nsp3

8ufl J CL
CHLORIDE ION[1 atoms] A 0.0
/75.3 1
/1 R1A_SARS Papain-like protease nsp3

8ufl Q CL
CHLORIDE ION[1 atoms] B 50.0
/75.4 2
/2 R1A_SARS Papain-like protease nsp3

8ufl R CL
CHLORIDE ION[1 atoms] B 100.0
/75.4 2
/2 R1A_SARS Papain-like protease nsp3

8ufl S CL
CHLORIDE ION[1 atoms] B 0.0
/75.4 1
/1 R1A_SARS Papain-like protease nsp3

8ufl T CL
CHLORIDE ION[1 atoms] B 0.0
/75.4 1
/1 R1A_SARS Papain-like protease nsp3

8ufl U CL
CHLORIDE ION[1 atoms] B 100.0
/75.4 1
/1 R1A_SARS Papain-like protease nsp3

8ufl V CL
CHLORIDE ION[1 atoms] B 100.0
/75.4 2
/2 R1A_SARS Papain-like protease nsp3

8ufl W CL
CHLORIDE ION[1 atoms] B 100.0
/75.4 1
/1 R1A_SARS Papain-like protease nsp3

8uob I CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 1
/1 R1A_SARS2 Papain-like protease nsp3

8uob J CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 4
/4 R1A_SARS2 Papain-like protease nsp3

8uuf H CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 4
/4 R1A_SARS2 Papain-like protease nsp3

8uuf I CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 2
/2 R1A_SARS2 Papain-like protease nsp3

8uuf J CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 4
/4 R1A_SARS2 Papain-like protease nsp3

8uuf K CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 1
/1 R1A_SARS2 Papain-like protease nsp3

8uug J CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 4
/4 R1AB_SARS2 Papain-like protease nsp3

8uug L CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 4
/4 R1AB_SARS2 Papain-like protease nsp3

8uug M CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 1
/1 R1AB_SARS2 Papain-like protease nsp3

8uuh J CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 3
/3 R1A_SARS2 Papain-like protease nsp3

8uuh L CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 1
/1 R1A_SARS2 Papain-like protease nsp3

8uuh M CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 4
/4 R1A_SARS2 Papain-like protease nsp3

8uuu J CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 4
/4 R1A_SARS2 Papain-like protease nsp3

8uuu K CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 4
/4 R1A_SARS2 Papain-like protease nsp3

8uuu L CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 1
/1 R1A_SARS2 Papain-like protease nsp3

8uuv I CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 2
/2 R1A_SARS2 Papain-like protease nsp3

8uuv J CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 1
/1 R1A_SARS2 Papain-like protease nsp3

8uuv K CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 3
/3 R1A_SARS2 Papain-like protease nsp3

8uuw J CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 4
/4 R1A_SARS2 Papain-like protease nsp3

8uuw K CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 1
/1 R1A_SARS2 Papain-like protease nsp3

8uuw L CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 4
/4 R1A_SARS2 Papain-like protease nsp3

8uuy N CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 4
/4 R1A_SARS2 Papain-like protease nsp3

8uuy O CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 1
/1 R1A_SARS2 Papain-like protease nsp3

8uuy P CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 3
/3 R1A_SARS2 Papain-like protease nsp3

8uvm G CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 3
/3 R1AB_SARS2 Papain-like protease nsp3

8uvm K CL
CHLORIDE ION[1 atoms] B 100.0
/100.0 3
/3 R1AB_SARS2 Papain-like protease nsp3

8uvm O CL
CHLORIDE ION[1 atoms] C 100.0
/100.0 3
/3 R1AB_SARS2 Papain-like protease nsp3

8uvm S CL
CHLORIDE ION[1 atoms] D 100.0
/100.0 2
/2 R1AB_SARS2 Papain-like protease nsp3

8uvm T CL
CHLORIDE ION[1 atoms] D 100.0
/100.0 4
/4 R1AB_SARS2 Papain-like protease nsp3

4m0w D NA
SODIUM ION[1 atoms] A 20.0
/82.3 5
/5 R1A_CVHSA Replicase polyprotein 1a

4ovz H NA
SODIUM ION[1 atoms] B 100.0
/81.3 5
/5 R1A_CVHSA Papain-like proteinase

5y3e C NA
SODIUM ION[1 atoms] A 100.0
/82.8 4
/4 R1A_CVHSA Replicase polyprotein 1a

5y3e D NA
SODIUM ION[1 atoms] A 40.0
/82.8 5
/5 R1A_CVHSA Replicase polyprotein 1a

5y3e E NA
SODIUM ION[1 atoms] A 83.3
/82.8 6
/6 R1A_CVHSA Replicase polyprotein 1a

5y3e F NA
SODIUM ION[1 atoms] A 100.0
/82.8 3
/3 R1A_CVHSA Replicase polyprotein 1a

5y3e G NA
SODIUM ION[1 atoms] A 100.0
/82.8 7
/7 R1A_CVHSA Replicase polyprotein 1a

5y3q D NA
SODIUM ION[1 atoms] A 100.0
/82.8 4
/4 R1A_CVHSA Replicase polyprotein 1a

5y3q E NA
SODIUM ION[1 atoms] A 40.0
/82.8 5
/5 R1A_CVHSA Replicase polyprotein 1a

5y3q F NA
SODIUM ION[1 atoms] A 83.3
/82.8 6
/6 R1A_CVHSA Replicase polyprotein 1a

5y3q G NA
SODIUM ION[1 atoms] A 100.0
/82.8 3
/3 R1A_CVHSA Replicase polyprotein 1a

5y3q H NA
SODIUM ION[1 atoms] A 100.0
/82.8 7
/7 R1A_CVHSA Replicase polyprotein 1a

6z5t D NA
SODIUM ION[1 atoms] A 100.0
/100.0 3
/3 R1AB_SARS2 Replicase polyprotein 1ab

6z5t F NA
SODIUM ION[1 atoms] B 100.0
/100.0 3
/3 R1AB_SARS2 Replicase polyprotein 1ab

6z6i K NA
SODIUM ION[1 atoms] A 100.0
/100.0 3
/3 R1AB_SARS2 Replicase polyprotein 1ab

6z6i L NA
SODIUM ION[1 atoms] A 100.0
/100.0 2
/2 R1AB_SARS2 Replicase polyprotein 1ab

6z6i Q NA
SODIUM ION[1 atoms] B 100.0
/100.0 2
/2 R1AB_SARS2 Replicase polyprotein 1ab

6z6i AA NA
SODIUM ION[1 atoms] C 100.0
/100.0 2
/2 R1AB_SARS2 Replicase polyprotein 1ab

6z6i BA NA
SODIUM ION[1 atoms] C 100.0
/100.0 2
/2 R1AB_SARS2 Replicase polyprotein 1ab

6z6i Y NA
SODIUM ION[1 atoms] C 100.0
/100.0 2
/2 R1AB_SARS2 Replicase polyprotein 1ab

6z6i Z NA
SODIUM ION[1 atoms] C 100.0
/100.0 3
/3 R1AB_SARS2 Replicase polyprotein 1ab

6z6i KA NA
SODIUM ION[1 atoms] D 100.0
/100.0 4
/4 R1AB_SARS2 Replicase polyprotein 1ab

6z72 I NA
SODIUM ION[1 atoms] A 100.0
/100.0 6
/6 R1AB_SARS2 Replicase polyprotein 1ab

6z72 L NA
SODIUM ION[1 atoms] B 100.0
/100.0 5
/5 R1AB_SARS2 Replicase polyprotein 1ab

6z72 P NA
SODIUM ION[1 atoms] C 100.0
/100.0 3
/3 R1AB_SARS2 Replicase polyprotein 1ab

6z72 T NA
SODIUM ION[1 atoms] D 100.0
/100.0 5
/5 R1AB_SARS2 Replicase polyprotein 1ab

7m1y P NA
SODIUM ION[1 atoms] A 100.0
/99.7 4
/4 R1A_SARS2 Papain-like protease

7m1y CA NA
SODIUM ION[1 atoms] B 100.0
/99.7 3
/3 R1A_SARS2 Papain-like protease

7ybg E NA
SODIUM ION[1 atoms] A 66.7
/99.1 3
/3 R1A_SARS2 Papain-like protease nsp3

7ybg F NA
SODIUM ION[1 atoms] A 100.0
/99.1 4
/4 R1A_SARS2 Papain-like protease nsp3

8cx9 R NA
SODIUM ION[1 atoms] B 100.0
/100.0 2
/2 R1A_SARS2 Papain-like protease nsp3

8cx9 T NA
SODIUM ION[1 atoms] C 100.0
/100.0 2
/2 R1A_SARS2 Papain-like protease nsp3

8g62 G NA
SODIUM ION[1 atoms] A 100.0
/100.0 3
/3 R1A_SARS2 Non-structural protein 3

8g62 P NA
SODIUM ION[1 atoms] B 100.0
/100.0 4
/4 R1A_SARS2 Non-structural protein 3

6wuu K MG
MAGNESIUM ION[1 atoms] B 100.0
/99.4 1
/1 R1AB_SARS2 Non-structural protein 3

6wuu M MG
MAGNESIUM ION[1 atoms] C 100.0
/99.7 1
/1 R1AB_SARS2 Non-structural protein 3

6wuu O MG
MAGNESIUM ION[1 atoms] D 100.0
/99.7 5
/5 R1AB_SARS2 Non-structural protein 3

6wuu P MG
MAGNESIUM ION[1 atoms] D 100.0
/99.7 2
/2 R1AB_SARS2 Non-structural protein 3

6ywk I MG
MAGNESIUM ION[1 atoms] C 100.0
/100.0 1
/4 R1AB_SARS2 NSP3 macrodomain

6ywl Q MG
MAGNESIUM ION[1 atoms] C 100.0
/100.0 1
/4 R1AB_SARS2 NSP3 macrodomain

7bf3 M MG
MAGNESIUM ION[1 atoms] C 100.0
/100.0 1
/4 R1AB_SARS2 NSP3 macrodomain

7bf5 F MG
MAGNESIUM ION[1 atoms] A 100.0
/100.0 1
/1 R1AB_SARS2 NSP3 macrodomain

7bf5 U MG
MAGNESIUM ION[1 atoms] E 100.0
/100.0 1
/4 R1AB_SARS2 NSP3 macrodomain

7oft L K
POTASSIUM ION[1 atoms] A 100.0
/100.0 1
/1 R1A_SARS2 Papain-like protease nsp3

7oft M K
POTASSIUM ION[1 atoms] A 100.0
/100.0 3
/3 R1A_SARS2 Papain-like protease nsp3

2fe8 D ZN
ZINC ION[1 atoms] A 100.0
/82.8 4
/4 R1AB_CVHSA Replicase polyprotein 1ab

2fe8 D ZN
ZINC ION[1 atoms] A 100.0
/82.8 4
/4 R1AB_CVHSA Replicase polyprotein 1ab

2fe8 I ZN
ZINC ION[1 atoms] B 100.0
/82.7 4
/4 R1AB_CVHSA Replicase polyprotein 1ab

2fe8 I ZN
ZINC ION[1 atoms] B 100.0
/82.7 4
/4 R1AB_CVHSA Replicase polyprotein 1ab

2fe8 N ZN
ZINC ION[1 atoms] C 100.0
/82.7 4
/4 R1AB_CVHSA Replicase polyprotein 1ab

2fe8 N ZN
ZINC ION[1 atoms] C 100.0
/82.7 4
/4 R1AB_CVHSA Replicase polyprotein 1ab

3e9s C ZN
ZINC ION[1 atoms] A 100.0
/82.7 5
/5 R1A_CVHSA Non-structural protein 3

3mj5 D ZN
ZINC ION[1 atoms] A 100.0
/82.7 4
/4 R1A_CVHSA Replicase polyprotein 1a

3mj5 F ZN
ZINC ION[1 atoms] B 66.7
/81.3 6
/6 R1A_CVHSA Replicase polyprotein 1a

4m0w C ZN
ZINC ION[1 atoms] A 100.0
/82.3 4
/4 R1A_CVHSA Replicase polyprotein 1a

4mm3 C ZN
ZINC ION[1 atoms] B 100.0
/82.9 4
/4 R1A_CVHSA Papain-like proteinase

4ovz C ZN
ZINC ION[1 atoms] A 100.0
/82.5 4
/4 R1A_CVHSA Papain-like proteinase

4ovz F ZN
ZINC ION[1 atoms] B 80.0
/81.3 5
/5 R1A_CVHSA Papain-like proteinase

4ow0 C ZN
ZINC ION[1 atoms] A 100.0
/82.6 4
/4 R1A_CVHSA papain-like protease

4ow0 H ZN
ZINC ION[1 atoms] B 80.0
/81.1 5
/5 R1A_CVHSA papain-like protease

5tl6 E ZN
ZINC ION[1 atoms] A 100.0
/82.9 4
/4 R1AB_CVHSA Replicase polyprotein 1ab

5tl6 G ZN
ZINC ION[1 atoms] B 100.0
/83.0 4
/4 R1AB_CVHSA Replicase polyprotein 1ab

5tl7 E ZN
ZINC ION[1 atoms] B 100.0
/82.9 4
/4 R1AB_CVHSA Replicase polyprotein 1ab

5tl7 F ZN
ZINC ION[1 atoms] D 100.0
/82.7 4
/4 R1AB_CVHSA Replicase polyprotein 1ab

5y3e B ZN
ZINC ION[1 atoms] A 100.0
/82.8 4
/4 R1A_CVHSA Replicase polyprotein 1a

5y3q B ZN
ZINC ION[1 atoms] A 100.0
/82.8 4
/4 R1A_CVHSA Replicase polyprotein 1a

6w9c D ZN
ZINC ION[1 atoms] A 100.0
/100.0 4
/4 R1A_SARS2 Non-structural protein 3

6w9c H ZN
ZINC ION[1 atoms] A 100.0
/100.0 2
/2 R1A_SARS2 Non-structural protein 3

6w9c F ZN
ZINC ION[1 atoms] B 100.0
/100.0 2
/2 R1A_SARS2 Non-structural protein 3

6w9c H ZN
ZINC ION[1 atoms] B 100.0
/100.0 2
/2 R1A_SARS2 Non-structural protein 3

6w9c H ZN
ZINC ION[1 atoms] C 100.0
/100.0 1
/1 R1A_SARS2 Non-structural protein 3

6w9c I ZN
ZINC ION[1 atoms] C 100.0
/100.0 4
/4 R1A_SARS2 Non-structural protein 3

6wrh B ZN
ZINC ION[1 atoms] A 100.0
/99.7 4
/4 R1AB_SARS2 Non-structural protein 3

6wuu I ZN
ZINC ION[1 atoms] A 100.0
/99.7 4
/4 R1AB_SARS2 Non-structural protein 3

6wuu J ZN
ZINC ION[1 atoms] B 100.0
/99.4 4
/4 R1AB_SARS2 Non-structural protein 3

6wuu L ZN
ZINC ION[1 atoms] C 100.0
/99.7 4
/4 R1AB_SARS2 Non-structural protein 3

6wuu N ZN
ZINC ION[1 atoms] D 100.0
/99.7 4
/4 R1AB_SARS2 Non-structural protein 3

6wx4 C ZN
ZINC ION[1 atoms] A 100.0
/99.7 4
/4 R1AB_SARS2 Non-structural protein 3

6wzu B ZN
ZINC ION[1 atoms] A 100.0
/100.0 4
/4 R1AB_SARS2 Non-structural protein 3

6xa9 J ZN
ZINC ION[1 atoms] A 100.0
/100.0 4
/4 R1AB_SARS2 Non-structural protein 3

6xa9 N ZN
ZINC ION[1 atoms] C 100.0
/100.0 4
/4 R1AB_SARS2 Non-structural protein 3

6xa9 O ZN
ZINC ION[1 atoms] E 100.0
/100.0 4
/4 R1AB_SARS2 Non-structural protein 3

6xaa C ZN
ZINC ION[1 atoms] A 100.0
/100.0 4
/4 R1AB_SARS2 Non-structural protein 3

6xg3 B ZN
ZINC ION[1 atoms] A 100.0
/99.7 4
/4 R1AB_SARS2 Non-structural protein 3

6xg3 B ZN
ZINC ION[1 atoms] A 100.0
/99.7 4
/4 R1AB_SARS2 Non-structural protein 3

7cjd E ZN
ZINC ION[1 atoms] A 100.0
/99.7 4
/4 R1AB_SARS2 Non-structural protein 3

7cjd F ZN
ZINC ION[1 atoms] B 100.0
/99.7 5
/5 R1AB_SARS2 Non-structural protein 3

7cjd H ZN
ZINC ION[1 atoms] C 100.0
/99.7 5
/5 R1AB_SARS2 Non-structural protein 3

7cjd I ZN
ZINC ION[1 atoms] D 100.0
/99.7 3
/3 R1AB_SARS2 Non-structural protein 3

7cjm C ZN
ZINC ION[1 atoms] A 100.0
/99.7 1
/1 R1AB_SARS2 Non-structural protein 3

7cjm D ZN
ZINC ION[1 atoms] A 100.0
/99.7 2
/2 R1AB_SARS2 Non-structural protein 3

7cjm E ZN
ZINC ION[1 atoms] A 100.0
/99.7 4
/4 R1AB_SARS2 Non-structural protein 3

7cmd F ZN
ZINC ION[1 atoms] A 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 3

7cmd G ZN
ZINC ION[1 atoms] A 100.0
/100.0 1
/1 R1AB_SARS2 Non-structural protein 3

7cmd H ZN
ZINC ION[1 atoms] B 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 3

7cmd J ZN
ZINC ION[1 atoms] B 100.0
/100.0 6
/6 R1AB_SARS2 Non-structural protein 3

7cmd K ZN
ZINC ION[1 atoms] B 100.0
/100.0 4
/4 R1AB_SARS2 Non-structural protein 3

7cmd L ZN
ZINC ION[1 atoms] B 100.0
/100.0 2
/2 R1AB_SARS2 Non-structural protein 3

7cmd N ZN
ZINC ION[1 atoms] C 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 3

7cmd P ZN
ZINC ION[1 atoms] D 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 3

7cmd Q ZN
ZINC ION[1 atoms] D 100.0
/100.0 1
/1 R1AB_SARS2 Non-structural protein 3

7d47 C ZN
ZINC ION[1 atoms] A 100.0
/99.7 5
/5 R1A_SARS2 Non-structural protein 3

7d47 E ZN
ZINC ION[1 atoms] B 100.0
/99.7 3
/3 R1A_SARS2 Non-structural protein 3

7d6h B ZN
ZINC ION[1 atoms] A 100.0
/99.7 4
/4 R1A_SARS2 Papain-like protease

7d7k C ZN
ZINC ION[1 atoms] A 100.0
/99.7 4
/4 R1AB_SARS2 Non-structural protein 3

7d7k O ZN
ZINC ION[1 atoms] B 100.0
/99.7 4
/4 R1AB_SARS2 Non-structural protein 3

7d7l C ZN
ZINC ION[1 atoms] A 100.0
/99.7 4
/4 R1AB_SARS2 Non-structural protein 3

7d7l N ZN
ZINC ION[1 atoms] B 100.0
/99.7 4
/4 R1AB_SARS2 Non-structural protein 3

7e35 C ZN
ZINC ION[1 atoms] A 100.0
/99.7 4
/4 R1AB_SARS2 Non-structural protein 3

7e35 E ZN
ZINC ION[1 atoms] B 100.0
/99.7 4
/4 R1AB_SARS2 Non-structural protein 3

7jir C ZN
ZINC ION[1 atoms] A 100.0
/99.7 4
/4 R1A_SARS2 Papain-like protease

7jir D ZN
ZINC ION[1 atoms] A 100.0
/99.7 3
/3 R1A_SARS2 Papain-like protease

7jir E ZN
ZINC ION[1 atoms] A 100.0
/99.7 2
/2 R1A_SARS2 Papain-like protease

7jir F ZN
ZINC ION[1 atoms] A 100.0
/99.7 2
/2 R1A_SARS2 Papain-like protease

7jit C ZN
ZINC ION[1 atoms] A 100.0
/99.7 4
/4 R1A_SARS2 Papain-like protease

7jit D ZN
ZINC ION[1 atoms] A 100.0
/99.7 3
/3 R1A_SARS2 Papain-like protease

7jit E ZN
ZINC ION[1 atoms] A 100.0
/99.7 2
/2 R1A_SARS2 Papain-like protease

7jit F ZN
ZINC ION[1 atoms] A 100.0
/99.7 1
/1 R1A_SARS2 Papain-like protease

7jiv C ZN
ZINC ION[1 atoms] A 100.0
/99.7 4
/4 R1A_SARS2 Papain-like protease

7jiv D ZN
ZINC ION[1 atoms] A 100.0
/99.7 3
/3 R1A_SARS2 Papain-like protease

7jiv E ZN
ZINC ION[1 atoms] A 100.0
/99.7 2
/2 R1A_SARS2 Papain-like protease

7jiv F ZN
ZINC ION[1 atoms] A 100.0
/99.7 2
/2 R1A_SARS2 Papain-like protease

7jiw C ZN
ZINC ION[1 atoms] A 100.0
/100.0 4
/4 R1A_SARS2 Papain-like protease

7jiw D ZN
ZINC ION[1 atoms] A 100.0
/100.0 2
/2 R1A_SARS2 Papain-like protease

7jiw E ZN
ZINC ION[1 atoms] A 100.0
/100.0 1
/1 R1A_SARS2 Papain-like protease

7jiw F ZN
ZINC ION[1 atoms] A 100.0
/100.0 2
/2 R1A_SARS2 Papain-like protease

7jn2 C ZN
ZINC ION[1 atoms] A 100.0
/100.0 4
/4 R1A_SARS2 Papain-like protease

7jn2 D ZN
ZINC ION[1 atoms] A 100.0
/100.0 4
/4 R1A_SARS2 Papain-like protease

7jn2 E ZN
ZINC ION[1 atoms] A 100.0
/100.0 2
/2 R1A_SARS2 Papain-like protease

7jn2 F ZN
ZINC ION[1 atoms] A 100.0
/100.0 1
/1 R1A_SARS2 Papain-like protease

7jn2 G ZN
ZINC ION[1 atoms] A 100.0
/100.0 2
/2 R1A_SARS2 Papain-like protease

7jrn D ZN
ZINC ION[1 atoms] A 100.0
/100.0 4
/4 R1A_SARS2 Non-structural protein 3

7jrn H ZN
ZINC ION[1 atoms] B 100.0
/100.0 5
/5 R1A_SARS2 Non-structural protein 3

7koj C ZN
ZINC ION[1 atoms] A 100.0
/99.7 4
/4 R1A_SARS2 Papain-like protease

7koj D ZN
ZINC ION[1 atoms] A 100.0
/99.7 4
/4 R1A_SARS2 Papain-like protease

7koj E ZN
ZINC ION[1 atoms] A 100.0
/99.7 2
/2 R1A_SARS2 Papain-like protease

7koj F ZN
ZINC ION[1 atoms] A 100.0
/99.7 2
/2 R1A_SARS2 Papain-like protease

7kok C ZN
ZINC ION[1 atoms] A 100.0
/99.7 4
/4 R1A_SARS2 Papain-like protease

7kok D ZN
ZINC ION[1 atoms] A 100.0
/99.7 3
/3 R1A_SARS2 Papain-like protease

7kok E ZN
ZINC ION[1 atoms] A 100.0
/99.7 2
/2 R1A_SARS2 Papain-like protease

7kok F ZN
ZINC ION[1 atoms] A 100.0
/99.7 2
/2 R1A_SARS2 Papain-like protease

7kol C ZN
ZINC ION[1 atoms] A 100.0
/100.0 4
/4 R1A_SARS2 Papain-like protease

7kol D ZN
ZINC ION[1 atoms] A 100.0
/100.0 2
/2 R1A_SARS2 Papain-like protease

7kol E ZN
ZINC ION[1 atoms] A 100.0
/100.0 1
/1 R1A_SARS2 Papain-like protease

7kol F ZN
ZINC ION[1 atoms] A 100.0
/100.0 3
/3 R1A_SARS2 Papain-like protease

7krx C ZN
ZINC ION[1 atoms] A 100.0
/99.7 4
/4 R1A_SARS2 Papain-like protease

7krx D ZN
ZINC ION[1 atoms] A 100.0
/99.7 3
/3 R1A_SARS2 Papain-like protease

7krx E ZN
ZINC ION[1 atoms] A 100.0
/99.7 2
/2 R1A_SARS2 Papain-like protease

7krx F ZN
ZINC ION[1 atoms] A 100.0
/99.7 1
/1 R1A_SARS2 Papain-like protease

7lbr C ZN
ZINC ION[1 atoms] A 100.0
/100.0 4
/4 R1A_SARS2 Non-structural protein 3

7lbr H ZN
ZINC ION[1 atoms] B 100.0
/100.0 4
/4 R1A_SARS2 Non-structural protein 3

7lbs D ZN
ZINC ION[1 atoms] A 100.0
/100.0 4
/4 R1A_SARS2 Non-structural protein 3

7lbs K ZN
ZINC ION[1 atoms] B 100.0
/100.0 3
/3 R1A_SARS2 Non-structural protein 3

7lfv E ZN
ZINC ION[1 atoms] A 100.0
/82.7 4
/4 R1A_SARS papain-like protease

7lfv U ZN
ZINC ION[1 atoms] B 100.0
/82.8 4
/4 R1A_SARS papain-like protease

7llf C ZN
ZINC ION[1 atoms] A 100.0
/100.0 5
/5 R1A_SARS2 Non-structural protein 3

7llf K ZN
ZINC ION[1 atoms] B 100.0
/100.0 4
/4 R1A_SARS2 Non-structural protein 3

7llz D ZN
ZINC ION[1 atoms] A 100.0
/100.0 4
/4 R1A_SARS2 Non-structural protein 3

7llz I ZN
ZINC ION[1 atoms] B 100.0
/100.0 4
/4 R1A_SARS2 Non-structural protein 3

7los C ZN
ZINC ION[1 atoms] A 100.0
/100.0 4
/4 R1A_SARS2 Non-structural protein 3

7los I ZN
ZINC ION[1 atoms] B 100.0
/100.0 4
/4 R1A_SARS2 Non-structural protein 3

7m1y D ZN
ZINC ION[1 atoms] A 100.0
/99.7 4
/4 R1A_SARS2 Papain-like protease

7m1y T ZN
ZINC ION[1 atoms] B 100.0
/99.7 4
/4 R1A_SARS2 Papain-like protease

7nfv B ZN
ZINC ION[1 atoms] A 100.0
/100.0 4
/4 R1A_SARS2 Papain-like protease nsp3

7nt4 J ZN
ZINC ION[1 atoms] A 100.0
/100.0 4
/4 R1AB_SARS2 Non-structural protein 3

7nt4 S ZN
ZINC ION[1 atoms] B 100.0
/100.0 4
/4 R1AB_SARS2 Non-structural protein 3

7ofs B ZN
ZINC ION[1 atoms] A 100.0
/100.0 4
/4 R1A_SARS2 Papain-like protease nsp3

7oft B ZN
ZINC ION[1 atoms] A 100.0
/100.0 4
/4 R1A_SARS2 Papain-like protease nsp3

7ofu E ZN
ZINC ION[1 atoms] A 100.0
/100.0 4
/4 R1A_SARS2 Papain-like protease nsp3

7qcg E ZN
ZINC ION[1 atoms] A 100.0
/100.0 4
/4 R1A_SARS2 Papain-like protease nsp3

7qch E ZN
ZINC ION[1 atoms] A 100.0
/100.0 4
/4 R1A_SARS2 Papain-like protease nsp3

7qci E ZN
ZINC ION[1 atoms] A 100.0
/100.0 4
/4 R1A_SARS2 Papain-like protease nsp3

7qcj H ZN
ZINC ION[1 atoms] A 100.0
/100.0 4
/4 R1A_SARS2 Papain-like protease nsp3

7qck F ZN
ZINC ION[1 atoms] A 100.0
/100.0 4
/4 R1A_SARS2 Papain-like protease nsp3

7qcm H ZN
ZINC ION[1 atoms] A 100.0
/100.0 4
/4 R1A_SARS2 Papain-like protease nsp3

7rbr C ZN
ZINC ION[1 atoms] A 100.0
/99.7 4
/4 R1A_SARS2 Papain-like protease

7rbs K ZN
ZINC ION[1 atoms] A 100.0
/99.7 4
/4 R1A_SARS2 Papain-like protease

7rbs L ZN
ZINC ION[1 atoms] C 100.0
/99.7 4
/4 R1A_SARS2 Papain-like protease

7rbs M ZN
ZINC ION[1 atoms] E 100.0
/99.7 4
/4 R1A_SARS2 Papain-like protease

7rbs N ZN
ZINC ION[1 atoms] G 100.0
/99.7 4
/4 R1A_SARS2 Papain-like protease

7rbs O ZN
ZINC ION[1 atoms] I 100.0
/99.7 4
/4 R1A_SARS2 Papain-like protease

7rzc E ZN
ZINC ION[1 atoms] A 100.0
/100.0 4
/4 R1A_SARS2 Non-structural protein 3

7rzc J ZN
ZINC ION[1 atoms] B 100.0
/100.0 4
/4 R1A_SARS2 Non-structural protein 3

7rzc S ZN
ZINC ION[1 atoms] C 100.0
/100.0 4
/4 R1A_SARS2 Non-structural protein 3

7sdr E ZN
ZINC ION[1 atoms] A 100.0
/100.0 4
/4 R1A_SARS2 Non-structural protein 3

7sdr H ZN
ZINC ION[1 atoms] B 100.0
/100.0 4
/4 R1A_SARS2 Non-structural protein 3

7sdr O ZN
ZINC ION[1 atoms] C 100.0
/100.0 4
/4 R1A_SARS2 Non-structural protein 3

7sgu C ZN
ZINC ION[1 atoms] A 100.0
/99.7 4
/4 R1A_SARS2 Papain-like protease

7sgv C ZN
ZINC ION[1 atoms] A 100.0
/99.7 2
/2 R1A_SARS2 Papain-like protease

7sgw C ZN
ZINC ION[1 atoms] A 100.0
/100.0 4
/4 R1A_SARS2 Non-structural protein 3

7skq C ZN
ZINC ION[1 atoms] A 100.0
/82.1 4
/4 Q0QDZ2_SARS 3C-like proteinase

7skq D ZN
ZINC ION[1 atoms] A 100.0
/82.1 3
/3 Q0QDZ2_SARS 3C-like proteinase

7skq H ZN
ZINC ION[1 atoms] A 100.0
/82.1 2
/2 Q0QDZ2_SARS 3C-like proteinase

7skq D ZN
ZINC ION[1 atoms] B 100.0
/82.2 2
/2 Q0QDZ2_SARS 3C-like proteinase

7skq G ZN
ZINC ION[1 atoms] B 80.0
/82.2 5
/5 Q0QDZ2_SARS 3C-like proteinase

7skq H ZN
ZINC ION[1 atoms] B 100.0
/82.2 2
/2 Q0QDZ2_SARS 3C-like proteinase

7skr D ZN
ZINC ION[1 atoms] A 100.0
/82.1 4
/4 Q0QDZ2_SARS 3C-like proteinase

7skr D ZN
ZINC ION[1 atoms] A 100.0
/82.1 4
/4 Q0QDZ2_SARS 3C-like proteinase

7skr E ZN
ZINC ION[1 atoms] A 66.7
/82.1 3
/3 Q0QDZ2_SARS 3C-like proteinase

7skr E ZN
ZINC ION[1 atoms] A 66.7
/82.1 3
/3 Q0QDZ2_SARS 3C-like proteinase

7sqe E ZN
ZINC ION[1 atoms] A 100.0
/99.7 4
/4 R1A_SARS2 Papain-like protease

7sqe J ZN
ZINC ION[1 atoms] B 100.0
/99.7 4
/4 R1A_SARS2 Papain-like protease

7sqe Q ZN
ZINC ION[1 atoms] C 100.0
/99.7 4
/4 R1A_SARS2 Papain-like protease

7tzj D ZN
ZINC ION[1 atoms] A 100.0
/99.7 1
/1 R1A_SARS2 Papain-like protease

7tzj E ZN
ZINC ION[1 atoms] A 100.0
/99.7 2
/2 R1A_SARS2 Papain-like protease

7tzj F ZN
ZINC ION[1 atoms] A 100.0
/99.7 1
/1 R1A_SARS2 Papain-like protease

7tzj G ZN
ZINC ION[1 atoms] A 100.0
/99.7 2
/2 R1A_SARS2 Papain-like protease

7tzj J ZN
ZINC ION[1 atoms] B 100.0
/99.7 2
/2 R1A_SARS2 Papain-like protease

7tzj K ZN
ZINC ION[1 atoms] B 100.0
/99.7 1
/1 R1A_SARS2 Papain-like protease

7tzj L ZN
ZINC ION[1 atoms] B 100.0
/99.7 2
/2 R1A_SARS2 Papain-like protease

7tzj M ZN
ZINC ION[1 atoms] B 100.0
/99.7 1
/1 R1A_SARS2 Papain-like protease

7tzj N ZN
ZINC ION[1 atoms] B 100.0
/99.7 1
/1 R1A_SARS2 Papain-like protease

7uv5 D ZN
ZINC ION[1 atoms] A 100.0
/99.4 4
/4 R1A_SARS2 Papain-like protease nsp3

7ybg D ZN
ZINC ION[1 atoms] A 100.0
/99.1 4
/4 R1A_SARS2 Papain-like protease nsp3

8cx9 M ZN
ZINC ION[1 atoms] A 100.0
/100.0 4
/4 R1A_SARS2 Papain-like protease nsp3

8cx9 O ZN
ZINC ION[1 atoms] B 100.0
/100.0 4
/4 R1A_SARS2 Papain-like protease nsp3

8cx9 S ZN
ZINC ION[1 atoms] C 100.0
/100.0 4
/4 R1A_SARS2 Papain-like protease nsp3

8cx9 U ZN
ZINC ION[1 atoms] D 100.0
/100.0 5
/5 R1A_SARS2 Papain-like protease nsp3

8eua C ZN
ZINC ION[1 atoms] A 100.0
/100.0 4
/4 R1AB_SARS2 Papain-like protease nsp3

8eua D ZN
ZINC ION[1 atoms] A 100.0
/100.0 1
/1 R1AB_SARS2 Papain-like protease nsp3

8eua E ZN
ZINC ION[1 atoms] A 100.0
/100.0 1
/1 R1AB_SARS2 Papain-like protease nsp3

8fwn J ZN
ZINC ION[1 atoms] A 100.0
/99.7 4
/4 R1AB_SARS2 Papain-like protease nsp3

8fwo E ZN
ZINC ION[1 atoms] A 100.0
/100.0 4
/4 R1AB_SARS2 Papain-like protease nsp3

8g62 D ZN
ZINC ION[1 atoms] A 100.0
/100.0 4
/4 R1A_SARS2 Non-structural protein 3

8g62 N ZN
ZINC ION[1 atoms] B 100.0
/100.0 4
/4 R1A_SARS2 Non-structural protein 3

8g62 V ZN
ZINC ION[1 atoms] C 100.0
/100.0 4
/4 R1A_SARS2 Non-structural protein 3

8iho E ZN
ZINC ION[1 atoms] A 100.0
/100.0 4
/4 R1A_SARS2 Papain-like protease nsp3

8iho F ZN
ZINC ION[1 atoms] B 100.0
/100.0 4
/4 R1A_SARS2 Papain-like protease nsp3

8uob C ZN
ZINC ION[1 atoms] A 100.0
/100.0 4
/4 R1A_SARS2 Papain-like protease nsp3

8uob D ZN
ZINC ION[1 atoms] A 100.0
/100.0 1
/1 R1A_SARS2 Papain-like protease nsp3

8uob E ZN
ZINC ION[1 atoms] A 100.0
/100.0 2
/2 R1A_SARS2 Papain-like protease nsp3

8uob F ZN
ZINC ION[1 atoms] A 100.0
/100.0 4
/4 R1A_SARS2 Papain-like protease nsp3

8uob G ZN
ZINC ION[1 atoms] A 100.0
/100.0 2
/2 R1A_SARS2 Papain-like protease nsp3

8uob H ZN
ZINC ION[1 atoms] A 100.0
/100.0 3
/3 R1A_SARS2 Papain-like protease nsp3

8uuf D ZN
ZINC ION[1 atoms] A 100.0
/100.0 1
/1 R1A_SARS2 Papain-like protease nsp3

8uuf E ZN
ZINC ION[1 atoms] A 100.0
/100.0 2
/2 R1A_SARS2 Papain-like protease nsp3

8uuf F ZN
ZINC ION[1 atoms] A 100.0
/100.0 4
/4 R1A_SARS2 Papain-like protease nsp3

8uuf G ZN
ZINC ION[1 atoms] A 100.0
/100.0 4
/4 R1A_SARS2 Papain-like protease nsp3

8uug E ZN
ZINC ION[1 atoms] A 100.0
/100.0 1
/1 R1AB_SARS2 Papain-like protease nsp3

8uug F ZN
ZINC ION[1 atoms] A 100.0
/100.0 4
/4 R1AB_SARS2 Papain-like protease nsp3

8uug G ZN
ZINC ION[1 atoms] A 100.0
/100.0 4
/4 R1AB_SARS2 Papain-like protease nsp3

8uug H ZN
ZINC ION[1 atoms] A 100.0
/100.0 2
/2 R1AB_SARS2 Papain-like protease nsp3

8uug I ZN
ZINC ION[1 atoms] A 100.0
/100.0 3
/3 R1AB_SARS2 Papain-like protease nsp3

8uuh E ZN
ZINC ION[1 atoms] A 100.0
/100.0 4
/4 R1A_SARS2 Papain-like protease nsp3

8uuh F ZN
ZINC ION[1 atoms] A 100.0
/100.0 1
/1 R1A_SARS2 Papain-like protease nsp3

8uuh G ZN
ZINC ION[1 atoms] A 100.0
/100.0 2
/2 R1A_SARS2 Papain-like protease nsp3

8uuh H ZN
ZINC ION[1 atoms] A 100.0
/100.0 2
/2 R1A_SARS2 Papain-like protease nsp3

8uuh I ZN
ZINC ION[1 atoms] A 100.0
/100.0 4
/4 R1A_SARS2 Papain-like protease nsp3

8uuu D ZN
ZINC ION[1 atoms] A 100.0
/100.0 3
/3 R1A_SARS2 Papain-like protease nsp3

8uuu E ZN
ZINC ION[1 atoms] A 100.0
/100.0 1
/1 R1A_SARS2 Papain-like protease nsp3

8uuu F ZN
ZINC ION[1 atoms] A 100.0
/100.0 4
/4 R1A_SARS2 Papain-like protease nsp3

8uuu G ZN
ZINC ION[1 atoms] A 100.0
/100.0 2
/2 R1A_SARS2 Papain-like protease nsp3

8uuu H ZN
ZINC ION[1 atoms] A 100.0
/100.0 3
/3 R1A_SARS2 Papain-like protease nsp3

8uuu I ZN
ZINC ION[1 atoms] A 100.0
/100.0 3
/3 R1A_SARS2 Papain-like protease nsp3

8uuv C ZN
ZINC ION[1 atoms] A 100.0
/100.0 2
/2 R1A_SARS2 Papain-like protease nsp3

8uuv D ZN
ZINC ION[1 atoms] A 100.0
/100.0 1
/1 R1A_SARS2 Papain-like protease nsp3

8uuv E ZN
ZINC ION[1 atoms] A 100.0
/100.0 2
/2 R1A_SARS2 Papain-like protease nsp3

8uuv F ZN
ZINC ION[1 atoms] A 100.0
/100.0 3
/3 R1A_SARS2 Papain-like protease nsp3

8uuv G ZN
ZINC ION[1 atoms] A 100.0
/100.0 4
/4 R1A_SARS2 Papain-like protease nsp3

8uuv H ZN
ZINC ION[1 atoms] A 100.0
/100.0 3
/3 R1A_SARS2 Papain-like protease nsp3

8uuw E ZN
ZINC ION[1 atoms] A 100.0
/100.0 1
/1 R1A_SARS2 Papain-like protease nsp3

8uuw F ZN
ZINC ION[1 atoms] A 100.0
/100.0 1
/1 R1A_SARS2 Papain-like protease nsp3

8uuw G ZN
ZINC ION[1 atoms] A 100.0
/100.0 1
/1 R1A_SARS2 Papain-like protease nsp3

8uuw H ZN
ZINC ION[1 atoms] A 100.0
/100.0 2
/2 R1A_SARS2 Papain-like protease nsp3

8uuw I ZN
ZINC ION[1 atoms] A 100.0
/100.0 3
/3 R1A_SARS2 Papain-like protease nsp3

8uuy F ZN
ZINC ION[1 atoms] A 100.0
/100.0 2
/2 R1A_SARS2 Papain-like protease nsp3

8uuy G ZN
ZINC ION[1 atoms] A 100.0
/100.0 4
/4 R1A_SARS2 Papain-like protease nsp3

8uuy H ZN
ZINC ION[1 atoms] A 100.0
/100.0 3
/3 R1A_SARS2 Papain-like protease nsp3

8uuy I ZN
ZINC ION[1 atoms] A 100.0
/100.0 1
/1 R1A_SARS2 Papain-like protease nsp3

8uuy J ZN
ZINC ION[1 atoms] A 100.0
/100.0 1
/1 R1A_SARS2 Papain-like protease nsp3

8uuy K ZN
ZINC ION[1 atoms] A 100.0
/100.0 1
/1 R1A_SARS2 Papain-like protease nsp3

8uuy L ZN
ZINC ION[1 atoms] A 100.0
/100.0 2
/2 R1A_SARS2 Papain-like protease nsp3

8uuy M ZN
ZINC ION[1 atoms] A 100.0
/100.0 2
/2 R1A_SARS2 Papain-like protease nsp3

8uvm H ZN
ZINC ION[1 atoms] A 100.0
/100.0 4
/4 R1AB_SARS2 Papain-like protease nsp3

8uvm L ZN
ZINC ION[1 atoms] B 100.0
/100.0 4
/4 R1AB_SARS2 Papain-like protease nsp3

8uvm P ZN
ZINC ION[1 atoms] C 100.0
/100.0 5
/5 R1AB_SARS2 Papain-like protease nsp3

8uvm U ZN
ZINC ION[1 atoms] D 100.0
/100.0 4
/4 R1AB_SARS2 Papain-like protease nsp3

8vec B ZN
ZINC ION[1 atoms] A 100.0
/99.7 4
/4 R1AB_SARS2 Papain-like protease nsp3

7m1y G IOD
IODIDE ION[1 atoms] A 100.0
/99.7 3
/3 R1A_SARS2 Papain-like protease

7m1y H IOD
IODIDE ION[1 atoms] A 100.0
/99.7 4
/4 R1A_SARS2 Papain-like protease

7m1y I IOD
IODIDE ION[1 atoms] A 100.0
/99.7 1
/1 R1A_SARS2 Papain-like protease

7m1y J IOD
IODIDE ION[1 atoms] A 100.0
/99.7 4
/4 R1A_SARS2 Papain-like protease

7m1y K IOD
IODIDE ION[1 atoms] A 100.0
/99.7 1
/1 R1A_SARS2 Papain-like protease

7m1y L IOD
IODIDE ION[1 atoms] A 100.0
/99.7 2
/2 R1A_SARS2 Papain-like protease

7m1y AA IOD
IODIDE ION[1 atoms] B 100.0
/99.7 2
/2 R1A_SARS2 Papain-like protease

7m1y Q IOD
IODIDE ION[1 atoms] B 100.0
/99.7 1
/1 R1A_SARS2 Papain-like protease

7m1y R IOD
IODIDE ION[1 atoms] B 100.0
/99.7 2
/2 R1A_SARS2 Papain-like protease

7m1y W IOD
IODIDE ION[1 atoms] B 100.0
/99.7 3
/3 R1A_SARS2 Papain-like protease

7m1y X IOD
IODIDE ION[1 atoms] B 100.0
/99.7 4
/4 R1A_SARS2 Papain-like protease

7m1y Y IOD
IODIDE ION[1 atoms] B 100.0
/99.7 1
/1 R1A_SARS2 Papain-like protease

7m1y Z IOD
IODIDE ION[1 atoms] B 100.0
/99.7 4
/4 R1A_SARS2 Papain-like protease

7jn2 M UNX
UNKNOWN ATOM OR ION[1 atoms] A 100.0
/100.0 1
/1 R1A_SARS2 Papain-like protease

7jn2 N UNX
UNKNOWN ATOM OR ION[1 atoms] A 100.0
/100.0 1
/1 R1A_SARS2 Papain-like protease

7koj M UNX
UNKNOWN ATOM OR ION[1 atoms] A 100.0
/99.7 2
/2 R1A_SARS2 Papain-like protease

7koj N UNX
UNKNOWN ATOM OR ION[1 atoms] A 100.0
/99.7 2
/2 R1A_SARS2 Papain-like protease

7koj O UNX
UNKNOWN ATOM OR ION[1 atoms] A 100.0
/99.7 1
/1 R1A_SARS2 Papain-like protease

7koj P UNX
UNKNOWN ATOM OR ION[1 atoms] A 100.0
/99.7 2
/2 R1A_SARS2 Papain-like protease

7koj Q UNX
UNKNOWN ATOM OR ION[1 atoms] A 100.0
/99.7 1
/1 R1A_SARS2 Papain-like protease

7koj R UNX
UNKNOWN ATOM OR ION[1 atoms] A 100.0
/99.7 2
/2 R1A_SARS2 Papain-like protease

7koj S UNX
UNKNOWN ATOM OR ION[1 atoms] A 100.0
/99.7 1
/1 R1A_SARS2 Papain-like protease

7koj T UNX
UNKNOWN ATOM OR ION[1 atoms] A 100.0
/99.7 1
/1 R1A_SARS2 Papain-like protease

7koj U UNX
UNKNOWN ATOM OR ION[1 atoms] A 100.0
/99.7 2
/2 R1A_SARS2 Papain-like protease

7koj V UNX
UNKNOWN ATOM OR ION[1 atoms] A 100.0
/99.7 1
/1 R1A_SARS2 Papain-like protease

7koj W UNX
UNKNOWN ATOM OR ION[1 atoms] A 100.0
/99.7 1
/1 R1A_SARS2 Papain-like protease

7kok L UNX
UNKNOWN ATOM OR ION[1 atoms] A 100.0
/99.7 1
/1 R1A_SARS2 Papain-like protease

7kok M UNX
UNKNOWN ATOM OR ION[1 atoms] A 100.0
/99.7 1
/1 R1A_SARS2 Papain-like protease

7kok N UNX
UNKNOWN ATOM OR ION[1 atoms] A 100.0
/99.7 2
/2 R1A_SARS2 Papain-like protease

7kok O UNX
UNKNOWN ATOM OR ION[1 atoms] A 100.0
/99.7 2
/2 R1A_SARS2 Papain-like protease

7kok P UNX
UNKNOWN ATOM OR ION[1 atoms] A 100.0
/99.7 2
/2 R1A_SARS2 Papain-like protease

7kok Q UNX
UNKNOWN ATOM OR ION[1 atoms] A 100.0
/99.7 1
/1 R1A_SARS2 Papain-like protease

7kok R UNX
UNKNOWN ATOM OR ION[1 atoms] A 100.0
/99.7 2
/2 R1A_SARS2 Papain-like protease

7kok S UNX
UNKNOWN ATOM OR ION[1 atoms] A 100.0
/99.7 1
/1 R1A_SARS2 Papain-like protease

7kok T UNX
UNKNOWN ATOM OR ION[1 atoms] A 100.0
/99.7 1
/1 R1A_SARS2 Papain-like protease

7kok V UNX
UNKNOWN ATOM OR ION[1 atoms] A 100.0
/99.7 1
/1 R1A_SARS2 Papain-like protease

7kok W UNX
UNKNOWN ATOM OR ION[1 atoms] A 100.0
/99.7 1
/1 R1A_SARS2 Papain-like protease

7kok X UNX
UNKNOWN ATOM OR ION[1 atoms] A 100.0
/99.7 1
/1 R1A_SARS2 Papain-like protease

7krx K UNX
UNKNOWN ATOM OR ION[1 atoms] A 100.0
/99.7 1
/1 R1A_SARS2 Papain-like protease

7krx L UNX
UNKNOWN ATOM OR ION[1 atoms] A 100.0
/99.7 1
/1 R1A_SARS2 Papain-like protease

7krx M UNX
UNKNOWN ATOM OR ION[1 atoms] A 100.0
/99.7 2
/2 R1A_SARS2 Papain-like protease

7krx N UNX
UNKNOWN ATOM OR ION[1 atoms] A 100.0
/99.7 1
/1 R1A_SARS2 Papain-like protease

7krx O UNX
UNKNOWN ATOM OR ION[1 atoms] A 100.0
/99.7 1
/1 R1A_SARS2 Papain-like protease

7d47 D CA
CALCIUM ION[1 atoms] A 100.0
/99.7 1
/1 R1A_SARS2 Non-structural protein 3

7d47 F CA
CALCIUM ION[1 atoms] B 75.0
/99.7 4
/4 R1A_SARS2 Non-structural protein 3

8hbl C LI
LITHIUM ION[1 atoms] A 100.0
/99.2 4
/4 R1A_SARS2 Non-structural protein 3

7lfv DA NH4
AMMONIUM ION[1 atoms] B 100.0
/82.8 2
/2 R1A_SARS papain-like protease

5e6j H NI
NICKEL (II) ION[1 atoms] A 0.0
/82.0 2
/2 R1AB_CVHSA Replicase polyprotein 1ab

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

HOMO

1945 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

6w9c B R1A_SARS2 Non-structural protein 3[307 aa] A 100.0
/100.0 5
/5 R1A_SARS2 Non-structural protein 3

6w9c C R1A_SARS2 Non-structural protein 3[309 aa] A 100.0
/100.0 8
/8 R1A_SARS2 Non-structural protein 3

6w9c A R1A_SARS2 Non-structural protein 3[310 aa] B 100.0
/100.0 9
/9 R1A_SARS2 Non-structural protein 3

6w9c C R1A_SARS2 Non-structural protein 3[309 aa] B 100.0
/100.0 4
/4 R1A_SARS2 Non-structural protein 3

6w9c A R1A_SARS2 Non-structural protein 3[310 aa] C 100.0
/100.0 4
/4 R1A_SARS2 Non-structural protein 3

6w9c B R1A_SARS2 Non-structural protein 3[307 aa] C 100.0
/100.0 8
/8 R1A_SARS2 Non-structural protein 3

6xg3 A R1AB_SARS2 Non-structural protein 3[313 aa] A 100.0
/99.7 24
/24 R1AB_SARS2 Non-structural protein 3

6xg3 A R1AB_SARS2 Non-structural protein 3[313 aa] A 100.0
/99.7 24
/24 R1AB_SARS2 Non-structural protein 3

7cjd B R1AB_SARS2 Non-structural protein 3[297 aa] A 100.0
/99.7 10
/10 R1AB_SARS2 Non-structural protein 3

7cjd C R1AB_SARS2 Non-structural protein 3[311 aa] A 100.0
/99.7 13
/13 R1AB_SARS2 Non-structural protein 3

7cjd D R1AB_SARS2 Non-structural protein 3[310 aa] A 100.0
/99.7 14
/14 R1AB_SARS2 Non-structural protein 3

7cjd A R1AB_SARS2 Non-structural protein 3[313 aa] B 100.0
/99.7 8
/8 R1AB_SARS2 Non-structural protein 3

7cjd C R1AB_SARS2 Non-structural protein 3[311 aa] B 100.0
/99.7 20
/20 R1AB_SARS2 Non-structural protein 3

7cjd D R1AB_SARS2 Non-structural protein 3[310 aa] B 100.0
/99.7 17
/17 R1AB_SARS2 Non-structural protein 3

7cjd A R1AB_SARS2 Non-structural protein 3[313 aa] C 100.0
/99.7 13
/13 R1AB_SARS2 Non-structural protein 3

7cjd B R1AB_SARS2 Non-structural protein 3[297 aa] C 100.0
/99.7 19
/19 R1AB_SARS2 Non-structural protein 3

7cjd A R1AB_SARS2 Non-structural protein 3[313 aa] D 100.0
/99.7 15
/15 R1AB_SARS2 Non-structural protein 3

7cjd B R1AB_SARS2 Non-structural protein 3[297 aa] D 100.0
/99.7 14
/14 R1AB_SARS2 Non-structural protein 3

7e35 B R1AB_SARS2 Non-structural protein 3[315 aa] A 100.0
/99.7 22
/22 R1AB_SARS2 Non-structural protein 3

7e35 A R1AB_SARS2 Non-structural protein 3[287 aa] B 100.0
/99.7 21
/21 R1AB_SARS2 Non-structural protein 3

8iho B R1A_SARS2 Papain-like protease nsp3[307 aa] A 100.0
/100.0 15
/15 R1A_SARS2 Papain-like protease nsp3

8iho A R1A_SARS2 Papain-like protease nsp3[313 aa] B 100.0
/100.0 14
/14 R1A_SARS2 Papain-like protease nsp3

2fe8 B R1AB_CVHSA Replicase polyprotein 1ab[314 aa] A 87.0
/82.8 23
/23 R1AB_CVHSA Replicase polyprotein 1ab

2fe8 B R1AB_CVHSA Replicase polyprotein 1ab[314 aa] A 75.0
/82.8 8
/9 R1AB_CVHSA Replicase polyprotein 1ab

2fe8 B R1AB_CVHSA Replicase polyprotein 1ab[314 aa] A 75.0
/82.8 8
/9 R1AB_CVHSA Replicase polyprotein 1ab

2fe8 B R1AB_CVHSA Replicase polyprotein 1ab[314 aa] A 87.0
/82.8 23
/23 R1AB_CVHSA Replicase polyprotein 1ab

2fe8 C R1AB_CVHSA Replicase polyprotein 1ab[313 aa] A 77.8
/82.8 18
/18 R1AB_CVHSA Replicase polyprotein 1ab

2fe8 C R1AB_CVHSA Replicase polyprotein 1ab[313 aa] A 77.8
/82.8 18
/18 R1AB_CVHSA Replicase polyprotein 1ab

2fe8 A R1AB_CVHSA Replicase polyprotein 1ab[315 aa] B 75.0
/82.7 16
/16 R1AB_CVHSA Replicase polyprotein 1ab

2fe8 A R1AB_CVHSA Replicase polyprotein 1ab[315 aa] B 80.0
/82.7 10
/11 R1AB_CVHSA Replicase polyprotein 1ab

2fe8 A R1AB_CVHSA Replicase polyprotein 1ab[315 aa] B 80.0
/82.7 10
/11 R1AB_CVHSA Replicase polyprotein 1ab

2fe8 A R1AB_CVHSA Replicase polyprotein 1ab[315 aa] B 75.0
/82.7 16
/16 R1AB_CVHSA Replicase polyprotein 1ab

2fe8 C R1AB_CVHSA Replicase polyprotein 1ab[313 aa] B 92.0
/82.7 25
/25 R1AB_CVHSA Replicase polyprotein 1ab

2fe8 C R1AB_CVHSA Replicase polyprotein 1ab[313 aa] B 92.0
/82.7 25
/25 R1AB_CVHSA Replicase polyprotein 1ab

2fe8 A R1AB_CVHSA Replicase polyprotein 1ab[315 aa] C 87.5
/82.7 16
/16 R1AB_CVHSA Replicase polyprotein 1ab

2fe8 A R1AB_CVHSA Replicase polyprotein 1ab[315 aa] C 87.5
/82.7 16
/16 R1AB_CVHSA Replicase polyprotein 1ab

2fe8 B R1AB_CVHSA Replicase polyprotein 1ab[314 aa] C 70.0
/82.7 20
/20 R1AB_CVHSA Replicase polyprotein 1ab

2fe8 B R1AB_CVHSA Replicase polyprotein 1ab[314 aa] C 70.0
/82.7 20
/20 R1AB_CVHSA Replicase polyprotein 1ab

2fe8 C R1AB_CVHSA Replicase polyprotein 1ab[313 aa] C 75.0
/82.7 8
/9 R1AB_CVHSA Replicase polyprotein 1ab

2fe8 C R1AB_CVHSA Replicase polyprotein 1ab[313 aa] C 75.0
/82.7 8
/9 R1AB_CVHSA Replicase polyprotein 1ab

3mj5 B R1A_CVHSA Replicase polyprotein 1a[262 aa] A 72.0
/82.7 25
/25 R1A_CVHSA Replicase polyprotein 1a

3mj5 A R1A_CVHSA Replicase polyprotein 1a[312 aa] B 82.1
/81.3 28
/28 R1A_CVHSA Replicase polyprotein 1a

7skq B Q0QDZ2_SARS 3C-like proteinase[304 aa] A 90.0
/82.1 20
/20 Q0QDZ2_SARS 3C-like proteinase

7skq A Q0QDZ2_SARS 3C-like proteinase[313 aa] B 90.9
/82.2 22
/22 Q0QDZ2_SARS 3C-like proteinase

7skr A Q0QDZ2_SARS 3C-like proteinase[314 aa] A 85.2
/82.1 27
/27 Q0QDZ2_SARS 3C-like proteinase

7skr A Q0QDZ2_SARS 3C-like proteinase[314 aa] A 85.2
/82.1 27
/27 Q0QDZ2_SARS 3C-like proteinase

2w2g B R1A_CVHSA NON-STRUCTURAL PROTEIN 3[256 aa] A 78.3
/76.3 23
/23 R1A_CVHSA NON-STRUCTURAL PROTEIN 3

2w2g A R1A_CVHSA NON-STRUCTURAL PROTEIN 3[257 aa] B 76.0
/75.0 25
/25 R1A_CVHSA NON-STRUCTURAL PROTEIN 3

2wct D R1A_CVHSA NON-STRUCTURAL PROTEIN 3[248 aa] A 79.2
/76.3 24
/24 R1A_CVHSA NON-STRUCTURAL PROTEIN 3

2wct C R1A_CVHSA NON-STRUCTURAL PROTEIN 3[252 aa] B 79.2
/76.3 24
/24 R1A_CVHSA NON-STRUCTURAL PROTEIN 3

2wct B R1A_CVHSA NON-STRUCTURAL PROTEIN 3[257 aa] C 76.0
/75.8 25
/25 R1A_CVHSA NON-STRUCTURAL PROTEIN 3

2wct A R1A_CVHSA NON-STRUCTURAL PROTEIN 3[257 aa] D 76.0
/75.4 25
/25 R1A_CVHSA NON-STRUCTURAL PROTEIN 3

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

PRECIPITANT

1945 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

2fe8 H SO4
SULFATE ION[5 atoms] A 100.0
/82.8 4
/4 R1AB_CVHSA Replicase polyprotein 1ab

2fe8 H SO4
SULFATE ION[5 atoms] A 100.0
/82.8 4
/4 R1AB_CVHSA Replicase polyprotein 1ab

2fe8 M SO4
SULFATE ION[5 atoms] B 100.0
/82.7 4
/4 R1AB_CVHSA Replicase polyprotein 1ab

2fe8 M SO4
SULFATE ION[5 atoms] B 100.0
/82.7 4
/4 R1AB_CVHSA Replicase polyprotein 1ab

2fe8 R SO4
SULFATE ION[5 atoms] C 100.0
/82.7 4
/4 R1AB_CVHSA Replicase polyprotein 1ab

2fe8 R SO4
SULFATE ION[5 atoms] C 100.0
/82.7 4
/4 R1AB_CVHSA Replicase polyprotein 1ab

2w2g C SO4
SULFATE ION[5 atoms] A 33.3
/76.3 3
/3 R1A_CVHSA NON-STRUCTURAL PROTEIN 3

2w2g D SO4
SULFATE ION[5 atoms] B 33.3
/75.0 3
/3 R1A_CVHSA NON-STRUCTURAL PROTEIN 3

5s4g E SO4
SULFATE ION[5 atoms] B 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 3

5tl6 F SO4
SULFATE ION[5 atoms] A 100.0
/82.9 3
/3 R1AB_CVHSA Replicase polyprotein 1ab

7d7k L SO4
SULFATE ION[5 atoms] A 100.0
/99.7 5
/5 R1AB_SARS2 Non-structural protein 3

7d7k M SO4
SULFATE ION[5 atoms] A 100.0
/99.7 2
/2 R1AB_SARS2 Non-structural protein 3

7d7k N SO4
SULFATE ION[5 atoms] A 100.0
/99.7 2
/2 R1AB_SARS2 Non-structural protein 3

7d7k V SO4
SULFATE ION[5 atoms] B 100.0
/99.7 5
/5 R1AB_SARS2 Non-structural protein 3

7d7k W SO4
SULFATE ION[5 atoms] B 100.0
/99.7 3
/3 R1AB_SARS2 Non-structural protein 3

7d7l G SO4
SULFATE ION[5 atoms] A 100.0
/99.7 2
/2 R1AB_SARS2 Non-structural protein 3

7d7l H SO4
SULFATE ION[5 atoms] A 100.0
/99.7 3
/3 R1AB_SARS2 Non-structural protein 3

7d7l I SO4
SULFATE ION[5 atoms] A 100.0
/99.7 5
/5 R1AB_SARS2 Non-structural protein 3

7d7l J SO4
SULFATE ION[5 atoms] A 100.0
/99.7 3
/3 R1AB_SARS2 Non-structural protein 3

7d7l K SO4
SULFATE ION[5 atoms] A 100.0
/99.7 4
/4 R1AB_SARS2 Non-structural protein 3

7d7l S SO4
SULFATE ION[5 atoms] B 100.0
/99.7 5
/5 R1AB_SARS2 Non-structural protein 3

7d7l T SO4
SULFATE ION[5 atoms] B 100.0
/99.7 4
/4 R1AB_SARS2 Non-structural protein 3

7d7l U SO4
SULFATE ION[5 atoms] B 100.0
/99.7 3
/3 R1AB_SARS2 Non-structural protein 3

7d7l V SO4
SULFATE ION[5 atoms] B 100.0
/99.7 2
/2 R1AB_SARS2 Non-structural protein 3

7jrn E SO4
SULFATE ION[5 atoms] A 100.0
/100.0 2
/2 R1A_SARS2 Non-structural protein 3

7jrn F SO4
SULFATE ION[5 atoms] A 100.0
/100.0 2
/2 R1A_SARS2 Non-structural protein 3

7jrn I SO4
SULFATE ION[5 atoms] B 100.0
/100.0 3
/3 R1A_SARS2 Non-structural protein 3

7jrn J SO4
SULFATE ION[5 atoms] B 100.0
/100.0 5
/5 R1A_SARS2 Non-structural protein 3

7jrn K SO4
SULFATE ION[5 atoms] B 100.0
/100.0 3
/3 R1A_SARS2 Non-structural protein 3

7lbr D SO4
SULFATE ION[5 atoms] A 100.0
/100.0 5
/5 R1A_SARS2 Non-structural protein 3

7lbr E SO4
SULFATE ION[5 atoms] A 100.0
/100.0 3
/3 R1A_SARS2 Non-structural protein 3

7lbr I SO4
SULFATE ION[5 atoms] B 100.0
/100.0 5
/5 R1A_SARS2 Non-structural protein 3

7lbr J SO4
SULFATE ION[5 atoms] B 100.0
/100.0 3
/3 R1A_SARS2 Non-structural protein 3

7lbs E SO4
SULFATE ION[5 atoms] A 100.0
/100.0 5
/5 R1A_SARS2 Non-structural protein 3

7lbs H SO4
SULFATE ION[5 atoms] A 100.0
/100.0 4
/4 R1A_SARS2 Non-structural protein 3

7lbs L SO4
SULFATE ION[5 atoms] B 100.0
/100.0 5
/5 R1A_SARS2 Non-structural protein 3

7lbs P SO4
SULFATE ION[5 atoms] B 100.0
/100.0 3
/3 R1A_SARS2 Non-structural protein 3

7lfv R SO4
SULFATE ION[5 atoms] A 50.0
/82.7 2
/2 R1A_SARS papain-like protease

7lfv S SO4
SULFATE ION[5 atoms] A 75.0
/82.7 4
/4 R1A_SARS papain-like protease

7lfv EA SO4
SULFATE ION[5 atoms] B 100.0
/82.8 4
/4 R1A_SARS papain-like protease

7llf D SO4
SULFATE ION[5 atoms] A 100.0
/100.0 5
/5 R1A_SARS2 Non-structural protein 3

7llf G SO4
SULFATE ION[5 atoms] A 100.0
/100.0 3
/3 R1A_SARS2 Non-structural protein 3

7llf H SO4
SULFATE ION[5 atoms] A 100.0
/100.0 1
/1 R1A_SARS2 Non-structural protein 3

7llf J SO4
SULFATE ION[5 atoms] A 100.0
/100.0 3
/3 R1A_SARS2 Non-structural protein 3

7llf L SO4
SULFATE ION[5 atoms] B 100.0
/100.0 5
/5 R1A_SARS2 Non-structural protein 3

7llf M SO4
SULFATE ION[5 atoms] B 100.0
/100.0 3
/3 R1A_SARS2 Non-structural protein 3

7llz E SO4
SULFATE ION[5 atoms] A 100.0
/100.0 5
/5 R1A_SARS2 Non-structural protein 3

7llz F SO4
SULFATE ION[5 atoms] A 100.0
/100.0 3
/3 R1A_SARS2 Non-structural protein 3

7llz G SO4
SULFATE ION[5 atoms] A 100.0
/100.0 2
/2 R1A_SARS2 Non-structural protein 3

7llz J SO4
SULFATE ION[5 atoms] B 100.0
/100.0 5
/5 R1A_SARS2 Non-structural protein 3

7llz K SO4
SULFATE ION[5 atoms] B 100.0
/100.0 3
/3 R1A_SARS2 Non-structural protein 3

7llz L SO4
SULFATE ION[5 atoms] B 100.0
/100.0 5
/5 R1A_SARS2 Non-structural protein 3

7los D SO4
SULFATE ION[5 atoms] A 100.0
/100.0 5
/5 R1A_SARS2 Non-structural protein 3

7los F SO4
SULFATE ION[5 atoms] A 100.0
/100.0 3
/3 R1A_SARS2 Non-structural protein 3

7los G SO4
SULFATE ION[5 atoms] A 100.0
/100.0 3
/3 R1A_SARS2 Non-structural protein 3

7los H SO4
SULFATE ION[5 atoms] A 100.0
/100.0 1
/1 R1A_SARS2 Non-structural protein 3

7los J SO4
SULFATE ION[5 atoms] B 100.0
/100.0 5
/5 R1A_SARS2 Non-structural protein 3

7los K SO4
SULFATE ION[5 atoms] B 100.0
/100.0 3
/3 R1A_SARS2 Non-structural protein 3

7nt4 K SO4
SULFATE ION[5 atoms] A 100.0
/100.0 4
/4 R1AB_SARS2 Non-structural protein 3

7nt4 L SO4
SULFATE ION[5 atoms] A 100.0
/100.0 1
/1 R1AB_SARS2 Non-structural protein 3

7nt4 T SO4
SULFATE ION[5 atoms] B 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 3

7nt4 U SO4
SULFATE ION[5 atoms] B 100.0
/100.0 2
/2 R1AB_SARS2 Non-structural protein 3

7nt4 V SO4
SULFATE ION[5 atoms] B 100.0
/100.0 6
/6 R1AB_SARS2 Non-structural protein 3

8eua F SO4
SULFATE ION[5 atoms] A 100.0
/100.0 2
/2 R1AB_SARS2 Papain-like protease nsp3

8ilc B SO4
SULFATE ION[5 atoms] A 100.0
/100.0 4
/4 R1A_SARS2 Papain-like protease nsp3

8ilc C SO4
SULFATE ION[5 atoms] A 100.0
/100.0 1
/1 R1A_SARS2 Papain-like protease nsp3

8ilc D SO4
SULFATE ION[5 atoms] A 100.0
/100.0 2
/2 R1A_SARS2 Papain-like protease nsp3

8ilc E SO4
SULFATE ION[5 atoms] A 100.0
/100.0 3
/3 R1A_SARS2 Papain-like protease nsp3

8ilc F SO4
SULFATE ION[5 atoms] A 100.0
/100.0 3
/3 R1A_SARS2 Papain-like protease nsp3

8ufl L SO4
SULFATE ION[5 atoms] A 75.0
/75.3 4
/4 R1A_SARS Papain-like protease nsp3

8ufl M SO4
SULFATE ION[5 atoms] A 66.7
/75.3 3
/3 R1A_SARS Papain-like protease nsp3

8ufl N SO4
SULFATE ION[5 atoms] A 100.0
/75.3 1
/1 R1A_SARS Papain-like protease nsp3

8ufl O SO4
SULFATE ION[5 atoms] A 33.3
/75.3 3
/3 R1A_SARS Papain-like protease nsp3

8ufl P SO4
SULFATE ION[5 atoms] A 50.0
/75.3 2
/2 R1A_SARS Papain-like protease nsp3

8ufl AA SO4
SULFATE ION[5 atoms] B 100.0
/75.4 1
/1 R1A_SARS Papain-like protease nsp3

8ufl BA SO4
SULFATE ION[5 atoms] B 60.0
/75.4 5
/5 R1A_SARS Papain-like protease nsp3

8ufl X SO4
SULFATE ION[5 atoms] B 75.0
/75.4 4
/4 R1A_SARS Papain-like protease nsp3

8ufl Y SO4
SULFATE ION[5 atoms] B 50.0
/75.4 2
/2 R1A_SARS Papain-like protease nsp3

8ufl Z SO4
SULFATE ION[5 atoms] B 100.0
/75.4 4
/4 R1A_SARS Papain-like protease nsp3

8ufm D SO4
SULFATE ION[5 atoms] A 100.0
/99.2 3
/3 R1A_SARS2 Papain-like protease nsp3

8ufm E SO4
SULFATE ION[5 atoms] A 100.0
/99.2 2
/2 R1A_SARS2 Papain-like protease nsp3

8ufm F SO4
SULFATE ION[5 atoms] A 100.0
/99.2 2
/2 R1A_SARS2 Papain-like protease nsp3

8ufm G SO4
SULFATE ION[5 atoms] A 100.0
/99.2 4
/4 R1A_SARS2 Papain-like protease nsp3

8ufm H SO4
SULFATE ION[5 atoms] A 100.0
/99.2 5
/5 R1A_SARS2 Papain-like protease nsp3

8ufm I SO4
SULFATE ION[5 atoms] A 100.0
/99.2 4
/4 R1A_SARS2 Papain-like protease nsp3

8ufm J SO4
SULFATE ION[5 atoms] A 100.0
/99.2 3
/3 R1A_SARS2 Papain-like protease nsp3

8uvm F SO4
SULFATE ION[5 atoms] A 100.0
/100.0 5
/5 R1AB_SARS2 Papain-like protease nsp3

8uvm J SO4
SULFATE ION[5 atoms] B 100.0
/100.0 5
/5 R1AB_SARS2 Papain-like protease nsp3

8uvm N SO4
SULFATE ION[5 atoms] C 100.0
/100.0 5
/5 R1AB_SARS2 Papain-like protease nsp3

8uvm R SO4
SULFATE ION[5 atoms] D 100.0
/100.0 5
/5 R1AB_SARS2 Papain-like protease nsp3

4m0w G GOL
GLYCEROL[6 atoms] A 100.0
/82.3 5
/5 R1A_CVHSA Replicase polyprotein 1a

4m0w H GOL
GLYCEROL[6 atoms] A 66.7
/82.3 6
/6 R1A_CVHSA Replicase polyprotein 1a

4ow0 F GOL
GLYCEROL[6 atoms] A 66.7
/82.6 3
/3 R1A_CVHSA papain-like protease

5y3e H GOL
GLYCEROL[6 atoms] A 66.7
/82.8 6
/6 R1A_CVHSA Replicase polyprotein 1a

5y3e I GOL
GLYCEROL[6 atoms] A 100.0
/82.8 6
/6 R1A_CVHSA Replicase polyprotein 1a

5y3e J GOL
GLYCEROL[6 atoms] A 100.0
/82.8 5
/5 R1A_CVHSA Replicase polyprotein 1a

5y3q I GOL
GLYCEROL[6 atoms] A 66.7
/82.8 6
/6 R1A_CVHSA Replicase polyprotein 1a

5y3q J GOL
GLYCEROL[6 atoms] A 100.0
/82.8 6
/6 R1A_CVHSA Replicase polyprotein 1a

6wrh H GOL
GLYCEROL[6 atoms] A 100.0
/99.7 3
/3 R1AB_SARS2 Non-structural protein 3

6wrh I GOL
GLYCEROL[6 atoms] A 100.0
/99.7 6
/6 R1AB_SARS2 Non-structural protein 3

6wzu C GOL
GLYCEROL[6 atoms] A 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 3

6wzu H GOL
GLYCEROL[6 atoms] A 100.0
/100.0 6
/6 R1AB_SARS2 Non-structural protein 3

6xa9 G GOL
GLYCEROL[6 atoms] A 100.0
/100.0 5
/5 R1AB_SARS2 Non-structural protein 3

6xa9 H GOL
GLYCEROL[6 atoms] A 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 3

6xa9 I GOL
GLYCEROL[6 atoms] A 100.0
/100.0 5
/5 R1AB_SARS2 Non-structural protein 3

6xa9 K GOL
GLYCEROL[6 atoms] C 100.0
/100.0 5
/5 R1AB_SARS2 Non-structural protein 3

6xa9 L GOL
GLYCEROL[6 atoms] C 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 3

6xa9 M GOL
GLYCEROL[6 atoms] C 100.0
/100.0 5
/5 R1AB_SARS2 Non-structural protein 3

6xa9 P GOL
GLYCEROL[6 atoms] E 100.0
/100.0 2
/2 R1AB_SARS2 Non-structural protein 3

6xa9 Q GOL
GLYCEROL[6 atoms] E 100.0
/100.0 5
/5 R1AB_SARS2 Non-structural protein 3

6z6i H GOL
GLYCEROL[6 atoms] A 100.0
/100.0 10
/10 R1AB_SARS2 Replicase polyprotein 1ab

6z6i N GOL
GLYCEROL[6 atoms] B 100.0
/100.0 3
/3 R1AB_SARS2 Replicase polyprotein 1ab

6z6i S GOL
GLYCEROL[6 atoms] C 100.0
/100.0 4
/4 R1AB_SARS2 Replicase polyprotein 1ab

6z6i W GOL
GLYCEROL[6 atoms] C 100.0
/100.0 6
/6 R1AB_SARS2 Replicase polyprotein 1ab

6z6i DA GOL
GLYCEROL[6 atoms] D 100.0
/100.0 5
/5 R1AB_SARS2 Replicase polyprotein 1ab

7d7l L GOL
GLYCEROL[6 atoms] A 100.0
/99.7 5
/5 R1AB_SARS2 Non-structural protein 3

7d7l M GOL
GLYCEROL[6 atoms] A 100.0
/99.7 6
/6 R1AB_SARS2 Non-structural protein 3

7lbr G GOL
GLYCEROL[6 atoms] A 100.0
/100.0 3
/3 R1A_SARS2 Non-structural protein 3

7lbr L GOL
GLYCEROL[6 atoms] B 100.0
/100.0 4
/4 R1A_SARS2 Non-structural protein 3

7lbs M GOL
GLYCEROL[6 atoms] B 100.0
/100.0 6
/6 R1A_SARS2 Non-structural protein 3

7lbs N GOL
GLYCEROL[6 atoms] B 100.0
/100.0 6
/6 R1A_SARS2 Non-structural protein 3

7llf O GOL
GLYCEROL[6 atoms] B 100.0
/100.0 4
/4 R1A_SARS2 Non-structural protein 3

7m1y F GOL
GLYCEROL[6 atoms] A 100.0
/99.7 5
/5 R1A_SARS2 Papain-like protease

7m1y V GOL
GLYCEROL[6 atoms] B 100.0
/99.7 6
/6 R1A_SARS2 Papain-like protease

7nfv C GOL
GLYCEROL[6 atoms] A 100.0
/100.0 6
/6 R1A_SARS2 Papain-like protease nsp3

7ofs H GOL
GLYCEROL[6 atoms] A 100.0
/100.0 3
/3 R1A_SARS2 Papain-like protease nsp3

7ofu C GOL
GLYCEROL[6 atoms] A 100.0
/100.0 3
/3 R1A_SARS2 Papain-like protease nsp3

7ofu D GOL
GLYCEROL[6 atoms] A 100.0
/100.0 7
/7 R1A_SARS2 Papain-like protease nsp3

7qcg C GOL
GLYCEROL[6 atoms] A 100.0
/100.0 3
/3 R1A_SARS2 Papain-like protease nsp3

7qcg D GOL
GLYCEROL[6 atoms] A 100.0
/100.0 3
/3 R1A_SARS2 Papain-like protease nsp3

7qch C GOL
GLYCEROL[6 atoms] A 100.0
/100.0 5
/5 R1A_SARS2 Papain-like protease nsp3

7qch D GOL
GLYCEROL[6 atoms] A 100.0
/100.0 5
/5 R1A_SARS2 Papain-like protease nsp3

7qci C GOL
GLYCEROL[6 atoms] A 100.0
/100.0 3
/3 R1A_SARS2 Papain-like protease nsp3

7qci D GOL
GLYCEROL[6 atoms] A 100.0
/100.0 5
/5 R1A_SARS2 Papain-like protease nsp3

7qcj B GOL
GLYCEROL[6 atoms] A 100.0
/100.0 5
/5 R1A_SARS2 Papain-like protease nsp3

7qcj C GOL
GLYCEROL[6 atoms] A 100.0
/100.0 3
/3 R1A_SARS2 Papain-like protease nsp3

7qcj D GOL
GLYCEROL[6 atoms] A 100.0
/100.0 3
/3 R1A_SARS2 Papain-like protease nsp3

7qcj E GOL
GLYCEROL[6 atoms] A 100.0
/100.0 3
/3 R1A_SARS2 Papain-like protease nsp3

7qcj G GOL
GLYCEROL[6 atoms] A 100.0
/100.0 7
/7 R1A_SARS2 Papain-like protease nsp3

7qck C GOL
GLYCEROL[6 atoms] A 100.0
/100.0 3
/3 R1A_SARS2 Papain-like protease nsp3

7qck D GOL
GLYCEROL[6 atoms] A 100.0
/100.0 5
/5 R1A_SARS2 Papain-like protease nsp3

7qck E GOL
GLYCEROL[6 atoms] A 100.0
/100.0 3
/3 R1A_SARS2 Papain-like protease nsp3

7qcm C GOL
GLYCEROL[6 atoms] A 100.0
/100.0 4
/4 R1A_SARS2 Papain-like protease nsp3

7qcm D GOL
GLYCEROL[6 atoms] A 100.0
/100.0 3
/3 R1A_SARS2 Papain-like protease nsp3

7qcm E GOL
GLYCEROL[6 atoms] A 100.0
/100.0 3
/3 R1A_SARS2 Papain-like protease nsp3

7qcm F GOL
GLYCEROL[6 atoms] A 100.0
/100.0 3
/3 R1A_SARS2 Papain-like protease nsp3

7qcm G GOL
GLYCEROL[6 atoms] A 100.0
/100.0 7
/7 R1A_SARS2 Papain-like protease nsp3

7sdr J GOL
GLYCEROL[6 atoms] B 100.0
/100.0 4
/4 R1A_SARS2 Non-structural protein 3

8f2e B GOL
GLYCEROL[6 atoms] A 100.0
/100.0 5
/5 R1AB_SARS2 Papain-like protease nsp3

8f2e C GOL
GLYCEROL[6 atoms] A 100.0
/100.0 5
/5 R1AB_SARS2 Papain-like protease nsp3

8f2e D GOL
GLYCEROL[6 atoms] A 100.0
/100.0 2
/2 R1AB_SARS2 Papain-like protease nsp3

8f2e E GOL
GLYCEROL[6 atoms] A 100.0
/100.0 1
/1 R1AB_SARS2 Papain-like protease nsp3

8f2e F GOL
GLYCEROL[6 atoms] A 100.0
/100.0 7
/7 R1AB_SARS2 Papain-like protease nsp3

8f2e G GOL
GLYCEROL[6 atoms] A 100.0
/100.0 3
/3 R1AB_SARS2 Papain-like protease nsp3

8fwn C GOL
GLYCEROL[6 atoms] A 100.0
/99.7 6
/6 R1AB_SARS2 Papain-like protease nsp3

8fwn D GOL
GLYCEROL[6 atoms] A 100.0
/99.7 3
/3 R1AB_SARS2 Papain-like protease nsp3

8fwn H GOL
GLYCEROL[6 atoms] A 100.0
/99.7 4
/4 R1AB_SARS2 Papain-like protease nsp3

8fwn I GOL
GLYCEROL[6 atoms] A 100.0
/99.7 5
/5 R1AB_SARS2 Papain-like protease nsp3

8fwo B GOL
GLYCEROL[6 atoms] A 100.0
/100.0 4
/4 R1AB_SARS2 Papain-like protease nsp3

8fwo C GOL
GLYCEROL[6 atoms] A 100.0
/100.0 2
/2 R1AB_SARS2 Papain-like protease nsp3

8hbl D GOL
GLYCEROL[6 atoms] A 100.0
/99.2 3
/3 R1A_SARS2 Non-structural protein 3

8hbl E GOL
GLYCEROL[6 atoms] A 100.0
/99.2 4
/4 R1A_SARS2 Non-structural protein 3

8hbl F GOL
GLYCEROL[6 atoms] A 100.0
/99.2 3
/3 R1A_SARS2 Non-structural protein 3

8hbl G GOL
GLYCEROL[6 atoms] A 100.0
/99.2 2
/2 R1A_SARS2 Non-structural protein 3

8uug C GOL
GLYCEROL[6 atoms] A 100.0
/100.0 3
/3 R1AB_SARS2 Papain-like protease nsp3

8uuu M GOL
GLYCEROL[6 atoms] A 100.0
/100.0 3
/3 R1A_SARS2 Papain-like protease nsp3

8uuu N GOL
GLYCEROL[6 atoms] A 100.0
/100.0 3
/3 R1A_SARS2 Papain-like protease nsp3

4ovz E DMS
DIMETHYL SULFOXIDE[4 atoms] A 100.0
/82.5 4
/4 R1A_CVHSA Papain-like proteinase

4ovz I DMS
DIMETHYL SULFOXIDE[4 atoms] B 33.3
/81.3 3
/3 R1A_CVHSA Papain-like proteinase

4ovz J DMS
DIMETHYL SULFOXIDE[4 atoms] B 100.0
/81.3 3
/3 R1A_CVHSA Papain-like proteinase

4ovz K DMS
DIMETHYL SULFOXIDE[4 atoms] B 100.0
/81.3 4
/4 R1A_CVHSA Papain-like proteinase

4ovz L DMS
DIMETHYL SULFOXIDE[4 atoms] B 66.7
/81.3 6
/6 R1A_CVHSA Papain-like proteinase

4ow0 E DMS
DIMETHYL SULFOXIDE[4 atoms] A 100.0
/82.6 4
/4 R1A_CVHSA papain-like protease

4ow0 G DMS
DIMETHYL SULFOXIDE[4 atoms] A 60.0
/82.6 5
/5 R1A_CVHSA papain-like protease

4ow0 J DMS
DIMETHYL SULFOXIDE[4 atoms] B 50.0
/81.1 2
/2 R1A_CVHSA papain-like protease

5s18 E DMS
DIMETHYL SULFOXIDE[4 atoms] B 100.0
/100.0 4
/4 R1AB_SARS2 Non-structural protein 3

5s1c E DMS
DIMETHYL SULFOXIDE[4 atoms] B 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 3

5s1e E DMS
DIMETHYL SULFOXIDE[4 atoms] B 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 3

7skr C DMS
DIMETHYL SULFOXIDE[4 atoms] A 100.0
/82.1 2
/2 Q0QDZ2_SARS 3C-like proteinase

7skr C DMS
DIMETHYL SULFOXIDE[4 atoms] A 100.0
/82.1 2
/2 Q0QDZ2_SARS 3C-like proteinase

7tzj H DMS
DIMETHYL SULFOXIDE[4 atoms] A 100.0
/99.7 5
/5 R1A_SARS2 Papain-like protease

7tzj O DMS
DIMETHYL SULFOXIDE[4 atoms] B 100.0
/99.7 4
/4 R1A_SARS2 Papain-like protease

8uuw C DMS
DIMETHYL SULFOXIDE[4 atoms] A 100.0
/100.0 1
/1 R1A_SARS2 Papain-like protease nsp3

5e6j G ACT
ACETATE ION[4 atoms] A 83.3
/82.0 6
/6 R1AB_CVHSA Replicase polyprotein 1ab

7jir L ACT
ACETATE ION[4 atoms] A 85.7
/99.7 7
/7 R1A_SARS2 Papain-like protease

7jit K ACT
ACETATE ION[4 atoms] A 85.7
/99.7 7
/7 R1A_SARS2 Papain-like protease

7jit L ACT
ACETATE ION[4 atoms] A 100.0
/99.7 5
/5 R1A_SARS2 Papain-like protease

7jiv K ACT
ACETATE ION[4 atoms] A 85.7
/99.7 7
/7 R1A_SARS2 Papain-like protease

7jn2 L ACT
ACETATE ION[4 atoms] A 100.0
/100.0 2
/2 R1A_SARS2 Papain-like protease

7koj K ACT
ACETATE ION[4 atoms] A 85.7
/99.7 7
/7 R1A_SARS2 Papain-like protease

7koj L ACT
ACETATE ION[4 atoms] A 100.0
/99.7 5
/5 R1A_SARS2 Papain-like protease

7kok J ACT
ACETATE ION[4 atoms] A 85.7
/99.7 7
/7 R1A_SARS2 Papain-like protease

7krx I ACT
ACETATE ION[4 atoms] A 100.0
/99.7 2
/2 R1A_SARS2 Papain-like protease

7krx J ACT
ACETATE ION[4 atoms] A 83.3
/99.7 6
/6 R1A_SARS2 Papain-like protease

8fwn G ACT
ACETATE ION[4 atoms] A 100.0
/99.7 4
/4 R1AB_SARS2 Papain-like protease nsp3

8g62 J ACT
ACETATE ION[4 atoms] A 100.0
/100.0 3
/3 R1A_SARS2 Non-structural protein 3

8g62 K ACT
ACETATE ION[4 atoms] A 100.0
/100.0 6
/6 R1A_SARS2 Non-structural protein 3

8g62 L ACT
ACETATE ION[4 atoms] A 100.0
/100.0 4
/4 R1A_SARS2 Non-structural protein 3

8g62 S ACT
ACETATE ION[4 atoms] B 100.0
/100.0 5
/5 R1A_SARS2 Non-structural protein 3

8g62 T ACT
ACETATE ION[4 atoms] B 100.0
/100.0 6
/6 R1A_SARS2 Non-structural protein 3

8g62 Z ACT
ACETATE ION[4 atoms] C 100.0
/100.0 3
/3 R1A_SARS2 Non-structural protein 3

8ufm C ACT
ACETATE ION[4 atoms] A 100.0
/99.2 4
/4 R1A_SARS2 Papain-like protease nsp3

8uuf C ACT
ACETATE ION[4 atoms] A 100.0
/100.0 1
/1 R1A_SARS2 Papain-like protease nsp3

8uug D ACT
ACETATE ION[4 atoms] A 100.0
/100.0 3
/3 R1AB_SARS2 Papain-like protease nsp3

8uuu C ACT
ACETATE ION[4 atoms] A 100.0
/100.0 2
/2 R1A_SARS2 Papain-like protease nsp3

8uuw D ACT
ACETATE ION[4 atoms] A 100.0
/100.0 2
/2 R1A_SARS2 Papain-like protease nsp3

8uuy E ACT
ACETATE ION[4 atoms] A 100.0
/100.0 3
/3 R1A_SARS2 Papain-like protease nsp3

6ywk J EPE
4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACI.. C 100.0
/100.0 6
/6 R1AB_SARS2 NSP3 macrodomain

6ywk CA EPE
4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACI.. E 100.0
/100.0 11
/11 R1AB_SARS2 NSP3 macrodomain

6ywk DA EPE
4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACI.. E 100.0
/100.0 6
/6 R1AB_SARS2 NSP3 macrodomain

6ywm D MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms] A 100.0
/100.0 10
/10 R1AB_SARS2 NSP3 macrodomain

7jir K MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms] A 100.0
/99.7 3
/3 R1A_SARS2 Papain-like protease

7jit J MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms] A 100.0
/99.7 3
/3 R1A_SARS2 Papain-like protease

7jiv G MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms] A 100.0
/99.7 3
/3 R1A_SARS2 Papain-like protease

7jiw K MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms] A 100.0
/100.0 6
/6 R1A_SARS2 Papain-like protease

7koj J MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms] A 100.0
/99.7 3
/3 R1A_SARS2 Papain-like protease

7kok K MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms] A 100.0
/99.7 3
/3 R1A_SARS2 Papain-like protease

7kol K MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms] A 100.0
/100.0 6
/6 R1A_SARS2 Papain-like protease

7lbs F BO3
BORIC ACID[4 atoms] A 100.0
/100.0 4
/4 R1A_SARS2 Non-structural protein 3

7lbs G BO3
BORIC ACID[4 atoms] A 100.0
/100.0 7
/7 R1A_SARS2 Non-structural protein 3

7lbs I BO3
BORIC ACID[4 atoms] A 100.0
/100.0 10
/10 R1A_SARS2 Non-structural protein 3

7lbs O BO3
BORIC ACID[4 atoms] B 100.0
/100.0 2
/2 R1A_SARS2 Non-structural protein 3

7llf E BO3
BORIC ACID[4 atoms] A 100.0
/100.0 3
/3 R1A_SARS2 Non-structural protein 3

7llf F BO3
BORIC ACID[4 atoms] A 100.0
/100.0 7
/7 R1A_SARS2 Non-structural protein 3

8uuh C PEG
DI(HYDROXYETHYL)ETHER[7 atoms] A 100.0
/100.0 3
/3 R1A_SARS2 Papain-like protease nsp3

8uuh D PEG
DI(HYDROXYETHYL)ETHER[7 atoms] A 100.0
/100.0 3
/3 R1A_SARS2 Papain-like protease nsp3

8uuy C PEG
DI(HYDROXYETHYL)ETHER[7 atoms] A 100.0
/100.0 2
/2 R1A_SARS2 Papain-like protease nsp3

8uuy D PGE
TRIETHYLENE GLYCOL[10 atoms] A 100.0
/100.0 1
/1 R1A_SARS2 Papain-like protease nsp3

5s74 E EDO
1,2-ETHANEDIOL[4 atoms] B 100.0
/100.0 2
/2 R1AB_SARS2 Non-structural protein 3

5s74 F EDO
1,2-ETHANEDIOL[4 atoms] B 100.0
/100.0 4
/4 R1AB_SARS2 Non-structural protein 3

5s74 G EDO
1,2-ETHANEDIOL[4 atoms] B 100.0
/100.0 6
/6 R1AB_SARS2 Non-structural protein 3

5s74 H EDO
1,2-ETHANEDIOL[4 atoms] B 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 3

6ywk F EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/100.0 2
/2 R1AB_SARS2 NSP3 macrodomain

6ywk G EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/100.0 6
/6 R1AB_SARS2 NSP3 macrodomain

6ywk H EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/100.0 5
/5 R1AB_SARS2 NSP3 macrodomain

6ywk K EDO
1,2-ETHANEDIOL[4 atoms] C 100.0
/100.0 6
/6 R1AB_SARS2 NSP3 macrodomain

6ywk L EDO
1,2-ETHANEDIOL[4 atoms] C 100.0
/100.0 2
/3 R1AB_SARS2 NSP3 macrodomain

6ywk M EDO
1,2-ETHANEDIOL[4 atoms] C 100.0
/100.0 2
/2 R1AB_SARS2 NSP3 macrodomain

6ywk N EDO
1,2-ETHANEDIOL[4 atoms] C 100.0
/100.0 4
/4 R1AB_SARS2 NSP3 macrodomain

6ywk O EDO
1,2-ETHANEDIOL[4 atoms] C 100.0
/100.0 4
/5 R1AB_SARS2 NSP3 macrodomain

6ywk P EDO
1,2-ETHANEDIOL[4 atoms] C 100.0
/100.0 3
/3 R1AB_SARS2 NSP3 macrodomain

6ywk AA EDO
1,2-ETHANEDIOL[4 atoms] D 100.0
/100.0 4
/4 R1AB_SARS2 NSP3 macrodomain

6ywk Q EDO
1,2-ETHANEDIOL[4 atoms] D 100.0
/100.0 3
/3 R1AB_SARS2 NSP3 macrodomain

6ywk R EDO
1,2-ETHANEDIOL[4 atoms] D 100.0
/100.0 2
/2 R1AB_SARS2 NSP3 macrodomain

6ywk S EDO
1,2-ETHANEDIOL[4 atoms] D 100.0
/100.0 5
/5 R1AB_SARS2 NSP3 macrodomain

6ywk T EDO
1,2-ETHANEDIOL[4 atoms] D 100.0
/100.0 5
/5 R1AB_SARS2 NSP3 macrodomain

6ywk U EDO
1,2-ETHANEDIOL[4 atoms] D 100.0
/100.0 5
/5 R1AB_SARS2 NSP3 macrodomain

6ywk V EDO
1,2-ETHANEDIOL[4 atoms] D 100.0
/100.0 7
/7 R1AB_SARS2 NSP3 macrodomain

6ywk W EDO
1,2-ETHANEDIOL[4 atoms] D 100.0
/100.0 1
/1 R1AB_SARS2 NSP3 macrodomain

6ywk X EDO
1,2-ETHANEDIOL[4 atoms] D 100.0
/100.0 7
/7 R1AB_SARS2 NSP3 macrodomain

6ywk Y EDO
1,2-ETHANEDIOL[4 atoms] D 100.0
/100.0 3
/3 R1AB_SARS2 NSP3 macrodomain

6ywk Z EDO
1,2-ETHANEDIOL[4 atoms] D 100.0
/100.0 1
/1 R1AB_SARS2 NSP3 macrodomain

6ywk EA EDO
1,2-ETHANEDIOL[4 atoms] E 100.0
/100.0 5
/5 R1AB_SARS2 NSP3 macrodomain

6ywk FA EDO
1,2-ETHANEDIOL[4 atoms] E 100.0
/100.0 7
/7 R1AB_SARS2 NSP3 macrodomain

6ywl G EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/100.0 5
/5 R1AB_SARS2 NSP3 macrodomain

6ywl H EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/100.0 6
/6 R1AB_SARS2 NSP3 macrodomain

6ywl I EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/100.0 4
/4 R1AB_SARS2 NSP3 macrodomain

6ywl J EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/100.0 4
/4 R1AB_SARS2 NSP3 macrodomain

6ywl K EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/100.0 1
/1 R1AB_SARS2 NSP3 macrodomain

6ywl L EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/100.0 3
/3 R1AB_SARS2 NSP3 macrodomain

6ywl N EDO
1,2-ETHANEDIOL[4 atoms] B 100.0
/100.0 4
/4 R1AB_SARS2 NSP3 macrodomain

6ywl O EDO
1,2-ETHANEDIOL[4 atoms] B 100.0
/100.0 3
/3 R1AB_SARS2 NSP3 macrodomain

6ywl R EDO
1,2-ETHANEDIOL[4 atoms] C 100.0
/100.0 5
/5 R1AB_SARS2 NSP3 macrodomain

6ywl S EDO
1,2-ETHANEDIOL[4 atoms] C 100.0
/100.0 5
/5 R1AB_SARS2 NSP3 macrodomain

6ywl U EDO
1,2-ETHANEDIOL[4 atoms] D 100.0
/100.0 5
/5 R1AB_SARS2 NSP3 macrodomain

6ywl V EDO
1,2-ETHANEDIOL[4 atoms] D 100.0
/100.0 4
/4 R1AB_SARS2 NSP3 macrodomain

6ywl W EDO
1,2-ETHANEDIOL[4 atoms] D 100.0
/100.0 4
/4 R1AB_SARS2 NSP3 macrodomain

6ywl Z EDO
1,2-ETHANEDIOL[4 atoms] E 100.0
/100.0 6
/6 R1AB_SARS2 NSP3 macrodomain

6ywm E EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/100.0 3
/3 R1AB_SARS2 NSP3 macrodomain

6ywm F EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/100.0 4
/4 R1AB_SARS2 NSP3 macrodomain

6ywm G EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/100.0 3
/3 R1AB_SARS2 NSP3 macrodomain

6ywm H EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/100.0 3
/3 R1AB_SARS2 NSP3 macrodomain

6ywm I EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/100.0 3
/3 R1AB_SARS2 NSP3 macrodomain

6ywm K EDO
1,2-ETHANEDIOL[4 atoms] B 100.0
/100.0 6
/6 R1AB_SARS2 NSP3 macrodomain

6ywm L EDO
1,2-ETHANEDIOL[4 atoms] B 100.0
/100.0 3
/3 R1AB_SARS2 NSP3 macrodomain

6ywm M EDO
1,2-ETHANEDIOL[4 atoms] B 100.0
/100.0 6
/6 R1AB_SARS2 NSP3 macrodomain

6z6i F EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/100.0 4
/4 R1AB_SARS2 Replicase polyprotein 1ab

6z6i G EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/100.0 4
/4 R1AB_SARS2 Replicase polyprotein 1ab

6z6i I EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/100.0 3
/3 R1AB_SARS2 Replicase polyprotein 1ab

6z6i P EDO
1,2-ETHANEDIOL[4 atoms] B 100.0
/100.0 1
/1 R1AB_SARS2 Replicase polyprotein 1ab

6z6i T EDO
1,2-ETHANEDIOL[4 atoms] C 100.0
/100.0 5
/5 R1AB_SARS2 Replicase polyprotein 1ab

6z6i U EDO
1,2-ETHANEDIOL[4 atoms] C 100.0
/100.0 2
/2 R1AB_SARS2 Replicase polyprotein 1ab

6z6i V EDO
1,2-ETHANEDIOL[4 atoms] C 100.0
/100.0 5
/5 R1AB_SARS2 Replicase polyprotein 1ab

6z6i EA EDO
1,2-ETHANEDIOL[4 atoms] D 100.0
/100.0 4
/4 R1AB_SARS2 Replicase polyprotein 1ab

6z6i FA EDO
1,2-ETHANEDIOL[4 atoms] D 100.0
/100.0 4
/4 R1AB_SARS2 Replicase polyprotein 1ab

6z6i GA EDO
1,2-ETHANEDIOL[4 atoms] D 100.0
/100.0 6
/6 R1AB_SARS2 Replicase polyprotein 1ab

6z6i HA EDO
1,2-ETHANEDIOL[4 atoms] D 100.0
/100.0 3
/3 R1AB_SARS2 Replicase polyprotein 1ab

6z6i IA EDO
1,2-ETHANEDIOL[4 atoms] D 100.0
/100.0 1
/1 R1AB_SARS2 Replicase polyprotein 1ab

6z6i JA EDO
1,2-ETHANEDIOL[4 atoms] D 100.0
/100.0 2
/2 R1AB_SARS2 Replicase polyprotein 1ab

6z72 F EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/100.0 4
/4 R1AB_SARS2 Replicase polyprotein 1ab

6z72 G EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/100.0 4
/4 R1AB_SARS2 Replicase polyprotein 1ab

6z72 H EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/100.0 4
/4 R1AB_SARS2 Replicase polyprotein 1ab

6z72 K EDO
1,2-ETHANEDIOL[4 atoms] B 100.0
/100.0 3
/3 R1AB_SARS2 Replicase polyprotein 1ab

6z72 N EDO
1,2-ETHANEDIOL[4 atoms] C 100.0
/100.0 4
/4 R1AB_SARS2 Replicase polyprotein 1ab

6z72 O EDO
1,2-ETHANEDIOL[4 atoms] C 100.0
/100.0 6
/6 R1AB_SARS2 Replicase polyprotein 1ab

6z72 S EDO
1,2-ETHANEDIOL[4 atoms] D 100.0
/100.0 4
/4 R1AB_SARS2 Replicase polyprotein 1ab

7bf3 F EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/100.0 3
/3 R1AB_SARS2 NSP3 macrodomain

7bf3 G EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/100.0 3
/3 R1AB_SARS2 NSP3 macrodomain

7bf3 H EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/100.0 2
/2 R1AB_SARS2 NSP3 macrodomain

7bf3 K EDO
1,2-ETHANEDIOL[4 atoms] B 100.0
/100.0 4
/4 R1AB_SARS2 NSP3 macrodomain

7bf3 N EDO
1,2-ETHANEDIOL[4 atoms] C 100.0
/100.0 4
/4 R1AB_SARS2 NSP3 macrodomain

7bf3 O EDO
1,2-ETHANEDIOL[4 atoms] D 100.0
/100.0 3
/3 R1AB_SARS2 NSP3 macrodomain

7bf3 P EDO
1,2-ETHANEDIOL[4 atoms] E 100.0
/100.0 3
/3 R1AB_SARS2 NSP3 macrodomain

7bf4 C EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/100.0 5
/5 R1AB_SARS2 NSP3 macrodomain

7bf4 D EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/100.0 4
/4 R1AB_SARS2 NSP3 macrodomain

7bf4 E EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/100.0 5
/5 R1AB_SARS2 NSP3 macrodomain

7bf4 F EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/100.0 6
/6 R1AB_SARS2 NSP3 macrodomain

7bf4 G EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/100.0 5
/5 R1AB_SARS2 NSP3 macrodomain

7bf4 H EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/100.0 6
/6 R1AB_SARS2 NSP3 macrodomain

7bf4 I EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/100.0 3
/3 R1AB_SARS2 NSP3 macrodomain

7bf4 J EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/100.0 2
/2 R1AB_SARS2 NSP3 macrodomain

7bf4 K EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/100.0 5
/5 R1AB_SARS2 NSP3 macrodomain

7bf5 H EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/100.0 2
/2 R1AB_SARS2 NSP3 macrodomain

7bf5 I EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/100.0 5
/5 R1AB_SARS2 NSP3 macrodomain

7bf5 K EDO
1,2-ETHANEDIOL[4 atoms] B 100.0
/100.0 4
/4 R1AB_SARS2 NSP3 macrodomain

7bf5 N EDO
1,2-ETHANEDIOL[4 atoms] C 100.0
/100.0 4
/4 R1AB_SARS2 NSP3 macrodomain

7bf5 O EDO
1,2-ETHANEDIOL[4 atoms] C 100.0
/100.0 2
/2 R1AB_SARS2 NSP3 macrodomain

7bf5 P EDO
1,2-ETHANEDIOL[4 atoms] C 100.0
/100.0 3
/3 R1AB_SARS2 NSP3 macrodomain

7bf5 Q EDO
1,2-ETHANEDIOL[4 atoms] C 100.0
/100.0 2
/2 R1AB_SARS2 NSP3 macrodomain

7bf5 R EDO
1,2-ETHANEDIOL[4 atoms] D 100.0
/100.0 3
/3 R1AB_SARS2 NSP3 macrodomain

7bf5 S EDO
1,2-ETHANEDIOL[4 atoms] D 100.0
/100.0 7
/7 R1AB_SARS2 NSP3 macrodomain

7bf5 T EDO
1,2-ETHANEDIOL[4 atoms] D 100.0
/100.0 6
/6 R1AB_SARS2 NSP3 macrodomain

7bf5 W EDO
1,2-ETHANEDIOL[4 atoms] E 100.0
/100.0 3
/3 R1AB_SARS2 NSP3 macrodomain

7bf6 E EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/100.0 3
/3 R1AB_SARS2 Papain-like protease nsp3

7bf6 F EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/100.0 7
/7 R1AB_SARS2 Papain-like protease nsp3

7bf6 G EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/100.0 3
/3 R1AB_SARS2 Papain-like protease nsp3

7cjd G EDO
1,2-ETHANEDIOL[4 atoms] B 100.0
/99.7 1
/1 R1AB_SARS2 Non-structural protein 3

7d7k E EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/99.7 4
/4 R1AB_SARS2 Non-structural protein 3

7d7k F EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/99.7 2
/2 R1AB_SARS2 Non-structural protein 3

7d7k G EDO
1,2-ETHANEDIOL[4 atoms] A 87.5
/99.7 8
/8 R1AB_SARS2 Non-structural protein 3

7d7k H EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/99.7 2
/2 R1AB_SARS2 Non-structural protein 3

7d7k I EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/99.7 2
/2 R1AB_SARS2 Non-structural protein 3

7d7k J EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/99.7 2
/2 R1AB_SARS2 Non-structural protein 3

7d7k K EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/99.7 1
/1 R1AB_SARS2 Non-structural protein 3

7d7k Q EDO
1,2-ETHANEDIOL[4 atoms] B 100.0
/99.7 6
/6 R1AB_SARS2 Non-structural protein 3

7d7k R EDO
1,2-ETHANEDIOL[4 atoms] B 100.0
/99.7 3
/3 R1AB_SARS2 Non-structural protein 3

7d7k S EDO
1,2-ETHANEDIOL[4 atoms] B 100.0
/99.7 4
/4 R1AB_SARS2 Non-structural protein 3

7d7k T EDO
1,2-ETHANEDIOL[4 atoms] B 100.0
/99.7 3
/3 R1AB_SARS2 Non-structural protein 3

7d7k U EDO
1,2-ETHANEDIOL[4 atoms] B 100.0
/99.7 3
/3 R1AB_SARS2 Non-structural protein 3

7d7k X EDO
1,2-ETHANEDIOL[4 atoms] B 87.5
/99.7 8
/8 R1AB_SARS2 Non-structural protein 3

7lfv F EDO
1,2-ETHANEDIOL[4 atoms] A 75.0
/82.7 4
/4 R1A_SARS papain-like protease

7lfv G EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/82.7 3
/3 R1A_SARS papain-like protease

7lfv H EDO
1,2-ETHANEDIOL[4 atoms] A 75.0
/82.7 4
/4 R1A_SARS papain-like protease

7lfv I EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/82.7 3
/3 R1A_SARS papain-like protease

7lfv J EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/82.7 4
/4 R1A_SARS papain-like protease

7lfv K EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/82.7 4
/4 R1A_SARS papain-like protease

7lfv L EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/82.7 3
/3 R1A_SARS papain-like protease

7lfv M EDO
1,2-ETHANEDIOL[4 atoms] A 80.0
/82.7 5
/5 R1A_SARS papain-like protease

7lfv N EDO
1,2-ETHANEDIOL[4 atoms] A 75.0
/82.7 4
/4 R1A_SARS papain-like protease

7lfv O EDO
1,2-ETHANEDIOL[4 atoms] A 75.0
/82.7 4
/4 R1A_SARS papain-like protease

7lfv P EDO
1,2-ETHANEDIOL[4 atoms] A 57.1
/82.7 7
/7 R1A_SARS papain-like protease

7lfv Q EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/82.7 5
/5 R1A_SARS papain-like protease

7lfv AA EDO
1,2-ETHANEDIOL[4 atoms] B 100.0
/82.8 6
/6 R1A_SARS papain-like protease

7lfv BA EDO
1,2-ETHANEDIOL[4 atoms] B 75.0
/82.8 4
/4 R1A_SARS papain-like protease

7lfv CA EDO
1,2-ETHANEDIOL[4 atoms] B 57.1
/82.8 7
/7 R1A_SARS papain-like protease

7lfv T EDO
1,2-ETHANEDIOL[4 atoms] B 50.0
/82.8 2
/2 R1A_SARS papain-like protease

7lfv V EDO
1,2-ETHANEDIOL[4 atoms] B 100.0
/82.8 2
/2 R1A_SARS papain-like protease

7lfv W EDO
1,2-ETHANEDIOL[4 atoms] B 100.0
/82.8 5
/5 R1A_SARS papain-like protease

7lfv X EDO
1,2-ETHANEDIOL[4 atoms] B 100.0
/82.8 3
/3 R1A_SARS papain-like protease

7lfv Y EDO
1,2-ETHANEDIOL[4 atoms] B 100.0
/82.8 3
/3 R1A_SARS papain-like protease

7lfv Z EDO
1,2-ETHANEDIOL[4 atoms] B 100.0
/82.8 3
/3 R1A_SARS papain-like protease

7nt4 F EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/100.0 11
/11 R1AB_SARS2 Non-structural protein 3

7nt4 G EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/100.0 9
/9 R1AB_SARS2 Non-structural protein 3

7nt4 H EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 3

7nt4 I EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/100.0 6
/6 R1AB_SARS2 Non-structural protein 3

7nt4 P EDO
1,2-ETHANEDIOL[4 atoms] B 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 3

7nt4 Q EDO
1,2-ETHANEDIOL[4 atoms] B 100.0
/100.0 7
/7 R1AB_SARS2 Non-structural protein 3

7nt4 R EDO
1,2-ETHANEDIOL[4 atoms] B 100.0
/100.0 4
/4 R1AB_SARS2 Non-structural protein 3

7qg7 D EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/100.0 8
/8 R1AB_SARS2 Papain-like protease nsp3

7qg7 E EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/100.0 3
/3 R1AB_SARS2 Papain-like protease nsp3

7qg7 G EDO
1,2-ETHANEDIOL[4 atoms] B 100.0
/100.0 6
/6 R1AB_SARS2 Papain-like protease nsp3

7qg7 H EDO
1,2-ETHANEDIOL[4 atoms] B 100.0
/100.0 2
/2 R1AB_SARS2 Papain-like protease nsp3

7qg7 I EDO
1,2-ETHANEDIOL[4 atoms] B 100.0
/100.0 6
/6 R1AB_SARS2 Papain-like protease nsp3

7rbr F EDO
1,2-ETHANEDIOL[4 atoms] A 91.7
/99.7 12
/12 R1A_SARS2 Papain-like protease

7rzc G EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/100.0 7
/7 R1A_SARS2 Non-structural protein 3

7rzc H EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/100.0 12
/12 R1A_SARS2 Non-structural protein 3

7rzc L EDO
1,2-ETHANEDIOL[4 atoms] B 100.0
/100.0 3
/3 R1A_SARS2 Non-structural protein 3

7rzc M EDO
1,2-ETHANEDIOL[4 atoms] B 100.0
/100.0 7
/7 R1A_SARS2 Non-structural protein 3

7rzc N EDO
1,2-ETHANEDIOL[4 atoms] B 100.0
/100.0 10
/10 R1A_SARS2 Non-structural protein 3

7rzc O EDO
1,2-ETHANEDIOL[4 atoms] B 100.0
/100.0 5
/5 R1A_SARS2 Non-structural protein 3

7rzc P EDO
1,2-ETHANEDIOL[4 atoms] B 100.0
/100.0 4
/4 R1A_SARS2 Non-structural protein 3

7rzc U EDO
1,2-ETHANEDIOL[4 atoms] C 100.0
/100.0 10
/10 R1A_SARS2 Non-structural protein 3

7rzc V EDO
1,2-ETHANEDIOL[4 atoms] C 100.0
/100.0 3
/3 R1A_SARS2 Non-structural protein 3

7rzc W EDO
1,2-ETHANEDIOL[4 atoms] C 100.0
/100.0 6
/6 R1A_SARS2 Non-structural protein 3

7sdr F EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/100.0 11
/11 R1A_SARS2 Non-structural protein 3

7sdr K EDO
1,2-ETHANEDIOL[4 atoms] B 100.0
/100.0 7
/7 R1A_SARS2 Non-structural protein 3

7sdr L EDO
1,2-ETHANEDIOL[4 atoms] B 100.0
/100.0 10
/10 R1A_SARS2 Non-structural protein 3

7sdr M EDO
1,2-ETHANEDIOL[4 atoms] B 100.0
/100.0 5
/5 R1A_SARS2 Non-structural protein 3

7sdr P EDO
1,2-ETHANEDIOL[4 atoms] C 100.0
/100.0 10
/10 R1A_SARS2 Non-structural protein 3

7sqe H EDO
1,2-ETHANEDIOL[4 atoms] A 91.7
/99.7 12
/12 R1A_SARS2 Papain-like protease

7sqe L EDO
1,2-ETHANEDIOL[4 atoms] B 100.0
/99.7 2
/2 R1A_SARS2 Papain-like protease

7sqe M EDO
1,2-ETHANEDIOL[4 atoms] B 100.0
/99.7 7
/7 R1A_SARS2 Papain-like protease

7sqe N EDO
1,2-ETHANEDIOL[4 atoms] B 90.0
/99.7 10
/10 R1A_SARS2 Papain-like protease

7sqe T EDO
1,2-ETHANEDIOL[4 atoms] C 90.0
/99.7 10
/10 R1A_SARS2 Papain-like protease

7uv5 E EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/99.4 5
/5 R1A_SARS2 Papain-like protease nsp3

7uv5 F EDO
1,2-ETHANEDIOL[4 atoms] A 81.8
/99.4 11
/11 R1A_SARS2 Papain-like protease nsp3

7uv5 G EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/99.4 5
/5 R1A_SARS2 Papain-like protease nsp3

6wrh C PO4
PHOSPHATE ION[5 atoms] A 83.3
/99.7 6
/6 R1AB_SARS2 Non-structural protein 3

6wrh D PO4
PHOSPHATE ION[5 atoms] A 100.0
/99.7 2
/2 R1AB_SARS2 Non-structural protein 3

6wrh E PO4
PHOSPHATE ION[5 atoms] A 100.0
/99.7 5
/5 R1AB_SARS2 Non-structural protein 3

6wzu D PO4
PHOSPHATE ION[5 atoms] A 100.0
/100.0 2
/2 R1AB_SARS2 Non-structural protein 3

6wzu E PO4
PHOSPHATE ION[5 atoms] A 100.0
/100.0 5
/5 R1AB_SARS2 Non-structural protein 3

6xg3 C PO4
PHOSPHATE ION[5 atoms] A 83.3
/99.7 6
/6 R1AB_SARS2 Non-structural protein 3

6xg3 C PO4
PHOSPHATE ION[5 atoms] A 83.3
/99.7 6
/6 R1AB_SARS2 Non-structural protein 3

7d6h C PO4
PHOSPHATE ION[5 atoms] A 83.3
/99.7 6
/6 R1A_SARS2 Papain-like protease

7nfv E PO4
PHOSPHATE ION[5 atoms] A 100.0
/100.0 5
/5 R1A_SARS2 Papain-like protease nsp3

7ofs G PO4
PHOSPHATE ION[5 atoms] A 100.0
/100.0 5
/5 R1A_SARS2 Papain-like protease nsp3

7ofu F PO4
PHOSPHATE ION[5 atoms] A 100.0
/100.0 5
/5 R1A_SARS2 Papain-like protease nsp3

7ofu G PO4
PHOSPHATE ION[5 atoms] A 100.0
/100.0 5
/5 R1A_SARS2 Papain-like protease nsp3

7ofu H PO4
PHOSPHATE ION[5 atoms] A 100.0
/100.0 2
/2 R1A_SARS2 Papain-like protease nsp3

7ofu I PO4
PHOSPHATE ION[5 atoms] A 100.0
/100.0 1
/1 R1A_SARS2 Papain-like protease nsp3

7qcg G PO4
PHOSPHATE ION[5 atoms] A 100.0
/100.0 6
/6 R1A_SARS2 Papain-like protease nsp3

7qcg H PO4
PHOSPHATE ION[5 atoms] A 100.0
/100.0 2
/2 R1A_SARS2 Papain-like protease nsp3

7qcg I PO4
PHOSPHATE ION[5 atoms] A 100.0
/100.0 5
/5 R1A_SARS2 Papain-like protease nsp3

7qcg J PO4
PHOSPHATE ION[5 atoms] A 100.0
/100.0 2
/2 R1A_SARS2 Papain-like protease nsp3

7qch F PO4
PHOSPHATE ION[5 atoms] A 100.0
/100.0 5
/5 R1A_SARS2 Papain-like protease nsp3

7qch G PO4
PHOSPHATE ION[5 atoms] A 100.0
/100.0 2
/2 R1A_SARS2 Papain-like protease nsp3

7qch H PO4
PHOSPHATE ION[5 atoms] A 100.0
/100.0 2
/2 R1A_SARS2 Papain-like protease nsp3

7qch I PO4
PHOSPHATE ION[5 atoms] A 100.0
/100.0 1
/1 R1A_SARS2 Papain-like protease nsp3

7qch J PO4
PHOSPHATE ION[5 atoms] A 100.0
/100.0 4
/4 R1A_SARS2 Papain-like protease nsp3

7qci F PO4
PHOSPHATE ION[5 atoms] A 100.0
/100.0 5
/5 R1A_SARS2 Papain-like protease nsp3

7qci G PO4
PHOSPHATE ION[5 atoms] A 100.0
/100.0 4
/4 R1A_SARS2 Papain-like protease nsp3

7qci H PO4
PHOSPHATE ION[5 atoms] A 100.0
/100.0 4
/4 R1A_SARS2 Papain-like protease nsp3

7qci I PO4
PHOSPHATE ION[5 atoms] A 100.0
/100.0 1
/1 R1A_SARS2 Papain-like protease nsp3

7qci J PO4
PHOSPHATE ION[5 atoms] A 100.0
/100.0 1
/1 R1A_SARS2 Papain-like protease nsp3

7qcj I PO4
PHOSPHATE ION[5 atoms] A 100.0
/100.0 5
/5 R1A_SARS2 Papain-like protease nsp3

7qcj J PO4
PHOSPHATE ION[5 atoms] A 100.0
/100.0 1
/1 R1A_SARS2 Papain-like protease nsp3

7qcj K PO4
PHOSPHATE ION[5 atoms] A 100.0
/100.0 4
/4 R1A_SARS2 Papain-like protease nsp3

7qck G PO4
PHOSPHATE ION[5 atoms] A 100.0
/100.0 5
/5 R1A_SARS2 Papain-like protease nsp3

7qck H PO4
PHOSPHATE ION[5 atoms] A 100.0
/100.0 1
/1 R1A_SARS2 Papain-like protease nsp3

7qck I PO4
PHOSPHATE ION[5 atoms] A 100.0
/100.0 2
/2 R1A_SARS2 Papain-like protease nsp3

7qcm L PO4
PHOSPHATE ION[5 atoms] A 100.0
/100.0 5
/5 R1A_SARS2 Papain-like protease nsp3

7qcm N PO4
PHOSPHATE ION[5 atoms] A 100.0
/100.0 2
/2 R1A_SARS2 Papain-like protease nsp3

8fwn B PO4
PHOSPHATE ION[5 atoms] A 83.3
/99.7 6
/6 R1AB_SARS2 Papain-like protease nsp3

8fwn E PO4
PHOSPHATE ION[5 atoms] A 100.0
/99.7 5
/5 R1AB_SARS2 Papain-like protease nsp3

8fwn F PO4
PHOSPHATE ION[5 atoms] A 100.0
/99.7 2
/2 R1AB_SARS2 Papain-like protease nsp3

8fwo D PO4
PHOSPHATE ION[5 atoms] A 100.0
/100.0 5
/5 R1AB_SARS2 Papain-like protease nsp3

8hbl B PO4
PHOSPHATE ION[5 atoms] A 100.0
/99.2 3
/3 R1A_SARS2 Non-structural protein 3

7m1y M FMT
FORMIC ACID[3 atoms] A 100.0
/99.7 3
/3 R1A_SARS2 Papain-like protease

7m1y N FMT
FORMIC ACID[3 atoms] A 100.0
/99.7 3
/3 R1A_SARS2 Papain-like protease

7m1y O FMT
FORMIC ACID[3 atoms] A 100.0
/99.7 4
/4 R1A_SARS2 Papain-like protease

7m1y BA FMT
FORMIC ACID[3 atoms] B 100.0
/99.7 4
/4 R1A_SARS2 Papain-like protease

7sgu F FMT
FORMIC ACID[3 atoms] A 100.0
/99.7 4
/4 R1A_SARS2 Papain-like protease

7sgu G FMT
FORMIC ACID[3 atoms] A 100.0
/99.7 3
/3 R1A_SARS2 Papain-like protease

8ufm B FMT
FORMIC ACID[3 atoms] A 100.0
/99.2 3
/3 R1A_SARS2 Papain-like protease nsp3

7ybg B DTT
2,3-DIHYDROXY-1,4-DITHIOBUTANE[8 atoms] A 100.0
/99.1 9
/9 R1A_SARS2 Papain-like protease nsp3

5y3q C BME
BETA-MERCAPTOETHANOL[4 atoms] A 100.0
/82.8 6
/6 R1A_CVHSA Replicase polyprotein 1a

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

Contact Molecules for Homologous Proteins

Full Bars[0.0 %]

UniProt Feature Tables [YP_009725299.1()]