Contact Molecules for Homologous Proteins | ||||
[Full Bars] |
[SiteTable] |
|
[Back to Search Page] |
[Back to HOMCOS] |
[SupCon3D] |
[help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
18767 | 967 | 46 | P15144(AMPN_HUMAN) | RecName: Full=Aminopeptidase N ; Short=AP-N; Short=hAPN; EC=3.4.11.2 ;AltName: Full=Alanyl aminopeptidase;AltName: Full=Aminopeptidase M; Short=AP-M;AltName: Full=Microsomal aminopeptidase;AltName: Full=Myeloid plasma membrane glycoprotein CD13;AltName: Full=gp150;AltName: CD_antigen=CD13; |
QUERYSEQ |
MAKGFYISKSLGILGILLGVAAVCTIIALSVVYSQEKNKNANSSPVASTTPSASATTNPASATTLDQSKAWNRYRLPNTLKPDSYRVTLRPYLTPNDRGLYVFKGSSTVRFTCKEATDVIIIHSKKLNYTLSQGHRVVLRGVGGSQPPDI DKTELVEPTEYLVVHLKGSLVKDSQYEMDSEFEGELADDLAGFYRSEYMEGNVRKVVATTQMQAADARKSFPCFDEPAMKAEFNITLIHPKDLTALSNMLPKGPSTPLPEDPNWNVTEFHTTPKMSTYLLAFIVSEFDYVEKQASNGVLI RIWARPSAIAAGHGDYALNVTGPILNFFAGHYDTPYPLPKSDQIGLPDFNAGAMENWGLVTYRENSLLFDPLSSSSSNKERVVTVIAHELAHQWFGNLVTIEWWNDLWLNEGFASYVEYLGADYAEPTWNLKDLMVLNDVYRVMAVDALA SSHPLSTPASEINTPAQISELFDAISYSKGASVLRMLSSFLSEDVFKQGLASYLHTFAYQNTIYLNLWDHLQEAVNNRSIQLPTTVRDIMNRWTLQMGFPVITVDTSTGTLSQEHFLLDPDSNVTRPSEFNYVWIVPITSIRDGRQQQDY WLIDVRAQNDLFSTSGNEWVLLNLNVTGYYRVNYDEENWRKIQTQLQRDHSAIPVINRAQIINDAFNLASAHKVPVTLALNNTLFLIEERQYMPWEAALSSLSYFKLMFDRSEVYGPMKNYLKKQVTPLFIHFRNNTNNWREIPENLMDQ YSEVNAISTACSNGVPECEEMVSGLFKQWMENPNNNPIHPNLRSTVYCNAIAQGGEEEWDFAWEQFRNATLVNEADKLRAALACSKELWILNRYLSYTLNPDLIRKQDATSTIISITNNVIGQGLVWDFVQSNWKKLFNDYGGGSFSFSN LIQAVTRRFSTEYELQQLEQFKKDNEETGFGSGTRALEQALEKTKANIKWVKENKEVVLQWFTENSK |
967 | region | name | description |
2-967 | CHAIN | /note="Aminopeptidase N" /id="PRO_0000095081" | |
2-8 | TOPO_DOM | /note="Cytoplasmic" | |
9-32 | TRANSMEM | /note="Helical; Signal-anchor for type II membrane protein" | |
33-967 | TOPO_DOM | /note="Extracellular" | |
33-68 | REGION | /note="Cytosolic Ser/Thr-rich junction" | |
40-62 | REGION | /note="Disordered" | |
69-967 | REGION | /note="Metalloprotease" | |
288-295 | REGION | /note="Necessary and sufficient to mediate interaction with HCoV-229E" ECO:0000269|PubMed:8887485" | |
389-389 | ACT_SITE | /note="Proton acceptor" ECO:0000269|PubMed:22932899" | |
352-356 | BINDING | /ligand="substrate" | |
388-388 | BINDING | /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_note="catalytic" ECO:0007744|PDB:4FYQ, ECO:0007744|PDB:4FYR, ECO:0007744|PDB:4FYT" | |
392-392 | BINDING | /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_note="catalytic" ECO:0007744|PDB:4FYQ, ECO:0007744|PDB:4FYR, ECO:0007744|PDB:4FYT" | |
411-411 | BINDING | /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_note="catalytic" ECO:0007744|PDB:4FYQ, ECO:0007744|PDB:4FYR, ECO:0007744|PDB:4FYT" | |
1-967 | DISORDER | predicted by DISOPRED |
MONOMER | |||||||
967 | |||||||
pdb_id | a1 | identity[%]2 | description | ||||
5lhd | C | 100.0 | AMPN_HUMAN Aminopeptidase N | ||||
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue. |
HETERO | |||||||
967 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
4fys[1] | B | ANGT_HUMAN Angiotensin IV[6 aa] | A | 100.0 /100.0 |
21 /21 |
AMPN_HUMAN Aminopeptidase N | |
4fyt[2] | B | AMASTATIN[4 aa] | A | 100.0 /100.0 |
17 /17 |
AMPN_HUMAN Aminopeptidase N | |
6atk[1] | E | SPIKE_CVH22 Spike glycoprotein[78 aa] | A | 100.0 /100.0 |
11 /11 |
AMPN_HUMAN Aminopeptidase N | |
6atk[1] | D | SPIKE_CVH22 Spike glycoprotein[134 aa] | B | 100.0 /100.0 |
11 /11 |
AMPN_HUMAN Aminopeptidase N | |
6atk[1] | F | SPIKE_CVH22 Spike glycoprotein[11 aa] | C | 100.0 /100.0 |
9 /9 |
AMPN_HUMAN Aminopeptidase N | |
6u7e[1] | C | Spike glycoprotein[109 aa] | A | 100.0 /100.0 |
13 /13 |
AMPN_HUMAN Aminopeptidase N | |
6u7e[1] | D | Spike glycoprotein[117 aa] | B | 100.0 /100.0 |
13 /13 |
AMPN_HUMAN Aminopeptidase N | |
6u7f[1] | C | Spike glycoprotein[96 aa] | A | 100.0 /100.0 |
14 /14 |
AMPN_HUMAN Aminopeptidase N | |
6u7f[1] | D | Spike glycoprotein[103 aa] | B | 100.0 /100.0 |
13 /13 |
AMPN_HUMAN Aminopeptidase N | |
6u7g[2] | C | H1AG31_CVH22 Spike protein[119 aa] | A | 100.0 /100.0 |
14 /14 |
AMPN_HUMAN Aminopeptidase N | |
7vpq[3] | B | A0A4P8D758_9NIDO Spike protein[103 aa] | A | 100.0 /100.0 |
24 /24 |
AMPN_HUMAN Aminopeptidase N | |
7vpp[1] | B | A0A4P8D758_9NIDO Spike protein[90 aa] | A | 77.3 /79.8 |
22 /22 |
K7GMF9_PIG Aminopeptidase | |
4f5c[2] | C | Q84852_9ALPC PRCV spike protein[146 aa] | A | 65.0 /79.7 |
20 /20 |
AMPN_PIG Aminopeptidase N | |
4hom[1] | B | substance P[11 aa] | A | 87.5 /79.8 |
32 /32 |
AMPN_PIG Aminopeptidase N | |
4ou3[2] | B | tumor-homing peptide[6 aa] | A | 93.3 /79.8 |
15 /15 |
AMPN_PIG Aminopeptidase N | |
4nz8[1] | B | CLEAVED poly-Ala[1 aa] | A | 100.0 /79.7 |
6 /6 |
AMPN_PIG Aminopeptidase N | |
4nz8[1] | C | CLEAVED poly-Ala[6 aa] | A | 78.6 /79.7 |
14 /14 |
AMPN_PIG Aminopeptidase N | |
4naq[1] | B | poly A peptide[7 aa] | A | 83.3 /79.6 |
18 /18 |
AMPN_PIG Aminopeptidase N | |
7u0l[1] | B | A0A8E6CMP0_9ALPC Spike glycoprotein[147 aa] | A | 47.4 /78.6 |
19 /19 |
AMPN_CANLF Aminopeptidase N | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
COMPOUND | |||||||
967 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
4f5c[8] | I |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 100.0 /79.7 |
3 /3 |
AMPN_PIG Aminopeptidase N | |
4f5c[16] | J |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 71.4 /79.7 |
7 /7 |
AMPN_PIG Aminopeptidase N | |
4f5c[4] | K |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 0.0 /79.7 |
1 /1 |
AMPN_PIG Aminopeptidase N | |
4f5c[6] | L |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 100.0 /79.7 |
2 /2 |
AMPN_PIG Aminopeptidase N | |
4f5c[23] | M |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 0.0 /79.7 |
1 /1 |
AMPN_PIG Aminopeptidase N | |
4f5c[12] | N |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 66.7 /79.7 |
3 /3 |
AMPN_PIG Aminopeptidase N | |
4f5c[7] | O |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 33.3 /79.7 |
3 /3 |
AMPN_PIG Aminopeptidase N | |
4f5c[2] | Q |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 100.0 /79.7 |
1 /1 |
AMPN_PIG Aminopeptidase N | |
4f5c[3] | CA |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
B | 50.0 /79.8 |
2 /2 |
AMPN_PIG Aminopeptidase N | |
4f5c[3] | V |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
B | 0.0 /79.8 |
1 /1 |
AMPN_PIG Aminopeptidase N | |
4fke[3] | K |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 50.0 /79.8 |
2 /2 |
AMPN_PIG Aminopeptidase N | |
4fke[15] | L |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 0.0 /79.8 |
2 /2 |
AMPN_PIG Aminopeptidase N | |
4fyq[7] | D |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 100.0 /100.0 |
5 /5 |
AMPN_HUMAN Aminopeptidase N | |
4fyq[10] | E |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 100.0 /100.0 |
6 /6 |
AMPN_HUMAN Aminopeptidase N | |
4fyq[17] | G |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 100.0 /100.0 |
4 /4 |
AMPN_HUMAN Aminopeptidase N | |
4fyq[10] | H |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 100.0 /100.0 |
5 /5 |
AMPN_HUMAN Aminopeptidase N | |
4fyq[9] | I |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 100.0 /100.0 |
3 /3 |
AMPN_HUMAN Aminopeptidase N | |
4fyr[3] | J |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 100.0 /100.0 |
2 /2 |
AMPN_HUMAN Aminopeptidase N | |
4hom[7] | L |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 50.0 /79.8 |
2 /2 |
AMPN_PIG Aminopeptidase N | |
4naq[2] | H |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 60.0 /79.6 |
5 /5 |
AMPN_PIG Aminopeptidase N | |
4naq[1] | I |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 66.7 /79.6 |
3 /3 |
AMPN_PIG Aminopeptidase N | |
4naq[2] | J |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 100.0 /79.6 |
4 /4 |
AMPN_PIG Aminopeptidase N | |
4nz8[1] | K |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 0.0 /79.7 |
1 /1 |
AMPN_PIG Aminopeptidase N | |
4ou3[2] | L |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 50.0 /79.8 |
2 /2 |
AMPN_PIG Aminopeptidase N | |
5lhd[4] | HA |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 100.0 /100.0 |
1 /1 |
AMPN_HUMAN Aminopeptidase N | |
5lhd[3] | IA |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 100.0 /100.0 |
2 /2 |
AMPN_HUMAN Aminopeptidase N | |
6atk[10] | L |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 100.0 /100.0 |
5 /5 |
AMPN_HUMAN Aminopeptidase N | |
6atk[1] | Q |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 100.0 /100.0 |
2 /2 |
AMPN_HUMAN Aminopeptidase N | |
6atk[2] | S |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
B | 100.0 /100.0 |
1 /1 |
AMPN_HUMAN Aminopeptidase N | |
6atk[3] | V |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
C | 100.0 /100.0 |
5 /5 |
AMPN_HUMAN Aminopeptidase N | |
6u7e[8] | R |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
B | 100.0 /100.0 |
5 /5 |
AMPN_HUMAN Aminopeptidase N | |
7u0l[1] | O |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 50.0 /78.6 |
2 /2 |
AMPN_CANLF Aminopeptidase N | |
7vpp[1] | R |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 50.0 /79.8 |
4 /4 |
K7GMF9_PIG Aminopeptidase | |
4fkk[1] | M |
BES
2-(3-AMINO-2-HYDROXY-4-PHENYL-BUTYRYLAMINO)-4-METH.. |
A | 100.0 /79.8 |
13 /13 |
AMPN_PIG Aminopeptidase N | |
4fyr[2] | L |
BES
2-(3-AMINO-2-HYDROXY-4-PHENYL-BUTYRYLAMINO)-4-METH.. |
A | 100.0 /100.0 |
15 /15 |
AMPN_HUMAN Aminopeptidase N | |
6bv0[1] | M |
ARG
ARGININE[12 atoms] |
A | 100.0 /79.8 |
10 /10 |
AMPN_PIG Aminopeptidase N | |
6bv1[1] | M |
ASP
ASPARTIC ACID[9 atoms] |
A | 100.0 /79.8 |
9 /9 |
AMPN_PIG Aminopeptidase N | |
6bv2[1] | M |
ILE
ISOLEUCINE[9 atoms] |
A | 100.0 /79.8 |
10 /10 |
AMPN_PIG Aminopeptidase N | |
6bv3[1] | M |
LEU
LEUCINE[9 atoms] |
A | 100.0 /79.8 |
9 /9 |
AMPN_PIG Aminopeptidase N | |
6bv4[1] | M |
MET
METHIONINE[9 atoms] |
A | 100.0 /79.8 |
10 /10 |
AMPN_PIG Aminopeptidase N | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
METAL | |||||||
967 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
3qnf[1] | E |
ZN
ZINC ION[1 atoms] |
A | 100.0 /40.4 |
4 /4 |
ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1 | |
4f5c[10] | H |
ZN
ZINC ION[1 atoms] |
A | 100.0 /79.7 |
4 /4 |
AMPN_PIG Aminopeptidase N | |
4fke[3] | M |
ZN
ZINC ION[1 atoms] |
A | 100.0 /79.8 |
3 /3 |
AMPN_PIG Aminopeptidase N | |
4fyq[9] | J |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
AMPN_HUMAN Aminopeptidase N | |
4hom[9] | N |
ZN
ZINC ION[1 atoms] |
A | 100.0 /79.8 |
3 /3 |
AMPN_PIG Aminopeptidase N | |
5lhd[4] | JA |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
3 /3 |
AMPN_HUMAN Aminopeptidase N | |
5z65[1] | K |
ZN
ZINC ION[1 atoms] |
A | 100.0 /79.8 |
5 /5 |
K7GMF9_PIG Aminopeptidase | |
6atk[5] | P |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
AMPN_HUMAN Aminopeptidase N | |
6u7e[9] | I |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
AMPN_HUMAN Aminopeptidase N | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
OTHERPOLY | |||||||
967 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
4f5c[7] | E | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | A | 71.4 /79.7 |
7 /7 |
AMPN_PIG Aminopeptidase N | |
4fke[17] | D | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | A | 83.3 /79.8 |
6 /6 |
AMPN_PIG Aminopeptidase N | |
4fke[3] | E | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | A | 66.7 /79.8 |
3 /3 |
AMPN_PIG Aminopeptidase N | |
4fke[3] | G | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | A | 80.0 /79.8 |
5 /5 |
AMPN_PIG Aminopeptidase N | |
4fke[3] | H | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | A | 50.0 /79.8 |
4 /4 |
AMPN_PIG Aminopeptidase N | |
4fke[3] | I | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | A | 0.0 /79.8 |
1 /1 |
AMPN_PIG Aminopeptidase N | |
4fke[19] | J | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | A | 66.7 /79.8 |
6 /6 |
AMPN_PIG Aminopeptidase N | |
4fyt[2] | E | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | A | 100.0 /100.0 |
4 /4 |
AMPN_HUMAN Aminopeptidase N | |
4hom[9] | F | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | A | 66.7 /79.8 |
3 /3 |
AMPN_PIG Aminopeptidase N | |
4hom[9] | H | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | A | 0.0 /79.8 |
1 /1 |
AMPN_PIG Aminopeptidase N | |
4hom[9] | I | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | A | 80.0 /79.8 |
5 /5 |
AMPN_PIG Aminopeptidase N | |
4hom[7] | J | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | A | 33.3 /79.8 |
3 /3 |
AMPN_PIG Aminopeptidase N | |
4naq[2] | C | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | A | 50.0 /79.6 |
4 /4 |
AMPN_PIG Aminopeptidase N | |
4naq[1] | D | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | A | 0.0 /79.6 |
1 /1 |
AMPN_PIG Aminopeptidase N | |
4naq[2] | F | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | A | 80.0 /79.6 |
5 /5 |
AMPN_PIG Aminopeptidase N | |
4naq[2] | G | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | A | 60.0 /79.6 |
5 /5 |
AMPN_PIG Aminopeptidase N | |
4nz8[1] | F | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | A | 75.0 /79.7 |
4 /4 |
AMPN_PIG Aminopeptidase N | |
4ou3[2] | C | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | A | 33.3 /79.8 |
3 /3 |
AMPN_PIG Aminopeptidase N | |
4ou3[2] | D | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | A | 60.0 /79.8 |
5 /5 |
AMPN_PIG Aminopeptidase N | |
4ou3[2] | G | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | A | 100.0 /79.8 |
4 /4 |
AMPN_PIG Aminopeptidase N | |
5lds[4] | F | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | A | 83.3 /79.8 |
6 /6 |
AMPN_PIG Aminopeptidase N | |
5lds[6] | G | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | A | 75.0 /79.8 |
4 /4 |
AMPN_PIG Aminopeptidase N | |
5lds[2] | N | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | D | 80.0 /79.8 |
5 /5 |
AMPN_PIG Aminopeptidase N | |
5lds[2] | S | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | D | 33.3 /79.8 |
3 /3 |
AMPN_PIG Aminopeptidase N | |
5lhd[2] | G | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | A | 100.0 /100.0 |
6 /6 |
AMPN_HUMAN Aminopeptidase N | |
5lhd[3] | I | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | A | 100.0 /100.0 |
5 /5 |
AMPN_HUMAN Aminopeptidase N | |
5lhd[1] | N | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | B | 100.0 /100.0 |
3 /3 |
AMPN_HUMAN Aminopeptidase N | |
5lhd[3] | Q | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | B | 100.0 /100.0 |
3 /3 |
AMPN_HUMAN Aminopeptidase N | |
5lhd[2] | V | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | C | 100.0 /100.0 |
1 /1 |
AMPN_HUMAN Aminopeptidase N | |
5lhd[1] | GA | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | D | 100.0 /100.0 |
2 /2 |
AMPN_HUMAN Aminopeptidase N | |
5z65[1] | E | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | A | 75.0 /79.8 |
4 /4 |
K7GMF9_PIG Aminopeptidase | |
5z65[1] | F | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | A | 100.0 /79.8 |
2 /2 |
K7GMF9_PIG Aminopeptidase | |
5z65[1] | G | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | A | 100.0 /79.8 |
4 /4 |
K7GMF9_PIG Aminopeptidase | |
5z65[1] | H | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | A | 50.0 /79.8 |
2 /2 |
K7GMF9_PIG Aminopeptidase | |
5z65[12] | I | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | A | 100.0 /79.8 |
2 /2 |
K7GMF9_PIG Aminopeptidase | |
6atk[12] | G | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | A | 100.0 /100.0 |
6 /6 |
AMPN_HUMAN Aminopeptidase N | |
7u0l[1] | G | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | A | 60.0 /78.6 |
5 /5 |
AMPN_CANLF Aminopeptidase N | |
7u0l[1] | K | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | A | 66.7 /78.6 |
6 /6 |
AMPN_CANLF Aminopeptidase N | |
7vpp[2] | F | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | A | 100.0 /79.8 |
4 /4 |
K7GMF9_PIG Aminopeptidase | |
7vpp[2] | G | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | A | 66.7 /79.8 |
3 /3 |
K7GMF9_PIG Aminopeptidase | |
7vpp[1] | H | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | A | 60.0 /79.8 |
5 /5 |
K7GMF9_PIG Aminopeptidase | |
7vpp[1] | M | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | C | 66.7 /79.9 |
3 /3 |
K7GMF9_PIG Aminopeptidase | |
5lds[1] | E | beta-D-mannopyranose-(1-3)-beta-D-mannopyranose-(1.. | A | 0.0 /79.8 |
2 /2 |
AMPN_PIG Aminopeptidase N | |
5lhd[1] | W | beta-D-mannopyranose-(1-3)-beta-D-mannopyranose-(1.. | C | 100.0 /100.0 |
5 /5 |
AMPN_HUMAN Aminopeptidase N | |
5lhd[1] | AA | beta-D-mannopyranose-(1-3)-beta-D-mannopyranose-(1.. | D | 100.0 /100.0 |
7 /7 |
AMPN_HUMAN Aminopeptidase N | |
5lds[2] | O | beta-D-mannopyranose-(1-3)-beta-D-mannopyranose-(1.. | D | 50.0 /79.8 |
2 /2 |
AMPN_PIG Aminopeptidase N | |
5lhd[1] | T | beta-D-mannopyranose-(1-3)-beta-D-mannopyranose-(1.. | C | 100.0 /100.0 |
5 /5 |
AMPN_HUMAN Aminopeptidase N | |
5lhd[3] | E | beta-D-mannopyranose-(1-6)-beta-D-mannopyranose-(1.. | A | 100.0 /100.0 |
6 /6 |
AMPN_HUMAN Aminopeptidase N | |
5lhd[1] | J | beta-D-mannopyranose-(1-6)-beta-D-mannopyranose-(1.. | A | 100.0 /100.0 |
6 /6 |
AMPN_HUMAN Aminopeptidase N | |
5lhd[3] | F | beta-D-mannopyranose-(1-3)-[beta-D-mannopyranose-(.. | A | 100.0 /100.0 |
6 /6 |
AMPN_HUMAN Aminopeptidase N | |
5lhd[1] | Y | beta-D-mannopyranose-(1-3)-[beta-D-mannopyranose-(.. | C | 100.0 /100.0 |
2 /2 |
AMPN_HUMAN Aminopeptidase N | |
7vpp[1] | L | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-3)-2-a.. | C | 75.0 /79.9 |
4 /4 |
K7GMF9_PIG Aminopeptidase | |
7vpq[1] | I | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-3)-2-a.. | C | 100.0 /100.0 |
3 /3 |
AMPN_HUMAN Aminopeptidase N | |
4fke[3] | B | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | A | 50.0 /79.8 |
4 /4 |
AMPN_PIG Aminopeptidase N | |
4fke[11] | C | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | A | 60.0 /79.8 |
5 /5 |
AMPN_PIG Aminopeptidase N | |
4fke[3] | F | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | A | 100.0 /79.8 |
5 /5 |
AMPN_PIG Aminopeptidase N | |
4hom[7] | C | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | A | 60.0 /79.8 |
5 /5 |
AMPN_PIG Aminopeptidase N | |
4hom[7] | G | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | A | 100.0 /79.8 |
5 /5 |
AMPN_PIG Aminopeptidase N | |
5z65[1] | B | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | A | 50.0 /79.8 |
4 /4 |
K7GMF9_PIG Aminopeptidase | |
4fyq[5] | B | beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. | A | 100.0 /100.0 |
7 /7 |
AMPN_HUMAN Aminopeptidase N | |
5lhd[3] | H | beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. | A | 100.0 /100.0 |
2 /2 |
AMPN_HUMAN Aminopeptidase N | |
5lhd[1] | O | beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. | B | 100.0 /100.0 |
1 /1 |
AMPN_HUMAN Aminopeptidase N | |
5lhd[1] | BA | beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. | D | 100.0 /100.0 |
5 /5 |
AMPN_HUMAN Aminopeptidase N | |
5lhd[1] | Z | beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. | D | 100.0 /100.0 |
6 /6 |
AMPN_HUMAN Aminopeptidase N | |
6u7e[1] | F | beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. | A | 100.0 /100.0 |
5 /5 |
AMPN_HUMAN Aminopeptidase N | |
6u7e[1] | G | beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. | B | 100.0 /100.0 |
6 /6 |
AMPN_HUMAN Aminopeptidase N | |
7u0l[1] | F | beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. | A | 100.0 /78.6 |
2 /2 |
AMPN_CANLF Aminopeptidase N | |
7u0l[1] | I | beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. | A | 83.3 /78.6 |
6 /6 |
AMPN_CANLF Aminopeptidase N | |
7u0l[1] | C | alpha-D-mannopyranose-(1-3)-beta-D-galactopyranose.. | A | 66.7 /78.6 |
6 /6 |
AMPN_CANLF Aminopeptidase N | |
7u0l[1] | D | alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose.. | A | 100.0 /78.6 |
2 /2 |
AMPN_CANLF Aminopeptidase N | |
7u0l[1] | E | alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose.. | A | 33.3 /78.6 |
3 /3 |
AMPN_CANLF Aminopeptidase N | |
7u0l[1] | H | alpha-D-mannopyranose-(1-6)-alpha-D-mannopyranose-.. | A | 77.8 /78.6 |
9 /9 |
AMPN_CANLF Aminopeptidase N | |
7u0l[1] | J | alpha-D-mannopyranose-(1-6)-beta-D-mannopyranose-(.. | A | 60.0 /78.6 |
5 /5 |
AMPN_CANLF Aminopeptidase N | |
3qnf[1] | D | alpha-D-mannopyranose-(1-6)-alpha-D-mannopyranose-.. | A | 16.7 /40.4 |
6 /8 |
ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1 | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
HOMO | |||||||
967 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
4fyq[6] | A | AMPN_HUMAN Aminopeptidase N[892 aa] | A | 100.0 /100.0 |
20 /20 |
AMPN_HUMAN Aminopeptidase N | |
4ou3[2] | A | AMPN_PIG Aminopeptidase N[902 aa] | A | 81.0 /79.8 |
21 /21 |
AMPN_PIG Aminopeptidase N | |
5lds[6] | B | AMPN_PIG Aminopeptidase N[898 aa] | A | 78.9 /79.8 |
19 /19 |
AMPN_PIG Aminopeptidase N | |
7vpp[2] | C | K7GMF9_PIG Aminopeptidase[898 aa] | A | 83.3 /79.8 |
18 /18 |
K7GMF9_PIG Aminopeptidase | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
PRECIPITANT | |||||||
967 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
4fyq[2] | V |
ACY
ACETIC ACID[4 atoms] |
A | 100.0 /100.0 |
7 /7 |
AMPN_HUMAN Aminopeptidase N | |
4fyr[2] | W |
ACY
ACETIC ACID[4 atoms] |
A | 100.0 /100.0 |
1 /1 |
AMPN_HUMAN Aminopeptidase N | |
5lhd[4] | AB |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
8 /8 |
AMPN_HUMAN Aminopeptidase N | |
5lhd[1] | KA |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
4 /4 |
AMPN_HUMAN Aminopeptidase N | |
5lhd[1] | LA |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
4 /4 |
AMPN_HUMAN Aminopeptidase N | |
5lhd[5] | MA |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
6 /6 |
AMPN_HUMAN Aminopeptidase N | |
5lhd[3] | OA |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
7 /7 |
AMPN_HUMAN Aminopeptidase N | |
5lhd[1] | PA |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
7 /7 |
AMPN_HUMAN Aminopeptidase N | |
5lhd[2] | QA |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
5 /5 |
AMPN_HUMAN Aminopeptidase N | |
5lhd[2] | RA |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
5 /5 |
AMPN_HUMAN Aminopeptidase N | |
5lhd[1] | SA |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
4 /4 |
AMPN_HUMAN Aminopeptidase N | |
5lhd[2] | UA |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
6 /6 |
AMPN_HUMAN Aminopeptidase N | |
5lhd[1] | VA |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
5 /5 |
AMPN_HUMAN Aminopeptidase N | |
5lhd[1] | WA |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
4 /4 |
AMPN_HUMAN Aminopeptidase N | |
5lhd[1] | XA |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
5 /5 |
AMPN_HUMAN Aminopeptidase N | |
5lhd[1] | YA |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
3 /3 |
AMPN_HUMAN Aminopeptidase N | |
5lhd[1] | DB |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
2 /2 |
AMPN_HUMAN Aminopeptidase N | |
5lhd[1] | EB |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
2 /2 |
AMPN_HUMAN Aminopeptidase N | |
5lhd[1] | FB |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
8 /8 |
AMPN_HUMAN Aminopeptidase N | |
5lhd[2] | HB |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
6 /6 |
AMPN_HUMAN Aminopeptidase N | |
5lhd[1] | JB |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
3 /3 |
AMPN_HUMAN Aminopeptidase N | |
5lhd[1] | KB |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
4 /4 |
AMPN_HUMAN Aminopeptidase N | |
5lhd[1] | LB |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
7 /7 |
AMPN_HUMAN Aminopeptidase N | |
5lhd[1] | NB |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
7 /7 |
AMPN_HUMAN Aminopeptidase N | |
5lhd[3] | AC |
EDO
1,2-ETHANEDIOL[4 atoms] |
C | 100.0 /100.0 |
6 /6 |
AMPN_HUMAN Aminopeptidase N | |
5lhd[1] | BC |
EDO
1,2-ETHANEDIOL[4 atoms] |
C | 100.0 /100.0 |
3 /3 |
AMPN_HUMAN Aminopeptidase N | |
5lhd[1] | CC |
EDO
1,2-ETHANEDIOL[4 atoms] |
C | 100.0 /100.0 |
8 /8 |
AMPN_HUMAN Aminopeptidase N | |
5lhd[1] | SB |
EDO
1,2-ETHANEDIOL[4 atoms] |
C | 100.0 /100.0 |
5 /5 |
AMPN_HUMAN Aminopeptidase N | |
5lhd[1] | XB |
EDO
1,2-ETHANEDIOL[4 atoms] |
C | 100.0 /100.0 |
4 /4 |
AMPN_HUMAN Aminopeptidase N | |
5lhd[1] | YB |
EDO
1,2-ETHANEDIOL[4 atoms] |
C | 100.0 /100.0 |
6 /6 |
AMPN_HUMAN Aminopeptidase N | |
5lhd[2] | ZB |
EDO
1,2-ETHANEDIOL[4 atoms] |
C | 100.0 /100.0 |
4 /4 |
AMPN_HUMAN Aminopeptidase N | |
5lhd[1] | KC |
EDO
1,2-ETHANEDIOL[4 atoms] |
D | 100.0 /100.0 |
5 /5 |
AMPN_HUMAN Aminopeptidase N | |
7vpp[2] | O |
GOL
GLYCEROL[6 atoms] |
A | 100.0 /79.8 |
7 /7 |
K7GMF9_PIG Aminopeptidase | |
7vpp[1] | P |
GOL
GLYCEROL[6 atoms] |
A | 100.0 /79.8 |
2 /2 |
K7GMF9_PIG Aminopeptidase | |
7vpp[1] | Q |
GOL
GLYCEROL[6 atoms] |
A | 100.0 /79.8 |
4 /4 |
K7GMF9_PIG Aminopeptidase | |
7vpp[1] | W |
GOL
GLYCEROL[6 atoms] |
C | 25.0 /79.9 |
4 /4 |
K7GMF9_PIG Aminopeptidase | |
7vpq[3] | S |
GOL
GLYCEROL[6 atoms] |
A | 100.0 /100.0 |
6 /6 |
AMPN_HUMAN Aminopeptidase N | |
5lds[6] | X |
ACT
ACETATE ION[4 atoms] |
A | 100.0 /79.8 |
7 /7 |
AMPN_PIG Aminopeptidase N | |
4fkh[1] | M |
ALA
ALANINE[6 atoms] |
A | 100.0 /79.8 |
7 /7 |
AMPN_PIG Aminopeptidase N | |
4fyq[21] | K |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /100.0 |
6 /6 |
AMPN_HUMAN Aminopeptidase N | |
4fyq[7] | M |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /100.0 |
1 /1 |
AMPN_HUMAN Aminopeptidase N | |
4fyq[14] | N |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /100.0 |
2 /2 |
AMPN_HUMAN Aminopeptidase N | |
4fyq[9] | O |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /100.0 |
4 /4 |
AMPN_HUMAN Aminopeptidase N | |
4fyq[6] | R |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /100.0 |
3 /3 |
AMPN_HUMAN Aminopeptidase N | |
4fyq[6] | R |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /100.0 |
2 /2 |
AMPN_HUMAN Aminopeptidase N | |
4fyq[7] | S |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /100.0 |
4 /4 |
AMPN_HUMAN Aminopeptidase N | |
4fyq[5] | T |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /100.0 |
4 /4 |
AMPN_HUMAN Aminopeptidase N | |
4fyq[5] | U |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /100.0 |
3 /3 |
AMPN_HUMAN Aminopeptidase N | |
4fyr[5] | V |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /100.0 |
3 /3 |
AMPN_HUMAN Aminopeptidase N | |
4naq[10] | M |
SO4
SULFATE ION[5 atoms] |
A | 83.3 /79.6 |
6 /6 |
AMPN_PIG Aminopeptidase N | |
4naq[2] | N |
SO4
SULFATE ION[5 atoms] |
A | 66.7 /79.6 |
3 /3 |
AMPN_PIG Aminopeptidase N | |
4naq[14] | O |
SO4
SULFATE ION[5 atoms] |
A | 75.0 /79.6 |
4 /4 |
AMPN_PIG Aminopeptidase N | |
4naq[2] | P |
SO4
SULFATE ION[5 atoms] |
A | 50.0 /79.6 |
4 /4 |
AMPN_PIG Aminopeptidase N | |
4naq[1] | Q |
SO4
SULFATE ION[5 atoms] |
A | 83.3 /79.6 |
6 /6 |
AMPN_PIG Aminopeptidase N | |
4naq[2] | R |
SO4
SULFATE ION[5 atoms] |
A | 80.0 /79.6 |
5 /5 |
AMPN_PIG Aminopeptidase N | |
4naq[1] | T |
SO4
SULFATE ION[5 atoms] |
A | 50.0 /79.6 |
2 /2 |
AMPN_PIG Aminopeptidase N | |
4naq[2] | U |
SO4
SULFATE ION[5 atoms] |
A | 87.5 /79.6 |
8 /8 |
AMPN_PIG Aminopeptidase N | |
4naq[5] | V |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /79.6 |
7 /7 |
AMPN_PIG Aminopeptidase N | |
4naq[3] | W |
SO4
SULFATE ION[5 atoms] |
A | 75.0 /79.6 |
4 /4 |
AMPN_PIG Aminopeptidase N | |
4nz8[3] | P |
SO4
SULFATE ION[5 atoms] |
A | 50.0 /79.7 |
2 /2 |
AMPN_PIG Aminopeptidase N | |
4ou3[8] | N |
SO4
SULFATE ION[5 atoms] |
A | 80.0 /79.8 |
5 /5 |
AMPN_PIG Aminopeptidase N | |
4ou3[8] | O |
SO4
SULFATE ION[5 atoms] |
A | 50.0 /79.8 |
2 /2 |
AMPN_PIG Aminopeptidase N | |
4ou3[2] | R |
SO4
SULFATE ION[5 atoms] |
A | 66.7 /79.8 |
3 /3 |
AMPN_PIG Aminopeptidase N | |
4ou3[3] | T |
SO4
SULFATE ION[5 atoms] |
A | 66.7 /79.8 |
3 /3 |
AMPN_PIG Aminopeptidase N | |
4ou3[8] | V |
SO4
SULFATE ION[5 atoms] |
A | 87.5 /79.8 |
8 /8 |
AMPN_PIG Aminopeptidase N | |
6buy[6] | O |
SO4
SULFATE ION[5 atoms] |
A | 83.3 /79.8 |
6 /6 |
AMPN_PIG Aminopeptidase N | |
6buy[6] | P |
SO4
SULFATE ION[5 atoms] |
A | 80.0 /79.8 |
5 /5 |
AMPN_PIG Aminopeptidase N | |
6buy[6] | T |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /79.8 |
4 /4 |
AMPN_PIG Aminopeptidase N | |
6buy[6] | V |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /79.8 |
4 /4 |
AMPN_PIG Aminopeptidase N | |
6buy[6] | W |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /79.8 |
2 /2 |
AMPN_PIG Aminopeptidase N | |
6buy[1] | M |
GLY
GLYCINE[5 atoms] |
A | 100.0 /79.8 |
7 /7 |
AMPN_PIG Aminopeptidase N | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. |