HOMCOS(prot_sch_conbars.cgi):

		Contact Molecules for Homologous Proteins
[Full Bars]	[SiteTable]	Summary Bars[100 %]	[Back to Search Page]	[Back to HOMCOS]
[SupCon3D]	[help]	seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]	[show] [download] [help]

PID

QueryLength

Homolgous Sequence in PDB

UniProt Query

TITLE

2692367

631

P17405(ASM_HUMAN)

RecName: Full=Sphingomyelin phosphodiesterase ; EC=3.1.4.12 ; EC=3.1.4.3 ;AltName: Full=Acid sphingomyelinase ; Short=aSMase;Contains: RecName: Full=Sphingomyelin phosphodiesterase, processed form ;Flags: Precursor;

QUERYSEQ

MPRYGASLRQSCPRSGREQGQDGTAGAPGLLWMGLVLALALALALALALSDSRVLWAPAEAHPLSPQGHPARLHRIVPRLRDVFGWGNLTCPICKGLFTAINLGLKKEPNVARVGSVAIKLCNLLKIAPPAVCQSIVHLFEDDMVEVWRR
SVLSPSEACGLLLGSTCGHWDIFSSWNISLPTVPKPPPKPPSPPAPGAPVSRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGEYSKCDLPLRTLESLLSGLGPAGPFDMVYWTGDIPAHDVWHQTRQDQLRALTT
VTALVRKFLGPVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGGFYALSPYPGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGDKVHIIGHIPPGHCLKSWSWNYYRIVARYEN
TLAAQFFGHTHVDEFEVFYDEETLSRPLAVAFLAPSATTYIGLNPGYRVYQIDGNYSGSSHVVLDHETYILNLTQANIPGAIPHWQLLYRARETYGLPNTLPTAWHNLVYRMRGDMQLFQTFWFLYHKGHPPSEPCGTPCRLATLCAQLS
ARADSPALCRHLMPDGSLPEAQSLWPRPLFC

[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [P17405(ASM_HUMAN)]

631
	region	name	description
	1-46	SIGNAL
	47-631	CHAIN	/note="Sphingomyelin phosphodiesterase" /id="PRO_0000002323"
	254-631	CHAIN	/note="Sphingomyelin phosphodiesterase, processed form" /id="PRO_0000456684"
	87-171	DOMAIN	/note="Saposin B-type"
	1-23	REGION	/note="Disordered"
	208-208	BINDING	/ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="1" ECO:0007744\|PDB:5I81, ECO:0007744\|PDB:5I85, ECO:0007744\|PDB:5I8R, ECO:0007744\|PDB:5JG8"
	210-210	BINDING	/ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="1" ECO:0007744\|PDB:5I81, ECO:0007744\|PDB:5I85, ECO:0007744\|PDB:5I8R, ECO:0007744\|PDB:5JG8"
	280-280	BINDING	/ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="1" ECO:0007744\|PDB:5I81, ECO:0007744\|PDB:5I85, ECO:0007744\|PDB:5I8R, ECO:0007744\|PDB:5JG8"
	280-280	BINDING	/ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="2" ECO:0007744\|PDB:5I81, ECO:0007744\|PDB:5I85, ECO:0007744\|PDB:5I8R, ECO:0007744\|PDB:5JG8"
	320-320	BINDING	/ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="2" ECO:0007744\|PDB:5I81, ECO:0007744\|PDB:5I85, ECO:0007744\|PDB:5I8R, ECO:0007744\|PDB:5JG8"
	427-427	BINDING	/ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="2" ECO:0007744\|PDB:5I81, ECO:0007744\|PDB:5I85, ECO:0007744\|PDB:5I8R, ECO:0007744\|PDB:5JG8"
	459-459	BINDING	/ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="2" ECO:0007744\|PDB:5I81, ECO:0007744\|PDB:5I85, ECO:0007744\|PDB:5I8R, ECO:0007744\|PDB:5JG8"
	461-461	BINDING	/ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="1" ECO:0007744\|PDB:5I81, ECO:0007744\|PDB:5I85, ECO:0007744\|PDB:5I8R, ECO:0007744\|PDB:5JG8"
	1-196	DISORDER	predicted by DISOPRED

MONOMER

631

pdb_id a¹ identity[%]² description

5jg8 B 100.0 ASM_HUMAN Sphingomyelin phosphodiesterase

1.a¹:asym_id for the homologue. 2.identity[%]²:sequence identity between the query and the homologue.

COMPOUND

631 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

5i81[11] E NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. A 100.0
/100.0 1
/1 ASM_HUMAN Sphingomyelin phosphodiesterase

5i81[2] E NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. A 100.0
/100.0 2
/2 ASM_HUMAN Sphingomyelin phosphodiesterase

5i81[9] F NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. A 100.0
/100.0 3
/3 ASM_HUMAN Sphingomyelin phosphodiesterase

5i81[9] H NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. A 100.0
/100.0 2
/2 ASM_HUMAN Sphingomyelin phosphodiesterase

5i81[3] J NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. A 100.0
/100.0 6
/6 ASM_HUMAN Sphingomyelin phosphodiesterase

5i8r[1] BA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. C 100.0
/100.0 1
/1 ASM_HUMAN Sphingomyelin phosphodiesterase

5jg8[2] N NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. A 100.0
/100.0 5
/5 ASM_HUMAN Sphingomyelin phosphodiesterase

5jg8[1] O NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. A 100.0
/100.0 2
/2 ASM_HUMAN Sphingomyelin phosphodiesterase

5jg8[2] S NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. A 100.0
/100.0 1
/1 ASM_HUMAN Sphingomyelin phosphodiesterase

5i85[4] U PC
PHOSPHOCHOLINE[11 atoms] A 100.0
/100.0 9
/9 ASM_HUMAN Sphingomyelin phosphodiesterase

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

METAL

631 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

5i81[18] L ZN
ZINC ION[1 atoms] A 100.0
/100.0 5
/5 ASM_HUMAN Sphingomyelin phosphodiesterase

5jg8[4] J ZN
ZINC ION[1 atoms] A 100.0
/100.0 4
/4 ASM_HUMAN Sphingomyelin phosphodiesterase

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

OTHERPOLY

631 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

5i81[4] B 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/100.0 5
/5 ASM_HUMAN Sphingomyelin phosphodiesterase

5i85[5] D 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/100.0 7
/7 ASM_HUMAN Sphingomyelin phosphodiesterase

5i8r[2] E 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/100.0 2
/2 ASM_HUMAN Sphingomyelin phosphodiesterase

5jg8[1] C 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/100.0 5
/5 ASM_HUMAN Sphingomyelin phosphodiesterase

5jg8[2] D 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/100.0 3
/3 ASM_HUMAN Sphingomyelin phosphodiesterase

5jg8[1] H 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 100.0
/100.0 2
/2 ASM_HUMAN Sphingomyelin phosphodiesterase

5i81[2] C beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 100.0
/100.0 3
/3 ASM_HUMAN Sphingomyelin phosphodiesterase

5i85[4] B beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 100.0
/100.0 3
/3 ASM_HUMAN Sphingomyelin phosphodiesterase

5i8r[1] H beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. B 100.0
/100.0 4
/4 ASM_HUMAN Sphingomyelin phosphodiesterase

5i81[2] D beta-D-mannopyranose-(1-3)-alpha-D-mannopyranose A 100.0
/100.0 3
/3 ASM_HUMAN Sphingomyelin phosphodiesterase

5i85[4] C alpha-D-mannopyranose-(1-3)-alpha-D-mannopyranose-.. A 100.0
/100.0 7
/7 ASM_HUMAN Sphingomyelin phosphodiesterase

5jg8[1] E 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-3)-2-a.. A 100.0
/100.0 4
/4 ASM_HUMAN Sphingomyelin phosphodiesterase

5jg8[1] F alpha-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-be.. B 100.0
/100.0 6
/6 ASM_HUMAN Sphingomyelin phosphodiesterase

5jg8[1] G alpha-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-be.. B 100.0
/100.0 5
/5 ASM_HUMAN Sphingomyelin phosphodiesterase

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

HOMO

631 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

5i81[4] A ASM_HUMAN Sphingomyelin phosphodiesterase[528 aa] A 100.0
/100.0 28
/28 ASM_HUMAN Sphingomyelin phosphodiesterase

5i85[4] A ASM_HUMAN Sphingomyelin phosphodiesterase[528 aa] A 100.0
/100.0 9
/9 ASM_HUMAN Sphingomyelin phosphodiesterase

5i85[4] A ASM_HUMAN Sphingomyelin phosphodiesterase[528 aa] A 100.0
/100.0 11
/11 ASM_HUMAN Sphingomyelin phosphodiesterase

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

PRECIPITANT

631 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

5i81[6] N SO4
SULFATE ION[5 atoms] A 100.0
/100.0 2
/2 ASM_HUMAN Sphingomyelin phosphodiesterase

5i81[8] O SO4
SULFATE ION[5 atoms] A 100.0
/100.0 2
/2 ASM_HUMAN Sphingomyelin phosphodiesterase

5i81[6] P SO4
SULFATE ION[5 atoms] A 100.0
/100.0 3
/3 ASM_HUMAN Sphingomyelin phosphodiesterase

5i81[6] Q SO4
SULFATE ION[5 atoms] A 100.0
/100.0 2
/2 ASM_HUMAN Sphingomyelin phosphodiesterase

5i81[6] R SO4
SULFATE ION[5 atoms] A 100.0
/100.0 5
/5 ASM_HUMAN Sphingomyelin phosphodiesterase

5i81[2] S SO4
SULFATE ION[5 atoms] A 100.0
/100.0 2
/2 ASM_HUMAN Sphingomyelin phosphodiesterase

5i81[6] T SO4
SULFATE ION[5 atoms] A 100.0
/100.0 6
/6 ASM_HUMAN Sphingomyelin phosphodiesterase

5i81[6] U SO4
SULFATE ION[5 atoms] A 100.0
/100.0 3
/3 ASM_HUMAN Sphingomyelin phosphodiesterase

5i81[2] V SO4
SULFATE ION[5 atoms] A 100.0
/100.0 3
/3 ASM_HUMAN Sphingomyelin phosphodiesterase

5i81[12] W SO4
SULFATE ION[5 atoms] A 100.0
/100.0 4
/4 ASM_HUMAN Sphingomyelin phosphodiesterase

5i85[4] P SO4
SULFATE ION[5 atoms] A 100.0
/100.0 2
/2 ASM_HUMAN Sphingomyelin phosphodiesterase

5i85[4] S SO4
SULFATE ION[5 atoms] A 100.0
/100.0 1
/1 ASM_HUMAN Sphingomyelin phosphodiesterase

5i85[4] T SO4
SULFATE ION[5 atoms] A 100.0
/100.0 3
/3 ASM_HUMAN Sphingomyelin phosphodiesterase

5jg8[2] L ACT
ACETATE ION[4 atoms] A 100.0
/100.0 7
/7 ASM_HUMAN Sphingomyelin phosphodiesterase

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

MONOMER
631
	pdb_id	a¹	identity[%]²	description
	5jg8	B	100.0	ASM_HUMAN Sphingomyelin phosphodiesterase
	1.a¹:asym_id for the homologue. 2.identity[%]²:sequence identity between the query and the homologue.

COMPOUND
631	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	5i81[11]	E	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..	A	100.0 /100.0	1 /1	ASM_HUMAN Sphingomyelin phosphodiesterase
	5i81[2]	E	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..	A	100.0 /100.0	2 /2	ASM_HUMAN Sphingomyelin phosphodiesterase
	5i81[9]	F	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..	A	100.0 /100.0	3 /3	ASM_HUMAN Sphingomyelin phosphodiesterase
	5i81[9]	H	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..	A	100.0 /100.0	2 /2	ASM_HUMAN Sphingomyelin phosphodiesterase
	5i81[3]	J	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..	A	100.0 /100.0	6 /6	ASM_HUMAN Sphingomyelin phosphodiesterase
	5i8r[1]	BA	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..	C	100.0 /100.0	1 /1	ASM_HUMAN Sphingomyelin phosphodiesterase
	5jg8[2]	N	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..	A	100.0 /100.0	5 /5	ASM_HUMAN Sphingomyelin phosphodiesterase
	5jg8[1]	O	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..	A	100.0 /100.0	2 /2	ASM_HUMAN Sphingomyelin phosphodiesterase
	5jg8[2]	S	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..	A	100.0 /100.0	1 /1	ASM_HUMAN Sphingomyelin phosphodiesterase
	5i85[4]	U	PC PHOSPHOCHOLINE[11 atoms]	A	100.0 /100.0	9 /9	ASM_HUMAN Sphingomyelin phosphodiesterase
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
METAL
631	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	5i81[18]	L	ZN ZINC ION[1 atoms]	A	100.0 /100.0	5 /5	ASM_HUMAN Sphingomyelin phosphodiesterase
	5jg8[4]	J	ZN ZINC ION[1 atoms]	A	100.0 /100.0	4 /4	ASM_HUMAN Sphingomyelin phosphodiesterase
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
OTHERPOLY
631	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	5i81[4]	B	2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a..	A	100.0 /100.0	5 /5	ASM_HUMAN Sphingomyelin phosphodiesterase
	5i85[5]	D	2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a..	A	100.0 /100.0	7 /7	ASM_HUMAN Sphingomyelin phosphodiesterase
	5i8r[2]	E	2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a..	A	100.0 /100.0	2 /2	ASM_HUMAN Sphingomyelin phosphodiesterase
	5jg8[1]	C	2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a..	A	100.0 /100.0	5 /5	ASM_HUMAN Sphingomyelin phosphodiesterase
	5jg8[2]	D	2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a..	A	100.0 /100.0	3 /3	ASM_HUMAN Sphingomyelin phosphodiesterase
	5jg8[1]	H	2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a..	B	100.0 /100.0	2 /2	ASM_HUMAN Sphingomyelin phosphodiesterase
	5i81[2]	C	beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet..	A	100.0 /100.0	3 /3	ASM_HUMAN Sphingomyelin phosphodiesterase
	5i85[4]	B	beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet..	A	100.0 /100.0	3 /3	ASM_HUMAN Sphingomyelin phosphodiesterase
	5i8r[1]	H	beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet..	B	100.0 /100.0	4 /4	ASM_HUMAN Sphingomyelin phosphodiesterase
	5i81[2]	D	beta-D-mannopyranose-(1-3)-alpha-D-mannopyranose	A	100.0 /100.0	3 /3	ASM_HUMAN Sphingomyelin phosphodiesterase
	5i85[4]	C	alpha-D-mannopyranose-(1-3)-alpha-D-mannopyranose-..	A	100.0 /100.0	7 /7	ASM_HUMAN Sphingomyelin phosphodiesterase
	5jg8[1]	E	2-acetamido-2-deoxy-beta-D-glucopyranose-(1-3)-2-a..	A	100.0 /100.0	4 /4	ASM_HUMAN Sphingomyelin phosphodiesterase
	5jg8[1]	F	alpha-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-be..	B	100.0 /100.0	6 /6	ASM_HUMAN Sphingomyelin phosphodiesterase
	5jg8[1]	G	alpha-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-be..	B	100.0 /100.0	5 /5	ASM_HUMAN Sphingomyelin phosphodiesterase
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
HOMO
631	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	5i81[4]	A	ASM_HUMAN Sphingomyelin phosphodiesterase[528 aa]	A	100.0 /100.0	28 /28	ASM_HUMAN Sphingomyelin phosphodiesterase
	5i85[4]	A	ASM_HUMAN Sphingomyelin phosphodiesterase[528 aa]	A	100.0 /100.0	9 /9	ASM_HUMAN Sphingomyelin phosphodiesterase
	5i85[4]	A	ASM_HUMAN Sphingomyelin phosphodiesterase[528 aa]	A	100.0 /100.0	11 /11	ASM_HUMAN Sphingomyelin phosphodiesterase
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
631	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	5i81[6]	N	SO4 SULFATE ION[5 atoms]	A	100.0 /100.0	2 /2	ASM_HUMAN Sphingomyelin phosphodiesterase
	5i81[8]	O	SO4 SULFATE ION[5 atoms]	A	100.0 /100.0	2 /2	ASM_HUMAN Sphingomyelin phosphodiesterase
	5i81[6]	P	SO4 SULFATE ION[5 atoms]	A	100.0 /100.0	3 /3	ASM_HUMAN Sphingomyelin phosphodiesterase
	5i81[6]	Q	SO4 SULFATE ION[5 atoms]	A	100.0 /100.0	2 /2	ASM_HUMAN Sphingomyelin phosphodiesterase
	5i81[6]	R	SO4 SULFATE ION[5 atoms]	A	100.0 /100.0	5 /5	ASM_HUMAN Sphingomyelin phosphodiesterase
	5i81[2]	S	SO4 SULFATE ION[5 atoms]	A	100.0 /100.0	2 /2	ASM_HUMAN Sphingomyelin phosphodiesterase
	5i81[6]	T	SO4 SULFATE ION[5 atoms]	A	100.0 /100.0	6 /6	ASM_HUMAN Sphingomyelin phosphodiesterase
	5i81[6]	U	SO4 SULFATE ION[5 atoms]	A	100.0 /100.0	3 /3	ASM_HUMAN Sphingomyelin phosphodiesterase
	5i81[2]	V	SO4 SULFATE ION[5 atoms]	A	100.0 /100.0	3 /3	ASM_HUMAN Sphingomyelin phosphodiesterase
	5i81[12]	W	SO4 SULFATE ION[5 atoms]	A	100.0 /100.0	4 /4	ASM_HUMAN Sphingomyelin phosphodiesterase
	5i85[4]	P	SO4 SULFATE ION[5 atoms]	A	100.0 /100.0	2 /2	ASM_HUMAN Sphingomyelin phosphodiesterase
	5i85[4]	S	SO4 SULFATE ION[5 atoms]	A	100.0 /100.0	1 /1	ASM_HUMAN Sphingomyelin phosphodiesterase
	5i85[4]	T	SO4 SULFATE ION[5 atoms]	A	100.0 /100.0	3 /3	ASM_HUMAN Sphingomyelin phosphodiesterase
	5jg8[2]	L	ACT ACETATE ION[4 atoms]	A	100.0 /100.0	7 /7	ASM_HUMAN Sphingomyelin phosphodiesterase
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

Contact Molecules for Homologous Proteins

Summary Bars[100 %]

UniProt Feature Tables [P17405(ASM_HUMAN)]