PSIBLAST 2.11.0+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Stephen F.
Altschul, John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005)
"Protein database searches using compositionally adjusted
substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: uniprot_sprot.fasta
           571,282 sequences; 206,678,396 total letters

Results from round 1


Query= sp|P17405|ASM_HUMAN Sphingomyelin phosphodiesterase OS=Homo sapiens
OX=9606 GN=SMPD1 PE=1 SV=5

Length=631
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

sp|P17405|ASM_HUMAN Sphingomyelin phosphodiesterase OS=Homo sapie...  1288    0.0   
sp|Q0VD19|ASM_BOVIN Sphingomyelin phosphodiesterase OS=Bos taurus...  1043    0.0   
sp|Q04519|ASM_MOUSE Sphingomyelin phosphodiesterase OS=Mus muscul...  1001    0.0   
sp|Q23498|ASM2_CAEEL Sphingomyelin phosphodiesterase 2 OS=Caenorh...  380     4e-123
sp|Q9UAY4|ASM3_CAEEL Putative sphingomyelin phosphodiesterase asm...  353     8e-113
sp|Q54C16|SGMB_DICDI Sphingomyelin phosphodiesterase B OS=Dictyos...  335     2e-105
sp|Q10916|ASM1_CAEEL Sphingomyelin phosphodiesterase 1 OS=Caenorh...  328     1e-103
sp|Q55C09|SGMA_DICDI Sphingomyelin phosphodiesterase A OS=Dictyos...  273     4e-82 
sp|Q54SR8|SGMC_DICDI Sphingomyelinase phosphodiesterase C OS=Dict...  194     4e-54 
sp|Q92485|ASM3B_HUMAN Acid sphingomyelinase-like phosphodiesteras...  189     3e-52 
sp|Q641Z7|ASM3A_RAT Cyclic GMP-AMP phosphodiesterase SMPDL3A OS=R...  188     4e-52 
sp|P70158|ASM3A_MOUSE Cyclic GMP-AMP phosphodiesterase SMPDL3A OS...  181     2e-49 
sp|Q92484|ASM3A_HUMAN Cyclic GMP-AMP phosphodiesterase SMPDL3A OS...  177     6e-48 
sp|Q3ZC91|ASM3A_BOVIN Cyclic GMP-AMP phosphodiesterase SMPDL3A OS...  177     9e-48 
sp|P58242|ASM3B_MOUSE Acid sphingomyelinase-like phosphodiesteras...  176     1e-47 
sp|Q55GC7|SGMD_DICDI Sphingomyelinase phosphodiesterase D OS=Dict...  104     1e-22 
sp|Q9C1W8|PPN1_SCHPO Endopolyphosphatase OS=Schizosaccharomyces p...  85.1    5e-16 
sp|Q9P3S1|PPN1_NEUCR Endopolyphosphatase OS=Neurospora crassa (st...  84.7    8e-16 
sp|Q5KH67|PPN1_CRYNJ Endopolyphosphatase OS=Cryptococcus neoforma...  84.7    9e-16 
sp|Q6FMQ0|PPN1_CANGA Endopolyphosphatase OS=Candida glabrata (str...  76.6    3e-13 
sp|Q6BKG0|PPN1_DEBHA Endopolyphosphatase OS=Debaryomyces hansenii...  70.1    3e-11 
sp|Q756F2|PPN1_EREGS Endopolyphosphatase OS=Eremothecium gossypii...  65.9    7e-10 
sp|Q6CWT7|PPN1_KLULA Endopolyphosphatase OS=Kluyveromyces lactis ...  65.5    1e-09 
sp|Q04119|PPN1_YEAST Endopolyphosphatase OS=Saccharomyces cerevis...  63.9    3e-09 
sp|Q6CEE7|PPN1_YARLI Endopolyphosphatase OS=Yarrowia lipolytica (...  53.9    4e-06 
sp|Q75EN9|CCZ1_EREGS Vacuolar fusion protein CCZ1 OS=Eremothecium...  35.8    1.3   
sp|B0SUK3|THIE_CAUSK Thiamine-phosphate synthase OS=Caulobacter s...  35.0    1.3   
sp|Q8H5F8|ADPRM_ORYSJ Manganese-dependent ADP-ribose/CDP-alcohol ...  34.7    2.6   
sp|Q99NB2|B3GN5_RAT Lactosylceramide 1,3-N-acetyl-beta-D-glucosam...  33.9    4.3   
sp|Q9SB68|ADPRM_ARATH Manganese-dependent ADP-ribose/CDP-alcohol ...  33.5    5.5   
sp|P26779|SAP_BOVIN Prosaposin OS=Bos taurus OX=9913 GN=PSAP PE=1...  33.5    7.9   
sp|Q03L46|METE_STRTD 5-methyltetrahydropteroyltriglutamate--homoc...  33.1    9.9   


>sp|P17405|ASM_HUMAN Sphingomyelin phosphodiesterase OS=Homo sapiens 
OX=9606 GN=SMPD1 PE=1 SV=5
Length=631

 Score = 1288 bits (3332),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 631/631 (100%), Positives = 631/631 (100%), Gaps = 0/631 (0%)

Query  1    MPRYGASLRQSCPRSGREQGQDGTAGAPGLLWMGLVLALALALALALALSDSRVLWAPAE  60
            MPRYGASLRQSCPRSGREQGQDGTAGAPGLLWMGLVLALALALALALALSDSRVLWAPAE
Sbjct  1    MPRYGASLRQSCPRSGREQGQDGTAGAPGLLWMGLVLALALALALALALSDSRVLWAPAE  60

Query  61   AHPLSPQGHPARLHRIVPRLRDVFGWGNLTCPICKGLFTAINLGLKKEPNVARVGSVAIK  120
            AHPLSPQGHPARLHRIVPRLRDVFGWGNLTCPICKGLFTAINLGLKKEPNVARVGSVAIK
Sbjct  61   AHPLSPQGHPARLHRIVPRLRDVFGWGNLTCPICKGLFTAINLGLKKEPNVARVGSVAIK  120

Query  121  LCNLLKIAPPAVCQSIVHLFEDDMVEVWRRSVLSPSEACGLLLGSTCGHWDIFSSWNISL  180
            LCNLLKIAPPAVCQSIVHLFEDDMVEVWRRSVLSPSEACGLLLGSTCGHWDIFSSWNISL
Sbjct  121  LCNLLKIAPPAVCQSIVHLFEDDMVEVWRRSVLSPSEACGLLLGSTCGHWDIFSSWNISL  180

Query  181  PTVPKPPPKPPSPPAPGAPVSRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASR  240
            PTVPKPPPKPPSPPAPGAPVSRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASR
Sbjct  181  PTVPKPPPKPPSPPAPGAPVSRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASR  240

Query  241  PGAGYWGEYSKCDLPLRTLESLLSGLGPAGPFDMVYWTGDIPAHDVWHQTRQDQLRALTT  300
            PGAGYWGEYSKCDLPLRTLESLLSGLGPAGPFDMVYWTGDIPAHDVWHQTRQDQLRALTT
Sbjct  241  PGAGYWGEYSKCDLPLRTLESLLSGLGPAGPFDMVYWTGDIPAHDVWHQTRQDQLRALTT  300

Query  301  VTALVRKFLGPVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEAL  360
            VTALVRKFLGPVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEAL
Sbjct  301  VTALVRKFLGPVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEAL  360

Query  361  RTLRIGGFYALSPYPGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGD  420
            RTLRIGGFYALSPYPGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGD
Sbjct  361  RTLRIGGFYALSPYPGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGD  420

Query  421  KVHIIGHIPPGHCLKSWSWNYYRIVARYENTLAAQFFGHTHVDEFEVFYDEETLSRPLAV  480
            KVHIIGHIPPGHCLKSWSWNYYRIVARYENTLAAQFFGHTHVDEFEVFYDEETLSRPLAV
Sbjct  421  KVHIIGHIPPGHCLKSWSWNYYRIVARYENTLAAQFFGHTHVDEFEVFYDEETLSRPLAV  480

Query  481  AFLAPSATTYIGLNPGYRVYQIDGNYSGSSHVVLDHETYILNLTQANIPGAIPHWQLLYR  540
            AFLAPSATTYIGLNPGYRVYQIDGNYSGSSHVVLDHETYILNLTQANIPGAIPHWQLLYR
Sbjct  481  AFLAPSATTYIGLNPGYRVYQIDGNYSGSSHVVLDHETYILNLTQANIPGAIPHWQLLYR  540

Query  541  ARETYGLPNTLPTAWHNLVYRMRGDMQLFQTFWFLYHKGHPPSEPCGTPCRLATLCAQLS  600
            ARETYGLPNTLPTAWHNLVYRMRGDMQLFQTFWFLYHKGHPPSEPCGTPCRLATLCAQLS
Sbjct  541  ARETYGLPNTLPTAWHNLVYRMRGDMQLFQTFWFLYHKGHPPSEPCGTPCRLATLCAQLS  600

Query  601  ARADSPALCRHLMPDGSLPEAQSLWPRPLFC  631
            ARADSPALCRHLMPDGSLPEAQSLWPRPLFC
Sbjct  601  ARADSPALCRHLMPDGSLPEAQSLWPRPLFC  631


>sp|Q0VD19|ASM_BOVIN Sphingomyelin phosphodiesterase OS=Bos taurus 
OX=9913 GN=SMPD1 PE=2 SV=1
Length=625

 Score = 1043 bits (2696),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 535/631 (85%), Positives = 569/631 (90%), Gaps = 6/631 (1%)

Query  1    MPRYGASLRQSCPRSGREQGQDGTAGAPGLLWMGLVLALALALALALALSDSRVLWAPAE  60
            MPR+G S  Q  PRSGREQ  D + GAP       +  L L LALALAL +S VLW+PAE
Sbjct  1    MPRHGVSPGQGLPRSGREQASDRSLGAP------CLRLLWLGLALALALPNSPVLWSPAE  54

Query  61   AHPLSPQGHPARLHRIVPRLRDVFGWGNLTCPICKGLFTAINLGLKKEPNVARVGSVAIK  120
            A PL  QGHPA+  RI P+L++ FGW NLTCP CKGLFTAI+ GL+ + +VA VGSVAIK
Sbjct  55   ARPLPTQGHPAKFIRIAPQLQEAFGWWNLTCPTCKGLFTAIDFGLRNQASVAWVGSVAIK  114

Query  121  LCNLLKIAPPAVCQSIVHLFEDDMVEVWRRSVLSPSEACGLLLGSTCGHWDIFSSWNISL  180
            LC LLKIAPPAVCQS V LFEDDMVEVW RSVLSPSEACGLLLGS+CGHWDIFSSWNISL
Sbjct  115  LCVLLKIAPPAVCQSAVQLFEDDMVEVWTRSVLSPSEACGLLLGSSCGHWDIFSSWNISL  174

Query  181  PTVPKPPPKPPSPPAPGAPVSRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASR  240
            P VPKPPP+PP PPAPG+PVSR+LFLTDLHWDHDYLEGTDP+C +PLCCRR SG PPAS+
Sbjct  175  PAVPKPPPQPPKPPAPGSPVSRVLFLTDLHWDHDYLEGTDPNCENPLCCRRDSGPPPASQ  234

Query  241  PGAGYWGEYSKCDLPLRTLESLLSGLGPAGPFDMVYWTGDIPAHDVWHQTRQDQLRALTT  300
            PGAGYWGEYSKCDLPLRTLESLLSGLGPAGPFDMVYWTGDIPAH++W Q+RQDQLRALTT
Sbjct  235  PGAGYWGEYSKCDLPLRTLESLLSGLGPAGPFDMVYWTGDIPAHNIWQQSRQDQLRALTT  294

Query  301  VTALVRKFLGPVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEAL  360
            +TALV+KFLGPVPVYPAVGNHESTPVN FPPPFI+GN SS WLYEAMA+AWEPWLPAEAL
Sbjct  295  ITALVKKFLGPVPVYPAVGNHESTPVNGFPPPFIKGNQSSHWLYEAMAEAWEPWLPAEAL  354

Query  361  RTLRIGGFYALSPYPGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGD  420
            RTLRIGGFYALSP PGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGD
Sbjct  355  RTLRIGGFYALSPRPGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGD  414

Query  421  KVHIIGHIPPGHCLKSWSWNYYRIVARYENTLAAQFFGHTHVDEFEVFYDEETLSRPLAV  480
            KVHIIGHIPPGHCLKSWSWNYYRIV RYENTLA QFFGHTHVDEFEVFYDEETLSRPL+V
Sbjct  415  KVHIIGHIPPGHCLKSWSWNYYRIVERYENTLAGQFFGHTHVDEFEVFYDEETLSRPLSV  474

Query  481  AFLAPSATTYIGLNPGYRVYQIDGNYSGSSHVVLDHETYILNLTQANIPGAIPHWQLLYR  540
            AFLAPSATTYIGLNPGYRVYQIDGNYSGSSHVVLDHETYI+NLT+AN PGA PHW LLYR
Sbjct  475  AFLAPSATTYIGLNPGYRVYQIDGNYSGSSHVVLDHETYIMNLTEANEPGATPHWYLLYR  534

Query  541  ARETYGLPNTLPTAWHNLVYRMRGDMQLFQTFWFLYHKGHPPSEPCGTPCRLATLCAQLS  600
            ARETYGLPN LPTAWH+LVYRMR D QLFQTFWFLYHKGHPPSEPCGTPCRLATLCAQLS
Sbjct  535  ARETYGLPNALPTAWHDLVYRMRKDTQLFQTFWFLYHKGHPPSEPCGTPCRLATLCAQLS  594

Query  601  ARADSPALCRHLMPDGSLPEAQSLWPRPLFC  631
            AR+DSPALCRHL+PD SLP+ QSLW  PL C
Sbjct  595  ARSDSPALCRHLVPDASLPDVQSLWSMPLLC  625


>sp|Q04519|ASM_MOUSE Sphingomyelin phosphodiesterase OS=Mus musculus 
OX=10090 GN=Smpd1 PE=1 SV=2
Length=627

 Score = 1001 bits (2588),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 518/633 (82%), Positives = 555/633 (88%), Gaps = 8/633 (1%)

Query  1    MPRYGASLRQSCPRSGREQGQDGTAGAP--GLLWMGLVLALALALALALALSDSRVLWAP  58
            MP + AS  Q   R+G EQ  + +  AP  GLLWM       L LAL LAL DS VLW P
Sbjct  1    MPHHRASSGQDHLRAGWEQRLERSLPAPRVGLLWM------GLGLALVLALFDSTVLWVP  54

Query  59   AEAHPLSPQGHPARLHRIVPRLRDVFGWGNLTCPICKGLFTAINLGLKKEPNVARVGSVA  118
            A A+PL  +GH  +   I P L+  FGW NLTCP CK LFTA+N GLKKEPNVARVGSVA
Sbjct  55   ARAYPLPSEGHSVKFSAIAPPLQSAFGWQNLTCPACKVLFTALNHGLKKEPNVARVGSVA  114

Query  119  IKLCNLLKIAPPAVCQSIVHLFEDDMVEVWRRSVLSPSEACGLLLGSTCGHWDIFSSWNI  178
            IK+C +L IAP  VCQS VHLFEDD+VEVW RSVLSPSEACGLLLGS+CGHWDIFS+WNI
Sbjct  115  IKICKMLNIAPLDVCQSAVHLFEDDVVEVWTRSVLSPSEACGLLLGSSCGHWDIFSTWNI  174

Query  179  SLPTVPKPPPKPPSPPAPGAPVSRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPA  238
            SLP+VPKPPPKPPSPPAPGAPVSR+LFLTDLHWDH+YLEGTDP CADPLCCRRGSG PP 
Sbjct  175  SLPSVPKPPPKPPSPPAPGAPVSRVLFLTDLHWDHEYLEGTDPYCADPLCCRRGSGWPPN  234

Query  239  SRPGAGYWGEYSKCDLPLRTLESLLSGLGPAGPFDMVYWTGDIPAHDVWHQTRQDQLRAL  298
            S+ GAG+WGEYSKCDLPLRTLESLL GLGPAGPF+MVYWTGDIPAHDVW Q+RQDQLRAL
Sbjct  235  SQKGAGFWGEYSKCDLPLRTLESLLKGLGPAGPFEMVYWTGDIPAHDVWQQSRQDQLRAL  294

Query  299  TTVTALVRKFLGPVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAE  358
            TT+T LVRKFLGPVPVYPAVGNHESTPVN FPPPFI+GN SS+WLYEAMAKAWEPWLPA+
Sbjct  295  TTITDLVRKFLGPVPVYPAVGNHESTPVNGFPPPFIKGNQSSQWLYEAMAKAWEPWLPAD  354

Query  359  ALRTLRIGGFYALSPYPGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDR  418
            AL TLRIGGFYAL+P PGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLV ELQAAE+R
Sbjct  355  ALHTLRIGGFYALTPRPGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVEELQAAENR  414

Query  419  GDKVHIIGHIPPGHCLKSWSWNYYRIVARYENTLAAQFFGHTHVDEFEVFYDEETLSRPL  478
            GDKVHIIGHIPPGHCLKSWSWNYY+I+ARYENTLA QFFGHTHVDEFE+FYDEETLSRPL
Sbjct  415  GDKVHIIGHIPPGHCLKSWSWNYYKIIARYENTLAGQFFGHTHVDEFEIFYDEETLSRPL  474

Query  479  AVAFLAPSATTYIGLNPGYRVYQIDGNYSGSSHVVLDHETYILNLTQANIPGAIPHWQLL  538
            AVAFLAPSATT+I LNPGYRVYQIDGNY GSSHVVLDHETYILNLTQAN  G  P W+ L
Sbjct  475  AVAFLAPSATTFINLNPGYRVYQIDGNYPGSSHVVLDHETYILNLTQANAAGGTPSWKRL  534

Query  539  YRARETYGLPNTLPTAWHNLVYRMRGDMQLFQTFWFLYHKGHPPSEPCGTPCRLATLCAQ  598
            YRARETYGLP+ +P +WHNLVYRMR D QLFQTFWFLYHKGHPPSEPCGTPCRLATLCAQ
Sbjct  535  YRARETYGLPDAMPASWHNLVYRMRDDEQLFQTFWFLYHKGHPPSEPCGTPCRLATLCAQ  594

Query  599  LSARADSPALCRHLMPDGSLPEAQSLWPRPLFC  631
            LSARADSPALCRHLMP+GSLP+A  LW RPL C
Sbjct  595  LSARADSPALCRHLMPNGSLPDANRLWSRPLLC  627


>sp|Q23498|ASM2_CAEEL Sphingomyelin phosphodiesterase 2 OS=Caenorhabditis 
elegans OX=6239 GN=asm-2 PE=1 SV=3
Length=618

 Score = 380 bits (977),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 216/615 (35%), Positives = 329/615 (53%), Gaps = 41/615 (7%)

Query  35   LVLALALALALALALSDSRVLWAPAEAHPL----SPQGHPA-------RLHRIVPRLRDV  83
            ++L + + LAL   + +S VL  P + H      + +G+ A       ++ R   +  + 
Sbjct  6    IILGIGIVLALVSNV-ESGVLRKPVDEHEYEKWTNARGNEAAVPPPKYKMLRYAKKAINE  64

Query  84   FGWGNLTCPICKGLFTAINLGLKKEPNVARVGSVAIKLCNLLKIAPPAVCQSIVHLFEDD  143
                 ++C  C      +   + +      + +  + LC+L  +  P VC++I++ F+D+
Sbjct  65   PENRKMSCLFCTFAVDGVQALIAQNSTDNEIAAFLVNLCDLFDVEQPHVCKNIIYAFKDE  124

Query  144  MVEVWRRSVLSPSEACGLLLGSTCGHWD--IFSSWNISLPTVPKPPPKPPSPPAPGAPVS  201
            +V V  RSV +P E CG  + + CGH D  +   WNI++P   KPP KP        P  
Sbjct  125  VVFVLERSVFTPEEICGAFIAN-CGHSDKPLTHMWNITIPG-GKPPIKPWPKIPDNKPTF  182

Query  202  RILFLTDLHWDHDYLEGTDPDC-------ADPLCCRRGS----GLPPASRPG-----AGY  245
            ++L L+D+H DH Y+ GT+  C          +CCR  S    G P   +       AG 
Sbjct  183  KVLHLSDIHIDHQYVVGTEAYCQLDSALGTYAMCCRDYSQDSQGAPTNLKDKPIYVPAGP  242

Query  246  WGEYSKCDLPLRTLESLLSGLGPA-GPFDMVYWTGDIPAHDVWHQTRQDQLRALTTVTAL  304
            WG    CDLP +T ES +  +       D +  TGD  AHD W  T       +  +T +
Sbjct  243  WGMPYLCDLPYQTFESAMKHISKTFKDLDYIIITGDFEAHDSWDYTEDLTRENMNNMTNV  302

Query  305  VRKFLGPVPVYPAVGNHESTPVNSFPPPFI--EGNHSSRWLYEAMAKAWEPWLPAEALRT  362
              ++   VPVY ++GNHE  P ++  P  +        +WLY+ M++ W  W+P EAL T
Sbjct  303  FLEYFPGVPVYVSIGNHEGVPQDAMAPHTMPEYDTRGPQWLYKIMSEMWSHWIPQEALDT  362

Query  363  LRIGGFYALSPYPGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGDKV  422
            ++    YA+ P PGL+LISLN  +CS  NF+L +N  DP   L+WL+ ELQ +E++G+ V
Sbjct  363  VQYRASYAVYPKPGLKLISLNTIYCSEFNFYLYVNEVDPDATLEWLIEELQDSENKGELV  422

Query  423  HIIGHIPPG--HCLKSWSWNYYRIVARYENTLAAQFFGHTHVDEFEVFYD-EETLSRPLA  479
            HII HIPPG  +CLK WSWN++ IV RYENT+A  F+GHTH D+F V+YD ++   RP  
Sbjct  423  HIISHIPPGDNYCLKGWSWNFFEIVKRYENTIAQMFYGHTHYDQFMVYYDMDDPNRRPFH  482

Query  480  VAFLAPSATTYIGLNPGYRVYQIDGNYSGSSHVVLDHETYILNLTQANIPGAIPHWQLLY  539
              +++PS TTY  LNP YR+Y+IDG Y G+++ V D +TY  N+T+AN+    P W L Y
Sbjct  483  FNWISPSLTTYDWLNPAYRIYEIDGGYEGATYTVKDAKTYFANVTEANMKNKEPEWVLSY  542

Query  540  RARETYGLPNTLPTAWHNLVYRMRGDMQLFQTFWFLYHKGHPPSEPCGT--PCRLATLCA  597
              RE Y + +  P +W +L  ++  +  LF+ +  LY++ H  +E C T   CR   +C 
Sbjct  543  DTREHYQMADFSPQSWSDLSDKLWTNTTLFRDYVRLYYRNHYNNE-CYTDYKCRYTFVCD  601

Query  598  QLSARADSPALCRHL  612
                R+   + C HL
Sbjct  602  IKKGRSYDESFCDHL  616


>sp|Q9UAY4|ASM3_CAEEL Putative sphingomyelin phosphodiesterase 
asm-3 OS=Caenorhabditis elegans OX=6239 GN=asm-3 PE=3 SV=2
Length=589

 Score = 353 bits (905),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 190/522 (36%), Positives = 279/522 (53%), Gaps = 17/522 (3%)

Query  91   CPICKGLFTAINLGLKKEPNVARVGSVAIKLCNLLKIAPPAVCQSIVHLFEDDMVEVWRR  150
            C  CK +   +     ++     V  +A+ +C    I    VC  I+  F D+ + V ++
Sbjct  21   CEECKSIVDLLQFEWGEKKTEECVMEIAVFICETFHIEDNDVCNFIISDFSDEFMYVIKQ  80

Query  151  SVLSPSEACGLLLGSTCGHWD--IFSSWNISLPTVPKPPPKPPSPPAPGAPVSRILFLTD  208
             +++P + CGLL+ + CG +   + + WN+++P   +PP  P     PG P  R L LTD
Sbjct  81   ILVTPHQLCGLLMKNDCGDFVDPLATIWNMTIPG-NQPPFVPKQVVPPGNPTLRALHLTD  139

Query  209  LHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPG-----AGYWGEYSKCDLPLRTLESLL  263
            LH D  Y  G + DC  P CCR           G     AG WG    CD P   L ++L
Sbjct  140  LHVDMFYTVGLEADCGTPQCCRPQDMNVEIVENGDVKQPAGPWGSVGSCDTPYWLLTNML  199

Query  264  SGLGP-AGPFDMVYWTGDIPAHDVWHQTRQDQLRALTTVTALVRKFLGPVPVYPAVGNHE  322
              +   AG  D +  +GD+ +H VW  T +     +  ++  +R +    PVY AVGNHE
Sbjct  200  QNIASTAGKLDYIMVSGDLVSHTVWAYTPETHSFMVKNLSDTIRSYFPKTPVYFAVGNHE  259

Query  323  STPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGGFYALSPYPGLRLISL  382
              PV++  P F    +   WLY+AM+ AW+ W+PA+  ++L   G Y    Y GLR+ISL
Sbjct  260  GVPVDNIAPHFTPKKYHMDWLYKAMSNAWQGWIPADQEKSLEYNGCYMKKIYDGLRMISL  319

Query  383  NMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGDKVHIIGHIP--PGHCLKSWSWN  440
            N  +  R NFWL IN TDP G LQWL+ +LQ AE+ GDKVHI+ HIP   G  L+ ++ N
Sbjct  320  NNVYGDRINFWLYINQTDPDGTLQWLINQLQDAENVGDKVHIVAHIPGSDGEALEGYALN  379

Query  441  YYRIVARYENTLAAQFFGHTHVDEFEVFYD--EETLSRPLAVAFLAPSATTYIGLNPGYR  498
            YY+I+ RY NT+  QFFGHTH ++F + Y   ++  S P  V + APS T Y    P YR
Sbjct  380  YYKIINRYANTVVGQFFGHTHSEKFYMMYANPDDYKSTPTNVVYSAPSVTPYSDYFPAYR  439

Query  499  VYQIDGNYSGSSHVVLDHETYILNLTQANIPGAIPHWQLLYR-ARETYGLPNTLPTAWHN  557
            +Y IDG + GS++ V+D+E +  NLT  N       W++LY+ A   YGL   +PT ++ 
Sbjct  440  IYTIDGVHKGSTYQVIDYEEWFFNLTSNNANPTNVKWEVLYQSANMEYGLKGQIPTEYNQ  499

Query  558  LVYRMRGDMQLFQTFWFLYHKG--HPPSEPCG-TPCRLATLC  596
            ++ RM+ D  LF  ++  +++   +    PC    CR   LC
Sbjct  500  MIERMKTDDSLFNKYYENHNRRSIYDGRAPCNDQQCRNGYLC  541


>sp|Q54C16|SGMB_DICDI Sphingomyelin phosphodiesterase B OS=Dictyostelium 
discoideum OX=44689 GN=sgmB PE=3 SV=1
Length=637

 Score = 335 bits (860),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 203/537 (38%), Positives = 288/537 (54%), Gaps = 32/537 (6%)

Query  91   CPICKGLFTAINLGLKKEPNVARVGSVAIKLCNLLKIAPPAVCQSIVHLFEDDMVEVWRR  150
            C ICK     +   +  +  +  +   AI LC  L I    VC  ++ LF +    V   
Sbjct  77   CDICKFGINQVQKMIASKQGIEDISKYAIDLCTYLHIEKAEVCNGLIPLFANMTYNVLSY  136

Query  151  SVLSPSEACGLLLGSTCGHWDIFSSWNISLPTVPKPPPKPPSPPAPGAPVSRILFLTDLH  210
              ++    CG +    C +    SS NI     PKPP  PP  P+P +P  +IL ++D+H
Sbjct  137  PTVTGEYVCGFV--GFCPYVPRNSS-NIINFPKPKPPHVPPVAPSPNSPTMKILHISDIH  193

Query  211  WDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGEYSKCDLPLRTLESLLSGLGP--  268
             D  Y  G + DC +PLCCR  +G P      AG WG Y  CD+ ++ +ES+   +    
Sbjct  194  VDPVYESGMNADCGEPLCCRAPNG-PGVGEKAAGEWGHY-LCDINMKMVESMFEFIDQEF  251

Query  269  AGPFDMVYWTGDIPAHDVWHQTRQDQLRALTTVTALVRKFLGPV-PVYPAVGNHESTPVN  327
                D+V+WTGD P HD+W QT   Q+ A   VT LV+K+ G    V+PA+GNHES PVN
Sbjct  252  GEDIDIVFWTGDNPPHDIWEQTYDSQINASQLVTNLVKKYFGSTAKVFPAIGNHESLPVN  311

Query  328  SFP-PPFIEGNHSSRWLYEAMAKAWEPWLPA-EALRTLRIGGFYALSPYPGLRLISLNMN  385
            SFP PP       S W++ A++  W  W+   E +  L+ GG+Y L    GLR+ISLNMN
Sbjct  312  SFPLPP------GSSWIFNALSYDWSDWVNVDEQVANLQYGGYYTLPVQSGLRVISLNMN  365

Query  386  FCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGDKVHIIGHIPPG--HCLKSWSWNYYR  443
            +C+  N +L  NSTDPA  LQW+V  LQA+ED G+KV+++GHIPPG   C+ SWS    +
Sbjct  366  WCNNGNLYLAENSTDPANMLQWIVDTLQASEDIGEKVYLVGHIPPGIPDCIDSWSEQLLQ  425

Query  444  IVARYENTLAAQFFGHTHVDEFEVFY---DEETLSRPL---AVAFLAPSATTYIGLNPGY  497
            IV RYE+T+ A F+GHTH DEF V+Y   DE   S P+    V +  PS TTY   NP +
Sbjct  426  IVNRYEDTILASFYGHTHRDEFSVYYTQSDENDPSSPMRASNVIYTTPSVTTYQHQNPSF  485

Query  498  RVYQIDGNYSGSSHVVLDHETYILNLTQANIPGAIPHWQLLYRARETYGLPNTLPTAWHN  557
            R++ +D N    +  +++  TY  +L+QAN+ G  P W L Y    TY +PN  P +   
Sbjct  486  RIFTVDSN----TGYLMESSTYHTDLSQANLNGK-PTWLLEYNTTNTYNIPNLTPISMDL  540

Query  558  LVYRMRGDMQLFQTFWFLYHKG--HPPSEPCGT-PCRLATLCAQLSARADSPALCRH  611
             +  +     + + +   Y+    +P S+PC +  C+L  +C   SA       C H
Sbjct  541  AIQNINSSNSMLEDYHVHYYSASPYPESKPCTSISCKLDYICKMKSAAYLKYYECIH  597


>sp|Q10916|ASM1_CAEEL Sphingomyelin phosphodiesterase 1 OS=Caenorhabditis 
elegans OX=6239 GN=asm-1 PE=1 SV=2
Length=564

 Score = 328 bits (841),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 184/539 (34%), Positives = 283/539 (53%), Gaps = 21/539 (4%)

Query  82   DVFGWGNLTCPICKGLFTAINLGLKKEPNVARVGSVAIKLCNLLKIAPPAVCQSIVHLFE  141
            D +G+  L C  C GL +  +  LK + +   +   A  +C L    P AVC  I   F 
Sbjct  33   DKYGFQPL-CISCTGLISVASFFLKFDVSEPVILEFATIVCKLFAKQPWAVCDGISSQFR  91

Query  142  DDMVEVWRR-SVLSPSEACGLLLGSTCGHWD-IFSSWNISLPTVPKPP--PKPPSPPAPG  197
            D+   V+RR +  SPS+ CG++L       D   S W ++LP  PK     K      P 
Sbjct  92   DEFFYVFRRLANESPSQICGIILPDCADPTDPSESGWMVALPPKPKRTRISKKKVQKKPN  151

Query  198  APVSR---ILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGEYSKCDL  254
              +S+   +L LTDLH D +Y   ++ +C DP+CCR     P   +  AGYWG   KCD+
Sbjct  152  MSMSQNLNVLQLTDLHVDFEYKYPSEANCDDPVCCRVSVSEP---KKAAGYWGSVGKCDI  208

Query  255  PLRTLESLLSGLGPAGPFDMVYWTGDIPAHDVWHQTRQDQLRALTTVTALVRKFLGPVPV  314
            P  T+E++LS +      DMV  TGD   H  W  + ++ L  L  +  LV+      P+
Sbjct  209  PFWTVENMLSHINKTHMIDMVIMTGDYINHVDWEYSIEEHLSVLRKLHRLVQNTFPSTPI  268

Query  315  YPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGGFYALSPY  374
            Y A+GNHE  PVNSF P  ++      WLY+       PWL   A  +L   G Y+    
Sbjct  269  YWALGNHEGVPVNSFAPHSVDERFWPTWLYKEFQTMSGPWLSEGAKDSLLKRGSYSTQVM  328

Query  375  PGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGDKVHIIGHIPPG--H  432
             GL+LI+LN  FC   NF+L +N +DP   + W V EL  +E +G++V+++ HIPPG   
Sbjct  329  DGLKLITLNTGFCEVTNFFLYLNQSDPDSSMSWFVKELFESEKKGEQVYVLAHIPPGDSE  388

Query  433  CLKSWSWNYYRIVARYENTLAAQFFGHTHVDEFEVFYDE--ETLSRPLAVAFLAPSATTY  490
            CL+ W++NYYR++ R+ +T+AAQFFGH H+D F VFY++     S+P++V + +PS TT+
Sbjct  389  CLEGWAFNYYRVIQRFSSTIAAQFFGHDHLDYFTVFYEDMHNVSSKPISVGYASPSVTTF  448

Query  491  IGLNPGYRVYQIDGNYSGSSHVVLDHETYILNLTQANIPGAIPHWQLLYRARETYGLPNT  550
               NP YR+Y+ID     +   ++D  TY  +L +A      P W+ LY AR+ +G+ + 
Sbjct  449  EYQNPAYRIYEID---PYNKFKIVDFTTYYADLEKAT-EDKKPVWEKLYSARQAHGMDDL  504

Query  551  LPTAWHNLVYRMRGDMQLFQTFWFLYHKGHPPSEPCGTPCRLATLCAQLSARADSPALC  609
             P +W+ ++ ++    +  + F+    +   P   C + C++  +C       +S   C
Sbjct  505  SPLSWNKVIQKLFTSEKKREKFYQYAFRNFSPQ--CDSTCQMQLMCNLRMGHHNSTLYC  561


>sp|Q55C09|SGMA_DICDI Sphingomyelin phosphodiesterase A OS=Dictyostelium 
discoideum OX=44689 GN=sgmA PE=3 SV=1
Length=583

 Score = 273 bits (697),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 166/535 (31%), Positives = 269/535 (50%), Gaps = 47/535 (9%)

Query  89   LTCPICKGLFTAINLGLKKEPNVARVGSVAIKLCNLLKIAPPAVCQSIVHLFEDDMVEVW  148
            L+C +C+   + +   +KK  ++  +      LC   K   P VC  I++ +   +V+V 
Sbjct  53   LSCDVCQIGASLLEDFIKKNASLTEIIKGLSDLCIASKEEQPEVCTGILNNYVPIIVDVL  112

Query  149  RRSVLSPSEACGLL-LGSTCGHW----------DIFSSWNISLPTVP---KPPPKPPSPP  194
             +S  +PS+ CG   + S  G            + +   + + PT+    KP  K  S  
Sbjct  113  IQSDFTPSQLCGYFKICSATGSSESSSISNSFDNEYRQESFNKPTMKVNKKPQYKDLSNQ  172

Query  195  AP-------GAPVSRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWG  247
             P          +  IL ++D+H+D DY  G++P+C  PLCCR G G        AG  G
Sbjct  173  EPLVKKFKGNDSIGYILQISDVHFDPDYKVGSNPNCGRPLCCRDGVG-------SAGPIG  225

Query  248  EYSKCDLPLRTLESLLSGLGP-AGPFDMVYWTGDIPAHDVWHQTRQDQLRALTTVTALVR  306
             Y  CD+P  T+E +   L       D + WTGD P H+VW Q++  Q  A  T+  +++
Sbjct  226  HY-LCDIPFSTVELIFQHLATLTDQLDFIVWTGDNPPHNVWEQSQAQQELATATLAQVIQ  284

Query  307  KFLGPVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIG  366
            K     PV P++GNHE+ P + +  P      +S+WL +++   W PWL A+AL  ++  
Sbjct  285  KTFPNTPVLPSLGNHEAYPADQYVLP------NSQWLLDSIYTYWAPWLDADALELVKER  338

Query  367  GFYALSPYPGLRLISLNMNFCSRENFWLLINS--TDPAGQLQWLVGELQAAEDRGDKVHI  424
            G+Y     PGLR++SLN       NF+ L+ +    P  Q  W++  L+ A+  G+KV I
Sbjct  339  GYYTSLIKPGLRVMSLNTLENDMINFYNLLPTYLKGPNNQSDWMINTLEQAQSNGEKVLI  398

Query  425  IGHIP---PGHCLKSWSWNYYRIVARYENTLAAQFFGHTHVDEFEVFYDEETLSRPLAVA  481
            IGHIP          W   Y ++V ++ + +  Q +GHTH D+F VF D  T + P  + 
Sbjct  399  IGHIPCTVKSASTDGWCAMYEQVVGQFSDVIIGQLYGHTHYDQFSVFSDVATHTIPTGMN  458

Query  482  FLAPSATTYIGLNPGYRVYQIDGNYSGSSHVVLDHETYILNLTQANIPGAIPHWQLLYRA  541
            ++ PS TTY    PGYR+YQ D     S++ ++++  Y  N+T+AN  GA+ ++QL Y A
Sbjct  459  YIVPSLTTYQNHEPGYRIYQFD----YSTNQIVNYYQYHANITEANETGAL-NFQLTYSA  513

Query  542  RETYGLPNTLPTAWHNLVYRMRGDMQLFQTFWFLYHKGHPPSEPCGTPCRLATLC  596
            +E Y + +  PT+W  +  +M+ +  +F ++ F      P  E C   C+   +C
Sbjct  514  KELYNMDDLSPTSWTKVANQMKTNSTMFNSY-FENLSSSPIKESCDQACQTKWIC  567


>sp|Q54SR8|SGMC_DICDI Sphingomyelinase phosphodiesterase C OS=Dictyostelium 
discoideum OX=44689 GN=sgmC PE=3 SV=1
Length=446

 Score = 194 bits (493),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 130/413 (31%), Positives = 200/413 (48%), Gaps = 40/413 (10%)

Query  206  LTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGEYSKCDLPLRTLESLLSG  265
            +TD H+D  Y+EG D D      CR  +      + GA   G Y KCD     L+S    
Sbjct  37   ITDTHYDFMYIEGGDEDKQ----CREVTYKSKYEKGGASSIGNY-KCDTSFELLQSSFEY  91

Query  266  LGPAGPF-DMVYWTGDIPAHDVWHQTRQD-QLRALTTVTALVRKFLGPVPVYPAVGNHES  323
            +       D + WTGD P H    Q  +   L+++T +T L++ +   +P++P++GNH+S
Sbjct  92   MVKHEEKPDFIIWTGDDPPHLGNSQLNETLVLQSITNMTNLIKGYFPDIPIFPSIGNHDS  151

Query  324  TPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGGFYALSPYPGLRLISLN  383
             P +              WL+E +A+ W P+L  +++ T ++GG+Y      G R+ISLN
Sbjct  152  YPQHQIGV-------GPNWLFENVAQLWSPFLSNDSIETFKLGGYYTELVSEGFRIISLN  204

Query  384  MNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGDKVHIIGHIPPGHCLKSWSWNYYR  443
              F   EN   L N TDPAGQL WL   L  A   G++V IIGH+PPG+  K   +N+++
Sbjct  205  TVFYYNENRQCL-NLTDPAGQLLWLNETLANASLAGERVWIIGHVPPGYNEKYDVFNFHK  263

Query  444  --------IVARYENTLAAQFFGHTHVDEFEVFYDEETLS----RPLAVAFLAPSATTYI  491
                      ++Y + +    +GH H D F +FYD+         P  + FL+PS T ++
Sbjct  264  QFNDEYLFSFSQYSDIIEFHIYGHEHTDTFRLFYDDPNDHINDIEPTGIMFLSPSLTPWM  323

Query  492  GL-------NPGYRVYQIDGNYSGSSHVVLDHETYILNLTQANIPGAIPHWQLLYRARET  544
                     NPG R+Y+    Y+ +S  +LD+  +  NLT   I G I  WQL YRA E 
Sbjct  324  NQFLPALPNNPGLRLYE----YNITSFALLDYYQFWTNLTDNIISGNID-WQLEYRATEF  378

Query  545  YGLPNTLPTAWHNLVYRMRGDMQLFQTFWFLYHKGHPPSEPCGTPCRLATLCA  597
            +   N  P + +     ++        F F Y+    P++ C   C+   LC+
Sbjct  379  FNTFNLSPVSMYEAYLLIQSVTSQLLKFHF-YNSVSYPTKGCDEICKKIQLCS  430


>sp|Q92485|ASM3B_HUMAN Acid sphingomyelinase-like phosphodiesterase 
3b OS=Homo sapiens OX=9606 GN=SMPDL3B PE=1 SV=2
Length=455

 Score = 189 bits (481),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 135/440 (31%), Positives = 202/440 (46%), Gaps = 49/440 (11%)

Query  206  LTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGEYSKCDLPLRTLESLLSG  265
            + DLH D DY    DP    P      +G  P   P AG WG+Y  CD P   + S +  
Sbjct  26   IADLHLDPDYKVSKDPFQVCP-----SAGSQPV--PDAGPWGDY-LCDSPWALINSSIYA  77

Query  266  LGPAGPF-DMVYWTGDIPAHDVWHQTRQDQ-LRALTTVTALVRKFLGPVPVYPAVGNHES  323
            +    P  D + WTGD   H    +  +   L  +  +T L+R+      VY A+GNH+ 
Sbjct  78   MKEIEPEPDFILWTGDDTPHVPDEKLGEAAVLEIVERLTKLIREVFPDTKVYAALGNHDF  137

Query  324  TPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGGFYALS---PYPGLRLI  380
             P N FP         S  +Y  +A+ W+PWL  E++   + G FY      P    R++
Sbjct  138  HPKNQFPA-------GSNNIYNQIAELWKPWLSNESIALFKKGAFYCEKLPGPSGAGRIV  190

Query  381  SLNMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGDKVHIIGHIPPGHCLKS----  436
             LN N     N  L  +  DP  Q QWL   L  A   GD V+I+GH+PPG   K+    
Sbjct  191  VLNTNLYYTSNA-LTADMADPGQQFQWLEDVLTDASKAGDMVYIVGHVPPGFFEKTQNKA  249

Query  437  -----WSWNYYRIVARYENTLAAQFFGHTHVDEFEVFYDEETLSRPLAVAFLAPSA----  487
                 ++  Y ++V ++   +A QFFGH H D F + YD+  +  P++  F+ P      
Sbjct  250  WFREGFNEKYLKVVRKHHRVIAGQFFGHHHTDSFRMLYDDAGV--PISAMFITPGVTPWK  307

Query  488  TTYIGL-----NPGYRVYQIDGNYSGSSHVVLDHETYILNLTQANIPGAIPHWQLLYRAR  542
            TT  G+     NP  RV++    Y  ++  + D  TY +NL+QAN  G  P W+L Y+  
Sbjct  308  TTLPGVVNGANNPAIRVFE----YDRATLSLKDMVTYFMNLSQANAQGT-PRWELEYQLT  362

Query  543  ETYGLPNTLPTAWHNLVYRMRGDMQLFQTFWFLYHKGHPPSEPCGTPCRLATLCAQLSAR  602
            E YG+P+    + H ++ R+ GD    Q + ++Y+     +  C   C +  +CA     
Sbjct  363  EAYGVPDASAHSMHTVLDRIAGDQSTLQRY-YVYNSVSYSAGVCDEACSMQHVCAMRQVD  421

Query  603  ADSPALCRHLMPDGSLPEAQ  622
             D+   C  L   G+ P  Q
Sbjct  422  IDAYTTC--LYASGTTPVPQ  439


>sp|Q641Z7|ASM3A_RAT Cyclic GMP-AMP phosphodiesterase SMPDL3A 
OS=Rattus norvegicus OX=10116 GN=Smpdl3a PE=2 SV=1
Length=445

 Score = 188 bits (478),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 139/445 (31%), Positives = 215/445 (48%), Gaps = 46/445 (10%)

Query  191  PSPPAPGAP-VSRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGEY  249
            P  PA GAP V +   +TDLH D  Y   TD D        +G+ +   S PG   +G+ 
Sbjct  24   PLAPAYGAPAVGQFWHVTDLHLDPTY-HITD-DHTKVCASSKGANV---SNPGP--FGDV  76

Query  250  SKCDLPLRTLESLLSGLGPAG-PFDMVYWTGDIPAHD-VWHQTRQDQLRALTTVTALVRK  307
              CD P + + S    +  +G     + WTGD P H  V   +    +  +T +T  V+ 
Sbjct  77   -LCDSPYQLILSAFDFIKNSGQEASFMIWTGDSPPHVPVRELSTGSVIEVITNMTVTVQN  135

Query  308  FLGPVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGG  367
                + V+PA+GNH+  P +  P        ++  +Y A++  W+PWL  EA+ TLR GG
Sbjct  136  LFPNLQVFPALGNHDYWPQDQLPI-------ATSKVYSAVSDLWKPWLDEEAISTLRKGG  188

Query  368  FYA--LSPYPGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGDKVHII  425
            FY+  ++  P LR+ISLN N     N  + +N TDPA Q +WL   L ++    +KV++I
Sbjct  189  FYSQKVASNPDLRIISLNTNLYYGPNI-MTLNKTDPANQFEWLENTLNSSLRNKEKVYVI  247

Query  426  GHIPPGH---------CLKSWSWNYYRIVARYENTLAAQFFGHTHVDEFEVFYDEETLSR  476
             H+P G+           + ++     I  RY + +A QF+GHTH D   V  D+     
Sbjct  248  AHVPVGYLPYATKTPAMRQYYNEKLVDIFRRYSSVIAGQFYGHTHRDSLMVLSDKN--GN  305

Query  477  PLAVAFLAPSATTYIGL------NPGYRVYQIDGNYSGSSHVVLDHETYILNLTQANIPG  530
            P+   F+AP+ T   G+      NPG R++Q    Y    + +LD   Y LNLT+AN+ G
Sbjct  306  PINSVFVAPAVTPVKGVLEKETNNPGVRLFQ----YKPGDYTLLDMLQYYLNLTEANLKG  361

Query  531  AIPHWQLLYRARETYGLPNTLPTAWHNLVYRMRG-DMQLFQTFWFLYHKGHPPSEPCGTP  589
               +W L Y   + YG+ +  P + H L  ++   D + F  ++  +   +  S PC   
Sbjct  362  E-SNWTLEYTLTQAYGVADLQPKSLHGLAQQLATIDSKQFLKYYHYFFVSYDSSAPCDQR  420

Query  590  CRLATLCAQLSARADSPALC--RHL  612
            C+   +CA ++    S   C  RHL
Sbjct  421  CKTLQICAIMNLDLVSYEDCLKRHL  445


>sp|P70158|ASM3A_MOUSE Cyclic GMP-AMP phosphodiesterase SMPDL3A 
OS=Mus musculus OX=10090 GN=Smpdl3a PE=1 SV=2
Length=445

 Score = 181 bits (460),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 140/445 (31%), Positives = 213/445 (48%), Gaps = 46/445 (10%)

Query  191  PSPPAPGAP-VSRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGEY  249
            P  PA  AP V +   +TDLH D  Y   TD D        +G+    AS PG   +G+ 
Sbjct  24   PLAPADRAPAVGQFWHVTDLHLDPTY-HITD-DRTKVCASSKGAN---ASNPGP--FGD-  75

Query  250  SKCDLPLRTLESLLSGLGPAG-PFDMVYWTGDIPAHD-VWHQTRQDQLRALTTVTALVRK  307
              CD P + + S    +  +G     + WTGD P H  V   +    ++ +T +T  V+ 
Sbjct  76   VLCDSPYQLILSAFDFIKNSGQEASFMIWTGDSPPHVPVPELSTGTVIKVITNMTMTVQN  135

Query  308  FLGPVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGG  367
                + V+PA+GNH+  P +  P         +  +Y A+A  W+PWL  EA+ TL+ GG
Sbjct  136  LFPNLQVFPALGNHDYWPQDQLPI-------VTSKVYSAVADLWKPWLGEEAISTLKKGG  188

Query  368  FYA--LSPYPGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGDKVHII  425
            FY+  ++  PGLR+ISLN N     N  + +N TDPA Q +WL   L ++    +KV+II
Sbjct  189  FYSQKVASNPGLRIISLNTNLYYGPNI-MTLNKTDPANQFEWLENTLNSSLWNKEKVYII  247

Query  426  GHIPPGH---------CLKSWSWNYYRIVARYENTLAAQFFGHTHVDEFEVFYDEETLSR  476
             H+P G+           + ++     I  RY + +A QF+GHTH D   V  D+     
Sbjct  248  AHVPVGYLPYATDTPAIRQYYNEKLLDIFRRYSSVIAGQFYGHTHRDSLMVLSDKN--GN  305

Query  477  PLAVAFLAPSATTYIGL------NPGYRVYQIDGNYSGSSHVVLDHETYILNLTQANIPG  530
            PL   F+AP+ T   G+      NPG R++Q    Y    + +LD   Y LNLT+AN+ G
Sbjct  306  PLNSVFVAPAVTPVKGVLQKETNNPGVRLFQ----YKPGDYTLLDMVQYYLNLTEANLKG  361

Query  531  AIPHWQLLYRARETYGLPNTLPTAWHNLVYRM-RGDMQLFQTFWFLYHKGHPPSEPCGTP  589
               +W L Y   + Y + +  P + + LV +    D + F  ++  Y   +  S  C   
Sbjct  362  E-SNWTLEYVLTQAYSVADLQPKSLYALVQQFATKDSKQFLKYYHYYFVSYDSSATCDQH  420

Query  590  CRLATLCA--QLSARADSPALCRHL  612
            C+   +CA   L + +    L +HL
Sbjct  421  CKTLQVCAIMNLDSMSYDDCLKQHL  445


>sp|Q92484|ASM3A_HUMAN Cyclic GMP-AMP phosphodiesterase SMPDL3A 
OS=Homo sapiens OX=9606 GN=SMPDL3A PE=1 SV=2
Length=453

 Score = 177 bits (449),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 139/452 (31%), Positives = 213/452 (47%), Gaps = 49/452 (11%)

Query  178  ISLPTVPKPPPKPPSPPAPGAPVSRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPP  237
            + LP  P     PP  PA G    +   +TDLH D  Y   TD D        +G+    
Sbjct  21   LGLPVAPAGGRNPP--PAIG----QFWHVTDLHLDPTY-HITD-DHTKVCASSKGAN---  69

Query  238  ASRPGAGYWGEYSKCDLPLRTLESLLSGLGPAG-PFDMVYWTGDIPAHDVWHQTRQDQ-L  295
            AS PG   +G+   CD P + + S    +  +G     + WTGD P H    +   D  +
Sbjct  70   ASNPGP--FGDV-LCDSPYQLILSAFDFIKNSGQEASFMIWTGDSPPHVPVPELSTDTVI  126

Query  296  RALTTVTALVRKFLGPVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWL  355
              +T +T  ++     + V+PA+GNH+  P +  P         +  +Y A+A  W+PWL
Sbjct  127  NVITNMTTTIQSLFPNLQVFPALGNHDYWPQDQLPV-------VTSKVYNAVANLWKPWL  179

Query  356  PAEALRTLRIGGFYA--LSPYPGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVGELQ  413
              EA+ TLR GGFY+  ++  P LR+ISLN N     N  + +N TDPA Q +WL   L 
Sbjct  180  DEEAISTLRKGGFYSQKVTTNPNLRIISLNTNLYYGPNI-MTLNKTDPANQFEWLESTLN  238

Query  414  AAEDRGDKVHIIGHIPPGHCLKSWSWN----YYR-----IVARYENTLAAQFFGHTHVDE  464
             ++   +KV+II H+P G+   S +      YY      I  +Y + +A QF+GHTH D 
Sbjct  239  NSQQNKEKVYIIAHVPVGYLPSSQNITAMREYYNEKLIDIFQKYSDVIAGQFYGHTHRDS  298

Query  465  FEVFYDEETLSRPLAVAFLAPSATTYIGL------NPGYRVYQIDGNYSGSSHVVLDHET  518
              V  D++    P+   F+AP+ T    +      NPG R++Q    Y    + +LD   
Sbjct  299  IMVLSDKK--GSPVNSLFVAPAVTPVKSVLEKQTNNPGIRLFQ----YDPRDYKLLDMLQ  352

Query  519  YILNLTQANIPGAIPHWQLLYRARETYGLPNTLPTAWHNLVYRMRG-DMQLFQTFWFLYH  577
            Y LNLT+AN+ G    W+L Y   +TY + +  P + + L  +    D + F  ++  + 
Sbjct  353  YYLNLTEANLKGE-SIWKLEYILTQTYDIEDLQPESLYGLAKQFTILDSKQFIKYYNYFF  411

Query  578  KGHPPSEPCGTPCRLATLCAQLSARADSPALC  609
              +  S  C   C+   +CA ++    S A C
Sbjct  412  VSYDSSVTCDKTCKAFQICAIMNLDNISYADC  443


>sp|Q3ZC91|ASM3A_BOVIN Cyclic GMP-AMP phosphodiesterase SMPDL3A 
OS=Bos taurus OX=9913 GN=SMPDL3A PE=2 SV=1
Length=450

 Score = 177 bits (448),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 130/440 (30%), Positives = 205/440 (47%), Gaps = 43/440 (10%)

Query  190  PPSPPAPGAPVSRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGEY  249
            P +P   G  V +   +TD H D  Y    D        C    G   AS PG   +G+ 
Sbjct  24   PLAPAGTGPAVGQFWHVTDFHLDPTYHITGD----HTKVCASSKG-AEASDPGP--FGD-  75

Query  250  SKCDLPLRTLESLLSGLGPAG-PFDMVYWTGDIPAHDVWHQTRQDQLRALT-TVTALVRK  307
              CD P R + S L  +  +G     + WTGD P H    +   D++  +T  +T  +++
Sbjct  76   VMCDSPYRLIFSALDFIKNSGQKVSFMIWTGDSPPHVPVLELSTDKVINVTANITTTIQR  135

Query  308  FLGPVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGG  367
                + V+PA+GNH+  P +  P         +  +Y A+A  W+PWL  +A+ TLR GG
Sbjct  136  LFPNLQVFPALGNHDYWPQDQLPV-------VNSKVYNAVANLWKPWLTEDAITTLRKGG  188

Query  368  FYA--LSPYPGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGDKVHII  425
            FY   +S  P LR+ISLN N     N  + +N TDPA Q +WL   L  ++   +KV+II
Sbjct  189  FYTQKVSNNPKLRIISLNTNLYYGPN-SVTLNQTDPANQFEWLENTLNISQQNKEKVYII  247

Query  426  GHIPPGH---------CLKSWSWNYYRIVARYENTLAAQFFGHTHVDEFEVFYDEETLSR  476
             H+P G+           K  +     I  +Y + +A QF+GHTH D   V  D++   +
Sbjct  248  AHVPVGYLPYARGISAMRKYHNEKLIDIFRKYSDIIAGQFYGHTHRDSIMVLSDKK--GK  305

Query  477  PLAVAFLAPSAT------TYIGLNPGYRVYQIDGNYSGSSHVVLDHETYILNLTQANIPG  530
            P+   F+AP+ T        +  NPG R++Q    Y    + +LD   Y LNLT AN+ G
Sbjct  306  PVNSLFVAPAVTPVRSVLERLTNNPGVRLFQ----YDPRDYKLLDMLQYYLNLTDANLKG  361

Query  531  AIPHWQLLYRARETYGLPNTLPTAWHNLVYRMR-GDMQLFQTFWFLYHKGHPPSEPCGTP  589
               +W+L Y   + Y + +  P + + L  +    + + F  ++  +   +  S  C   
Sbjct  362  E-SNWKLEYNLTQAYDIQDLQPKSLYKLAKQFAIQESKQFIKYYKYFFVSYDSSVICQGK  420

Query  590  CRLATLCAQLSARADSPALC  609
            C++  +CA ++    S   C
Sbjct  421  CKIFQICAIMNLDVISYTDC  440


>sp|P58242|ASM3B_MOUSE Acid sphingomyelinase-like phosphodiesterase 
3b OS=Mus musculus OX=10090 GN=Smpdl3b PE=1 SV=1
Length=456

 Score = 176 bits (447),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 131/438 (30%), Positives = 197/438 (45%), Gaps = 47/438 (11%)

Query  197  GAPVSRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGEYSKCDLPL  256
            GA + R   ++DLH D +Y    DP    P      +G  P     AG WG+Y  CD P 
Sbjct  17   GAQLGRFWHISDLHLDPNYTVSKDPLQVCP-----SAGSQPVL--NAGPWGDY-LCDSPW  68

Query  257  RTLESLLSGLGPAGPF-DMVYWTGDIPAHDVWHQTRQDQLRALTT-VTALVRKFLGPVPV  314
              + S L  +    P  D + WTGD   H       +  + A+   +T L+++      V
Sbjct  69   ALINSSLYAMKEIEPKPDFILWTGDDTPHVPNESLGEAAVLAIVERLTNLIKEVFPDTKV  128

Query  315  YPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGGFYALS--  372
            Y A+GNH+  P N FP         S  +Y  +A+ W PWL  E+    + G FY+    
Sbjct  129  YAALGNHDFHPKNQFPA-------QSNRIYNQVAELWRPWLSNESYALFKRGAFYSEKLP  181

Query  373  -PYPGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGDKVHIIGHIPPG  431
             P    R++ LN N     N        DP  Q +WL   L  A   G+ V++IGH+PPG
Sbjct  182  GPSRAGRVVVLNTNLYYSNN-EQTAGMADPGEQFRWLGDVLSNASRDGEMVYVIGHVPPG  240

Query  432  HCLK---------SWSWNYYRIVARYENTLAAQFFGHTHVDEFEVFYDEETLSRPLAVAF  482
               K         S++  Y +++ ++   +A QFFGH H D F +FYD      P+ V F
Sbjct  241  FFEKTQNKAWFRESFNEEYLKVIQKHHRVIAGQFFGHHHTDSFRMFYD--NTGAPINVMF  298

Query  483  LAPSA----TTYIGL-----NPGYRVYQIDGNYSGSSHVVLDHETYILNLTQANIPGAIP  533
            L P      TT  G+     NPG R+++    Y  ++  + D  TY LNL QAN+    P
Sbjct  299  LTPGVTPWKTTLPGVVDGANNPGIRIFE----YDRATLNLKDLVTYFLNLRQANVQ-ETP  353

Query  534  HWQLLYRARETYGLPNTLPTAWHNLVYRMRGDMQLFQTFWFLYHKGHPPSEPCGTPCRLA  593
             W+  YR  E Y +P+   ++ H  + R+  +  + Q + ++Y+        C   CR+ 
Sbjct  354  RWEQEYRLTEAYQVPDASVSSMHTALTRIASEPHILQRY-YVYNSVSYNHLTCEDSCRIE  412

Query  594  TLCAQLSARADSPALCRH  611
             +CA      ++ A C H
Sbjct  413  HVCAIQHVAFNTYATCLH  430


>sp|Q55GC7|SGMD_DICDI Sphingomyelinase phosphodiesterase D OS=Dictyostelium 
discoideum OX=44689 GN=sgmD PE=3 SV=1
Length=438

 Score = 104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 93/354 (26%), Positives = 150/354 (42%), Gaps = 47/354 (13%)

Query  241  PGAGYWGEYSKCDLPLRTLESLLSGLGPAGPF-DMVYWTGDIPAHDV----WHQTRQDQL  295
            P  G +G Y  CD     L  ++S +       D + +TGD   H +    W +++    
Sbjct  72   PTNGLYGRYG-CDTNQLLLSEVISEMLNVNSNPDFIIYTGDGAGHGLPNGPWSESQ----  126

Query  296  RALTTVTALVRKFLGPVP---VYPAVGNHESTPVNSFPPPFIEGNHSS-RWLYEAMAKAW  351
                  + L +   G  P     P +GN++      FP    + N S+ ++LYE     W
Sbjct  127  ------STLAKSLYGAYPNTQFIPTIGNNDV-----FPDYNSQCNDSNLQFLYET----W  171

Query  352  EPWLPAEALRTLRIGGFYALSPYPGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVGE  411
              W+P   + +    G + +SP  GL +ISLN    S +N        DP GQ  WL  +
Sbjct  172  AQWIPTNQVSSFLYRGSFVVSPVSGLTIISLNTILYSVKNKNTFSTPQDPCGQFAWLEQQ  231

Query  412  LQAAEDRGDKVHIIGHIPPG----HCLKSWSWNY----YRIVARYENTLAAQFFGHTHVD  463
            L AA+  G+ V+IIGHI PG    +   +W   Y    + I + Y+ T+ A FFGH H D
Sbjct  232  LIAAKQAGNSVYIIGHIFPGLDPFYLQGTWKSQYQTAFFNITSDYQTTITAGFFGHIHRD  291

Query  464  EF-EVFYDEETLSRPLAV-AFLAPSATTYIGLNPGYRVYQIDGNYSGSSHVVLDHETYIL  521
            E   + +D  +L+       F+  S T     NP ++ +     Y   S  + D   Y  
Sbjct  292  EIRSIQFDNPSLTNNHYFPMFIGSSITPVYFNNPTFKQFT----YDSQSKNITDITAYFS  347

Query  522  NLTQANIPGAIPHWQLLYRARETYGLPNTLPTA---WHNLVYRMRGDMQLFQTF  572
            ++  +N+ G + +W   Y     Y + N         ++L+ RM     +F  +
Sbjct  348  DVYISNLKGHM-NWTEEYDFVSIYDIDNQYGIGGDQLNSLMERMVSSNSIFNNY  400


>sp|Q9C1W8|PPN1_SCHPO Endopolyphosphatase OS=Schizosaccharomyces 
pombe (strain 972 / ATCC 24843) OX=284812 GN=ppn1 PE=3 SV=1
Length=577

 Score = 85.1 bits (209),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 99/367 (27%), Positives = 157/367 (43%), Gaps = 52/367 (14%)

Query  195  APGAP-VSRILFLTDLHWDHDYLEGTDPDCADPLC--CRRGSGLPPASRPGAGYW--GEY  249
            + G P V R L +TD+H D  Y +G+     D  C      S   P  +   GY   G  
Sbjct  40   SKGKPLVGRFLHITDMHPDIYYEKGS---TVDHYCHSYDHNSDDTPLGKSKVGYLSPGPG  96

Query  250  SKCD----LPLRTLESLLSGLGPA-GPFDMVYWTGDIPAHDVWHQTRQDQLRALTTVTAL  304
             +CD    L  +TLE L        G  D + WTGD   HD  +   + Q   L +   L
Sbjct  97   YECDSSPALIDKTLEWLKEHQDDVLGGIDFILWTGDNSRHDNDNHFPRTQSEILASNEDL  156

Query  305  VRKFLG---PVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALR  361
            V K +     VP+  A+GN++  P N      +E   SS  +   +A AW+  +P E   
Sbjct  157  VNKMIEAFPDVPIVSAIGNNDIYPHN-----IMEAGPSS--MTRQLAGAWDALIPYEERH  209

Query  362  TLRIGGFYALSPYPG-LRLISLNMNFCSRENFWLL---INSTDPAGQL--QWLVGELQAA  415
            T   G +Y     P  L  IS+N  + S +N  +     ++ D  G L  +W   +L+A 
Sbjct  210  TFEKGSYYLCDVIPDKLAAISINTLYLSNKNAAVDGCPDDNLDEPGSLFMRWFKIQLEAY  269

Query  416  EDRGDKVHIIGHIPP--GHCLKSWSWNYYRIVARYENTLAAQFFGHTHVDEFEVFYDEET  473
              +G KV ++GHIPP  G   +    ++  ++  + + +  Q +GH +++ F VF + + 
Sbjct  270  RLKGMKVWLLGHIPPTRGQWYEDCYTSFTDLLYEFRDIIVGQLYGHMNINHF-VFLEFDK  328

Query  474  LSRPLAVAFLAPSATTYIGLN---PGYRVYQIDGNYSGSSHVVLDHETYILNLTQANIPG  530
            L          P  T   G+    P Y    ID  Y+       +  T+  NLT+  + G
Sbjct  329  L----------PVDTESYGIKSAQPKYVKSLIDAQYA-------ELPTFPENLTEEFLNG  371

Query  531  AIPHWQL  537
             + ++ L
Sbjct  372  TVGNYSL  378


>sp|Q9P3S1|PPN1_NEUCR Endopolyphosphatase OS=Neurospora crassa 
(strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 
987) OX=367110 GN=epp-1 PE=3 SV=3
Length=731

 Score = 84.7 bits (208),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 83/314 (26%), Positives = 130/314 (41%), Gaps = 42/314 (13%)

Query  202  RILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGEYSKCDLPLRTLES  261
            + L +TDLH D  Y   +  D AD   C RG G      P   Y  E S CD P   + +
Sbjct  56   KFLHITDLHPDQFYKPHSSTDEAD--ACHRGKG------PAGVYGAEVSDCDSPFALINA  107

Query  262  LLSGLGP--AGPFDMVYWTGDIPAHDVWHQTRQDQLRALTTVTALVRKFLG---------  310
                +        D V WTGD   HD      ++  + L T   +  K            
Sbjct  108  TFDWIAANVKDDIDFVIWTGDTARHDSDEGVPRNADQVLGTNRWIADKMAELFSDSTGRH  167

Query  311  -PVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGGFY  369
              +P+ P +GN++  P N   P    G +S  WL +     W  ++P     + + GG++
Sbjct  168  LEIPIVPTLGNNDILPHNILLP----GPNS--WL-QHYTHIWRRFVPEAQRHSFQFGGWF  220

Query  370  ALSPYPG-LRLISLNMNFCSRENFWL--LINSTDPA-GQLQWLVGELQAAEDRGDKVHII  425
             +   P  L + SLN  +    N       + ++P   Q++WL  +L    +RG K  ++
Sbjct  221  YVEVIPNRLAIFSLNTLYFFDRNAGTDGCASPSEPGYKQMEWLRIQLHIMRERGMKAILM  280

Query  426  GHIPPGHC--LKSWS---WNYYRI-VARYENTLAAQFFGHTHVDEFEVFYDEETLSRPLA  479
            GH+PP      K W    W  Y + + +Y + + +  FGH ++D F   +DE    R + 
Sbjct  281  GHVPPARTDSKKLWDENCWQKYSLWLRQYRDVVVSGVFGHMNIDHF-FIHDE----RDIN  335

Query  480  VAFLAPSATTYIGL  493
            V  LA  A   I +
Sbjct  336  VGQLAGLADNSIDI  349


>sp|Q5KH67|PPN1_CRYNJ Endopolyphosphatase OS=Cryptococcus neoformans 
var. neoformans serotype D (strain JEC21 / ATCC MYA-565) 
OX=214684 GN=PPN1 PE=3 SV=1
Length=678

 Score = 84.7 bits (208),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 69/247 (28%), Positives = 109/247 (44%), Gaps = 22/247 (9%)

Query  243  AGYWGE-YSKCDLPLRTLESLLSGLGP--AGPFDMVYWTGDIPAHDVWHQTRQDQLRALT  299
            AG WG   S CD P+  +      L    A   D V WTGD   HD+  +  +       
Sbjct  120  AGKWGTAVSDCDCPMSLVNITFDWLKEEWANEVDFVVWTGDNARHDIDRRIPRTPKEIFD  179

Query  300  TVTALVRKFLG----PVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWL  355
            +   +V + L      +P+ P++GN++  P N      +     SR + E     W+ ++
Sbjct  180  SNRMIVDRMLDAFGRDMPIVPSIGNNDIYPHN------VLAAGPSR-ITEEFLLIWKHFI  232

Query  356  PAEALRTLRIGGFYALSPYPG-LRLISLNMNFCSRENFWL---LINSTDPAG-QLQWLVG  410
            P+EA      G ++++   P  L +ISLN  F    N  +     +S DP   ++ WL  
Sbjct  233  PSEAAHVFERGAYFSVEVIPDRLAVISLNTLFWYDANTLVDGCRDHSNDPGALEMDWLEV  292

Query  411  ELQAAEDRGDKVHIIGHIPP--GHCLKSWSWNYYRIVARYENTLAAQFFGHTHVDEFEVF  468
            +L     RG +V + GH+PP   H   +    Y  +  RY++T+    FGH +VD F  F
Sbjct  293  QLNNFRQRGMQVWLTGHVPPHMNHYYDNCYLRYGDLALRYQDTIVGHLFGHMNVDHF-FF  351

Query  469  YDEETLS  475
             D + L 
Sbjct  352  IDVDELE  358


>sp|Q6FMQ0|PPN1_CANGA Endopolyphosphatase OS=Candida glabrata 
(strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL 
Y-65 / CBS 138) OX=284593 GN=PPN1 PE=3 SV=1
Length=663

 Score = 76.6 bits (187),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 79/289 (27%), Positives = 124/289 (43%), Gaps = 41/289 (14%)

Query  202  RILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGE-YSKCDLPLRTLE  260
            R L +TD+H D  Y+ GT     D +C    SG P   +  A  +G   S CD P+  ++
Sbjct  86   RFLHITDMHPDEYYVAGT---SIDNVC---HSGEPTKGKDRAAKFGNAMSGCDSPMLLMD  139

Query  261  SLLSGLGP--AGPFDMVYWTGDIPAHD---VWHQTRQDQLRALTTVTALVRK-FLGP---  311
              L  +        D V WTGD   HD    + +T  +  R    V   ++K F  P   
Sbjct  140  MTLDWIDKNLKDQIDFVVWTGDNIRHDNDRTYPRTEDEIFRMNAEVAEKIKKIFRTPNSP  199

Query  312  ------VPVYPAVGNHESTPVNSFP-PPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLR  364
                  VPV P++GN++  P N F   P ++    +R  Y    + W  ++P E  R   
Sbjct  200  DPRDFAVPVVPSIGNNDVFPHNLFSLGPTLQ----TREYY----RLWGDFIPEEQQRMFD  251

Query  365  IGGFYALSPYPG-LRLISLNMNFCSRENFWLLINSTDPAGQ-----LQWLVGELQAAEDR  418
                +     PG L ++S N  +  + N   L+++ D   Q     L WL   L    +R
Sbjct  252  RDASFFTEVIPGKLAVLSFNTLYLFKAN--PLVDNCDSRKQPGYQLLLWLGYVLDEIRER  309

Query  419  GDKVHIIGHIPP-GHCLKSWSWNYYRI-VARYENTLAAQFFGHTHVDEF  465
            G KV I GH+PP      S  ++ + + +  Y + +    +GH ++D F
Sbjct  310  GMKVWISGHVPPIAKNYDSSCYDKFSLWMHEYRDVIIGGLYGHMNMDHF  358


>sp|Q6BKG0|PPN1_DEBHA Endopolyphosphatase OS=Debaryomyces hansenii 
(strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / 
NBRC 0083 / IGC 2968) OX=284592 GN=PPN1 PE=3 SV=3
Length=713

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 80/312 (26%), Positives = 125/312 (40%), Gaps = 54/312 (17%)

Query  184  PKPPPKPPSPPAPGAPVSRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGA  243
            PKP  K            R L +TD+H D  Y  G D        C  G G   A + G 
Sbjct  78   PKPKLKIVKGGDEQVLHGRFLHITDMHPDKYYKTGADVGS----LCHSGKG--SAGKYGD  131

Query  244  GYWGEYSKCDLPLRTLESLLSGLGP--AGPFDMVYWTGDIPAHD---VWHQTRQDQLRAL  298
               G    CD P+  +E  L  +        D V WTGD   HD    + +T  +     
Sbjct  132  AVLG----CDSPMVLMEDTLKWVKENLKDKIDFVVWTGDNVRHDNDRRYPRTESNIFDMN  187

Query  299  TTVTALVRKFLG------------PVPVYPAVGNHESTPVNSFPP-PFIEGNHSSRWLYE  345
              V+ L+ +                +P+ P++GN++  P N F P P ++    +R L+ 
Sbjct  188  QRVSELMYETFKEENPRGGRPRQLKIPLVPSLGNNDVFPHNLFSPGPTLQ----TRELF-  242

Query  346  AMAKAWEPWLPAEALRTLRIGGFYALSPYPG-LRLISLNMNFCSRENFWLLIN---STDP  401
               K W  ++PA  L     G ++     P  L ++S+N  +  + N  L+ N     DP
Sbjct  243  ---KIWHDFVPAAQLHIFNRGAYFFKEIIPNELAVLSINTLYLFQSN-PLVDNCDRKKDP  298

Query  402  AGQL-QWLVGELQAAEDRGDKVHIIGHIPPGH------CLKSW-SWNYYRIVARYENTLA  453
              +L +WL   L+    R  KV + GH+PP        CL+ +  W     +  Y + + 
Sbjct  299  GHKLFEWLGYTLKEMRARNMKVWLSGHVPPNEKNYDISCLRKYIVW-----MHEYRDVII  353

Query  454  AQFFGHTHVDEF  465
               +GH ++D F
Sbjct  354  GGLYGHMNIDHF  365


>sp|Q756F2|PPN1_EREGS Endopolyphosphatase OS=Eremothecium gossypii 
(strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) 
OX=284811 GN=PPN1 PE=3 SV=2
Length=594

 Score = 65.9 bits (159),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 76/291 (26%), Positives = 113/291 (39%), Gaps = 46/291 (16%)

Query  202  RILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGE-YSKCDLPLRTLE  260
            R L +TD+H D  Y+EG+    A    C        + R  AG +G+    CD P+  + 
Sbjct  70   RFLHITDIHPDPLYVEGSSIAGA----CHGDPARDASDR--AGRFGDAMGGCDAPMDLMN  123

Query  261  SLLSGLGP--AGPFDMVYWTGDIPAHD-----------VWHQTRQ--DQLRALTTVTALV  305
              L+ +        D V WTGD   HD           + H   Q  DQ   L       
Sbjct  124  YTLAWVATHLRDEIDFVVWTGDNARHDNDRRQPRTAEQILHMNAQVADQFYELFQQQRDG  183

Query  306  RKFLGPVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRI  365
                G VPV P++GN++  P N F       +     +   + + W  ++P E  +    
Sbjct  184  DTMQG-VPVVPSLGNNDVFPHNMF-------SLGPTLMTRQLQRIWAKFIPEEQRQAFEH  235

Query  366  GGFYALSPYPG-LRLISLNMNFCSRENFWLLINSTDPA----GQLQWLVGELQAAEDRGD  420
               + +   P  L +IS N  +  + N  L+ N  D A      L WL   L+    R  
Sbjct  236  DTSFFVEVIPDRLAVISFNTLYFFKSNP-LVDNCNDKAQPGHALLLWLGSVLEEMRARNM  294

Query  421  KVHIIGHIPP------GHCLKSWSWNYYRIVARYENTLAAQFFGHTHVDEF  465
            KV + GH+PP      G C    +W  Y     Y + +    +GH +VD F
Sbjct  295  KVWLSGHVPPIPKNFEGSCYNKLAWWTY----EYRDVIIGGLYGHMNVDHF  341


>sp|Q6CWT7|PPN1_KLULA Endopolyphosphatase OS=Kluyveromyces lactis 
(strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL 
Y-1140 / WM37) OX=284590 GN=PPN1 PE=3 SV=1
Length=681

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 86/315 (27%), Positives = 125/315 (40%), Gaps = 46/315 (15%)

Query  179  SLPTVPKPPPKPPSPPAPGAPVS-RILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPP  237
            SL   P  P K          +  R L +TD+H D  Y E T  D      C RG   P 
Sbjct  87   SLGLTPNQPVKITDIGGKEKSIKGRFLHITDMHPDLYYKENTSIDD----TCHRGK--PK  140

Query  238  ASRPGAGYWGEYSK-CDLP----LRTLESLLSGLGPAGPFDMVYWTGDIPAHDVWHQ---  289
                 A  +G   K CD P      TL+ +   L  +   D + WTGD   HD   +   
Sbjct  141  NDGDRAARFGNAMKGCDGPPDLMYYTLDWIHKNL--SDEIDFIIWTGDNVRHDNDRRIPR  198

Query  290  TRQDQLRALTTVTALVRKFLG----------PVPVYPAVGNHESTPVNSFPP-PFIEGNH  338
            T Q        V+ L  K              V + P++GN++  P N F P P ++   
Sbjct  199  TEQQIFDMNRQVSELFLKTFKDHESDDPRDLKVKIIPSLGNNDVFPHNLFSPGPTLQ---  255

Query  339  SSRWLYEAMAKAWEPWLPAEALRTLRIGGFYALSPYPG-LRLISLNMNFCSRENFWLLIN  397
             +R LY+     W  ++P     T      + +   PG L +ISLN  +  + N   L++
Sbjct  256  -TRELYDI----WSQFIPPAQQNTFDRYASFFVEAIPGKLAVISLNTLYMFKGN--PLVD  308

Query  398  STDPAGQ-----LQWLVGELQAAEDRGDKVHIIGHIP--PGHCLKSWSWNYYRIVARYEN  450
            +     Q     L W+   LQ   DRG KV + GH+P  P +   S S      +  Y +
Sbjct  309  NCSNKKQPGYKMLLWVGFTLQELRDRGMKVWLSGHVPPIPKNFDSSCSDKLALWLHEYSD  368

Query  451  TLAAQFFGHTHVDEF  465
             +   F+GH ++D F
Sbjct  369  IIIGGFYGHMNMDHF  383


>sp|Q04119|PPN1_YEAST Endopolyphosphatase OS=Saccharomyces cerevisiae 
(strain ATCC 204508 / S288c) OX=559292 GN=PPN1 PE=1 
SV=1
Length=674

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 73/291 (25%), Positives = 124/291 (43%), Gaps = 45/291 (15%)

Query  202  RILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGE-YSKCDLPLRTLE  260
            R L +TD+H D  Y+EG+     D +C    +G P   +  A  +G+  S CD P+  +E
Sbjct  96   RFLHITDIHPDPYYVEGS---SIDAVC---HTGKPSKKKDVAPKFGKAMSGCDSPVILME  149

Query  261  SLLSGLGPA--GPFDMVYWTGDIPAHD--VWHQTRQDQLRALTTVTA--LVRKFLG----  310
              L  +        D V WTGD   HD    H   + Q+  +  + A  +   F      
Sbjct  150  ETLRWIKENLRDKIDFVIWTGDNIRHDNDRKHPRTEAQIFDMNNIVADKMTELFSAGNEE  209

Query  311  -----PVPVYPAVGNHESTPVNSFP-PPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLR  364
                  V V P++GN++  P N F   P ++    +R  Y    + W+ ++P +  RT  
Sbjct  210  DPRDFDVSVIPSLGNNDVFPHNMFALGPTLQ----TREYY----RIWKNFVPQQQQRTFD  261

Query  365  IGGFYALSPYPG-LRLISLNMNFCSRENFWLLINSTDPAGQ-----LQWLVGELQAAEDR  418
                +     PG L ++S+N  +  + N   L+++ +   +     L W    L+    R
Sbjct  262  RSASFLTEVIPGKLAVLSINTLYLFKAN--PLVDNCNSKKEPGYQLLLWFGYVLEELRSR  319

Query  419  GDKVHIIGHIPPGHCLKSWSWNYYRIVA----RYENTLAAQFFGHTHVDEF  465
            G KV + GH+PP    K++  + Y         Y + +    +GH ++D F
Sbjct  320  GMKVWLSGHVPP--IAKNFDQSCYDKFTLWTHEYRDIIIGGLYGHMNIDHF  368


>sp|Q6CEE7|PPN1_YARLI Endopolyphosphatase OS=Yarrowia lipolytica 
(strain CLIB 122 / E 150) OX=284591 GN=PPN1 PE=3 SV=1
Length=747

 Score = 53.9 bits (128),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 67/266 (25%), Positives = 99/266 (37%), Gaps = 53/266 (20%)

Query  241  PGAGYWGE-YSKCDLPLRTLESLLSGLGPA--GPFDMVYWTGDIPAHDV---WHQTRQDQ  294
            P AGY+G   S CD P+  + +    +        D + WTGD   HD    + +  QD 
Sbjct  114  PKAGYYGHPLSSCDGPISLMNATFDWIDQNIRDEIDFIIWTGDNVRHDNDNRYPRLEQDI  173

Query  295  LRALTTVTALVRKFLG--------------------PVPVYPAVGNHESTPVNSF--PPP  332
                  V++   +                        +P+ P++GN++  P N +   P 
Sbjct  174  FGYNQIVSSKFHELFRYNETRDGEGHNGGGDPQHPLVIPIIPSLGNNDVFPHNLYLAGPS  233

Query  333  FIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGGFYALSPYPG-LRLISLNMNFCSREN  391
            F     S R     M + W  ++P         G +Y      G L +ISLN  +  + N
Sbjct  234  F----QSRR-----MLQIWSEFVPEAQQHIFSRGSYYFQEVITGKLAVISLNTLYFYKSN  284

Query  392  FWL--LINSTDPA-GQLQWLVGELQAAEDRGDKVHIIGHIPP------GHC-LKSWSWNY  441
                     TDP    L WL   L     RG KV + GH+PP        C LK   W  
Sbjct  285  PMSDGCDEKTDPGYKHLVWLGVVLDEMRQRGMKVWLSGHVPPVEKNYEDSCHLKLAYW--  342

Query  442  YRIVARYENTLAAQFFGHTHVDEFEV  467
               +  Y + +    FGH ++D F V
Sbjct  343  ---LTEYRDIIVGSVFGHMNIDHFVV  365


>sp|Q75EN9|CCZ1_EREGS Vacuolar fusion protein CCZ1 OS=Eremothecium 
gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / 
NRRL Y-1056) OX=284811 GN=CCZ1 PE=3 SV=1
Length=663

 Score = 35.8 bits (81),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 22/74 (30%), Positives = 30/74 (41%), Gaps = 6/74 (8%)

Query  208  DLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGEYSK------CDLPLRTLES  261
            D  WD DYL+  D    D +    GS +   ++PG   +G ++K      C LPL     
Sbjct  407  DKIWDPDYLQAIDAKLYDAMLQLEGSVVTEDNKPGRFAYGVFNKTTKRIECSLPLLRFSD  466

Query  262  LLSGLGPAGPFDMV  275
              S      P  MV
Sbjct  467  KRSDEKSRQPLKMV  480


>sp|B0SUK3|THIE_CAUSK Thiamine-phosphate synthase OS=Caulobacter 
sp. (strain K31) OX=366602 GN=thiE PE=3 SV=1
Length=219

 Score = 35.0 bits (79),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 49/110 (45%), Gaps = 19/110 (17%)

Query  72   RLHRIVP-RLRDVFGWG-NLTCPICKGLFTAINLGLKKEPN------------VARVGSV  117
            RL+ I P  L D+  +G +L   +  G   A+ + LK  P+            +AR   V
Sbjct  5    RLYLITPPALDDLAAFGHDLAAALDGGDVAALQIRLKDAPDDIIAAAVQVLSPIARARDV  64

Query  118  AIKLCNLLKIAPPAVCQSIVHLFEDDMVEVWRRSVLSPSEACGLLLGSTC  167
            A+ L +   +A    C   VHL +DDM     R ++ P    G ++G TC
Sbjct  65   AVILNDRPDLAARLGCDG-VHLGQDDMPLAQARKLMGP----GAMIGVTC  109


>sp|Q8H5F8|ADPRM_ORYSJ Manganese-dependent ADP-ribose/CDP-alcohol 
diphosphatase OS=Oryza sativa subsp. japonica OX=39947 GN=Os07g0688000 
PE=2 SV=1
Length=321

 Score = 34.7 bits (78),  Expect = 2.6, Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 44/110 (40%), Gaps = 16/110 (15%)

Query  393  WLLINSTDPAGQLQWLVGELQAAEDRGDKVHIIGHIP--PGHC-LKSWSWNYYRIVA--R  447
            +++ N      QL WL   LQ A  R   V +  H+P  PG     +  WNY  ++A  R
Sbjct  192  FVMFNGGVGKEQLSWLNDVLQDASARRQNVILCSHLPMDPGSASFAALMWNYDEVMAIVR  251

Query  448  YENTLAAQFFGHTH-----VDEFEVFYDEETLSRPLAVAFLAPSATTYIG  492
                + A F GH H     VD   V +      R L  A   P  T+  G
Sbjct  252  QYKCVKACFAGHDHKGGHSVDSHGVHH------RTLEAALECPPGTSAFG  295


>sp|Q99NB2|B3GN5_RAT Lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase 
OS=Rattus norvegicus OX=10116 GN=B3gnt5 
PE=2 SV=2
Length=377

 Score = 33.9 bits (76),  Expect = 4.3, Method: Compositional matrix adjust.
 Identities = 16/60 (27%), Positives = 24/60 (40%), Gaps = 0/60 (0%)

Query  52   SRVLWAPAEAHPLSPQGHPARLHRIVPRLRDVFGWGNLTCPICKGLFTAINLGLKKEPNV  111
             R++W     H +  Q      H +  +    FGW N  CP  + L TA +      PN+
Sbjct  143  KRLIWEDQVYHDIIQQDFTDSFHNLTFKFLLQFGWANTFCPHARFLMTADDDIFIHMPNL  202


>sp|Q9SB68|ADPRM_ARATH Manganese-dependent ADP-ribose/CDP-alcohol 
diphosphatase OS=Arabidopsis thaliana OX=3702 GN=At4g24730 
PE=2 SV=1
Length=311

 Score = 33.5 bits (75),  Expect = 5.5, Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 43/96 (45%), Gaps = 10/96 (10%)

Query  404  QLQWLVGELQAAEDRGDKVHIIGHIP--PGHCLK-SWSWNY---YRIVARYENTLAAQFF  457
            QLQWL   LQ A +   +V + GH+P  PG   K +  WN+     I+ +Y+ ++     
Sbjct  195  QLQWLDSVLQDASNSNQRVIVCGHVPMSPGVASKAALLWNFDEVMNIIHKYD-SVKVCLS  253

Query  458  GHTHVDEFEVFYDEETL-SRPLAVAFLAPSATTYIG  492
            GH H   +  F D   +  R L  A   P  T   G
Sbjct  254  GHDHKGGY--FVDSHGVHHRSLEAALECPPGTYSFG  287


>sp|P26779|SAP_BOVIN Prosaposin OS=Bos taurus OX=9913 GN=PSAP 
PE=1 SV=3
Length=525

 Score = 33.5 bits (75),  Expect = 7.9, Method: Compositional matrix adjust.
 Identities = 26/98 (27%), Positives = 42/98 (43%), Gaps = 7/98 (7%)

Query  62   HPLSPQGHPARLHRIVPRLRDVFGWGNLTCPICKGLFTAINLGLKKEPNVARVGSVAIKL  121
            H  S +G PA   R++PR    F      C +CK L   ++  L+K     ++ +   K 
Sbjct  387  HLCSSRGLPAATVRVMPRKDGGF------CEVCKKLVGYLDRNLEKNSTKEQILAALEKG  440

Query  122  CNLLKIAPPAVCQSIVHLFEDDMVEVWRRSVLSPSEAC  159
            C+ L       C   V  +E  ++E+    V+ PS  C
Sbjct  441  CSFLPDQYRKQCDQFVTEYEPVLIEILVE-VMDPSFVC  477


>sp|Q03L46|METE_STRTD 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase OS=Streptococcus thermophilus 
(strain ATCC BAA-491 / LMD-9) OX=322159 GN=metE PE=3 SV=1
Length=749

 Score = 33.1 bits (74),  Expect = 9.9, Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 27/48 (56%), Gaps = 1/48 (2%)

Query  434  LKSW-SWNYYRIVARYENTLAAQFFGHTHVDEFEVFYDEETLSRPLAV  480
            +K W + NY+ IV ++E T A +  GH   DE++   D    +RP+ V
Sbjct  112  MKKWFNTNYHYIVPKFEKTTAVKLAGHKIFDEYQEAKDLGLDTRPVVV  159



Lambda      K        H        a         alpha
   0.322    0.139    0.468    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 68870589996
Results from round 2


Query= sp|P17405|ASM_HUMAN Sphingomyelin phosphodiesterase OS=Homo sapiens
OX=9606 GN=SMPD1 PE=1 SV=5

Length=631
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value
Sequences used in model and found again:

sp|P17405|ASM_HUMAN Sphingomyelin phosphodiesterase OS=Homo sapie...  897     0.0   
sp|Q0VD19|ASM_BOVIN Sphingomyelin phosphodiesterase OS=Bos taurus...  867     0.0   
sp|Q04519|ASM_MOUSE Sphingomyelin phosphodiesterase OS=Mus muscul...  864     0.0   
sp|Q23498|ASM2_CAEEL Sphingomyelin phosphodiesterase 2 OS=Caenorh...  666     0.0   
sp|Q9UAY4|ASM3_CAEEL Putative sphingomyelin phosphodiesterase asm...  609     0.0   
sp|Q10916|ASM1_CAEEL Sphingomyelin phosphodiesterase 1 OS=Caenorh...  604     0.0   
sp|Q54C16|SGMB_DICDI Sphingomyelin phosphodiesterase B OS=Dictyos...  564     0.0   
sp|Q55C09|SGMA_DICDI Sphingomyelin phosphodiesterase A OS=Dictyos...  552     0.0   
sp|Q641Z7|ASM3A_RAT Cyclic GMP-AMP phosphodiesterase SMPDL3A OS=R...  473     2e-161
sp|Q92484|ASM3A_HUMAN Cyclic GMP-AMP phosphodiesterase SMPDL3A OS...  469     5e-160
sp|P70158|ASM3A_MOUSE Cyclic GMP-AMP phosphodiesterase SMPDL3A OS...  468     8e-160
sp|Q3ZC91|ASM3A_BOVIN Cyclic GMP-AMP phosphodiesterase SMPDL3A OS...  465     2e-158
sp|Q92485|ASM3B_HUMAN Acid sphingomyelinase-like phosphodiesteras...  458     2e-155
sp|P58242|ASM3B_MOUSE Acid sphingomyelinase-like phosphodiesteras...  441     6e-149
sp|Q54SR8|SGMC_DICDI Sphingomyelinase phosphodiesterase C OS=Dict...  426     2e-143
sp|Q9C1W8|PPN1_SCHPO Endopolyphosphatase OS=Schizosaccharomyces p...  315     2e-98 
sp|Q6FMQ0|PPN1_CANGA Endopolyphosphatase OS=Candida glabrata (str...  317     3e-98 
sp|Q6BKG0|PPN1_DEBHA Endopolyphosphatase OS=Debaryomyces hansenii...  313     4e-96 
sp|Q55GC7|SGMD_DICDI Sphingomyelinase phosphodiesterase D OS=Dict...  304     5e-96 
sp|Q6CWT7|PPN1_KLULA Endopolyphosphatase OS=Kluyveromyces lactis ...  310     2e-95 
sp|Q04119|PPN1_YEAST Endopolyphosphatase OS=Saccharomyces cerevis...  308     7e-95 
sp|Q5KH67|PPN1_CRYNJ Endopolyphosphatase OS=Cryptococcus neoforma...  302     2e-92 
sp|Q756F2|PPN1_EREGS Endopolyphosphatase OS=Eremothecium gossypii...  296     5e-91 
sp|Q9P3S1|PPN1_NEUCR Endopolyphosphatase OS=Neurospora crassa (st...  295     2e-89 
sp|Q6CEE7|PPN1_YARLI Endopolyphosphatase OS=Yarrowia lipolytica (...  277     5e-82 

Sequences not found previously or not previously below threshold:

sp|P07602|SAP_HUMAN Prosaposin OS=Homo sapiens OX=9606 GN=PSAP PE...  53.2    6e-06
sp|P10960|SAP_RAT Prosaposin OS=Rattus norvegicus OX=10116 GN=Psa...  51.7    2e-05
sp|Q61207|SAP_MOUSE Prosaposin OS=Mus musculus OX=10090 GN=Psap P...  50.9    3e-05
sp|Q9SB68|ADPRM_ARATH Manganese-dependent ADP-ribose/CDP-alcohol ...  50.1    3e-05
sp|P20097|SAP_CAVPO Saposin-C OS=Cavia porcellus OX=10141 GN=PSAP...  45.9    3e-05
sp|P38887|YH02_YEAST Uncharacterized protein YHR202W OS=Saccharom...  50.5    4e-05
sp|Q8C1C1|SAPL1_MOUSE Proactivator polypeptide-like 1 OS=Mus musc...  50.1    4e-05
sp|Q28FE0|CPPED_XENTR Serine/threonine-protein phosphatase CPPED1...  49.4    5e-05
sp|P26779|SAP_BOVIN Prosaposin OS=Bos taurus OX=9913 GN=PSAP PE=1...  48.6    1e-04
sp|O13035|SAP_CHICK Prosaposin OS=Gallus gallus OX=9031 GN=PSAP P...  47.4    3e-04
sp|Q5U3W0|CPPED_DANRE Serine/threonine-protein phosphatase CPPED1...  45.9    7e-04
sp|Q5RCR9|CPPED_PONAB Serine/threonine-protein phosphatase CPPED1...  45.9    7e-04
sp|Q3LIE5|ADPRM_HUMAN Manganese-dependent ADP-ribose/CDP-alcohol ...  45.5    0.001
sp|Q8BFS6|CPPED_MOUSE Serine/threonine-protein phosphatase CPPED1...  44.7    0.001
sp|Q9BRF8|CPPED_HUMAN Serine/threonine-protein phosphatase CPPED1...  44.0    0.003
sp|A7YY53|ADPRM_BOVIN Manganese-dependent ADP-ribose/CDP-alcohol ...  42.4    0.009
sp|Q99KS6|ADPRM_MOUSE Manganese-dependent ADP-ribose/CDP-alcohol ...  42.4    0.009
sp|Q76LX8|ATS13_HUMAN A disintegrin and metalloproteinase with th...  42.8    0.012
sp|Q6NUJ1|SAPL1_HUMAN Proactivator polypeptide-like 1 OS=Homo sap...  41.7    0.019
sp|Q7T0Q0|ADPRM_XENLA Manganese-dependent ADP-ribose/CDP-alcohol ...  40.9    0.026
sp|Q5M886|ADPRM_RAT Manganese-dependent ADP-ribose/CDP-alcohol di...  40.9    0.031
sp|Q66JJ3|ADPRM_XENTR Manganese-dependent ADP-ribose/CDP-alcohol ...  40.5    0.040
sp|Q58DC0|CPPED_BOVIN Serine/threonine-protein phosphatase CPPED1...  40.1    0.041
sp|Q8H5F8|ADPRM_ORYSJ Manganese-dependent ADP-ribose/CDP-alcohol ...  40.1    0.047
sp|Q29075|NKL_PIG Antimicrobial peptide NK-lysin (Fragment) OS=Su...  37.8    0.072
sp|P9WL81|Y2577_MYCTU Uncharacterized protein Rv2577 OS=Mycobacte...  39.7    0.092
sp|P9WL80|Y2577_MYCTO Uncharacterized protein MT2654 OS=Mycobacte...  39.7    0.092
sp|B2W0D9|STS1_PYRTR Tethering factor for nuclear proteasome sts1...  38.2    0.16 
sp|O59759|YJM5_SCHPO Uncharacterized protein C1020.05 OS=Schizosa...  38.6    0.19 
sp|E3RPB1|STS1_PYRTT Tethering factor for nuclear proteasome sts1...  37.4    0.34 
sp|A2RSY6|TRM1L_MOUSE TRMT1-like protein OS=Mus musculus OX=10090...  37.4    0.44 
sp|Q08I43|ERI1_SCHPO 3'-5' exonuclease eri1 OS=Schizosaccharomyce...  37.0    0.50 
sp|P50405|PSPB_MOUSE Pulmonary surfactant-associated protein B OS...  37.0    0.56 
sp|Q8H129|PPA3_ARATH Purple acid phosphatase 3 OS=Arabidopsis tha...  36.6    0.56 
sp|Q7T291|ADPRM_DANRE Manganese-dependent ADP-ribose/CDP-alcohol ...  35.9    1.1  
sp|E7QJD3|YIM1_YEASZ Protein YIM1 OS=Saccharomyces cerevisiae (st...  35.9    1.2  
sp|E7LYS5|YIM1_YEASV Protein YIM1 OS=Saccharomyces cerevisiae (st...  35.9    1.2  
sp|E7KGT3|YIM1_YEASA Protein YIM1 OS=Saccharomyces cerevisiae (st...  35.9    1.2  
sp|C8ZF09|YIM1_YEAS8 Protein YIM1 OS=Saccharomyces cerevisiae (st...  35.9    1.2  
sp|B5VPS4|YIM1_YEAS6 Protein YIM1 OS=Saccharomyces cerevisiae (st...  35.9    1.2  
sp|C7GQ91|YIM1_YEAS2 Protein YIM1 OS=Saccharomyces cerevisiae (st...  35.9    1.2  
sp|B3LM39|YIM1_YEAS1 Protein YIM1 OS=Saccharomyces cerevisiae (st...  35.9    1.2  
sp|Q9SCX8|PPA17_ARATH Purple acid phosphatase 17 OS=Arabidopsis t...  35.5    1.5  
sp|A6ZML0|YIM1_YEAS7 Protein YIM1 OS=Saccharomyces cerevisiae (st...  35.1    2.0  
sp|P28625|YIM1_YEAST Protein YIM1 OS=Saccharomyces cerevisiae (st...  35.1    2.0  
sp|E7NLM5|YIM1_YEASO Protein YIM1 OS=Saccharomyces cerevisiae (st...  34.0    4.7  
sp|A5WBU9|CNPD3_PSYWF Probable cyclic nucleotide phosphodiesteras...  34.0    4.8  
sp|Q05904|SM34_LYTPI 34 kDa spicule matrix protein OS=Lytechinus ...  33.2    7.9  


>sp|P17405|ASM_HUMAN Sphingomyelin phosphodiesterase OS=Homo sapiens 
OX=9606 GN=SMPD1 PE=1 SV=5
Length=631

 Score = 897 bits (2317),  Expect = 0.0, Method: Composition-based stats.
 Identities = 631/631 (100%), Positives = 631/631 (100%), Gaps = 0/631 (0%)

Query  1    MPRYGASLRQSCPRSGREQGQDGTAGAPGLLWMGLVLALALALALALALSDSRVLWAPAE  60
            MPRYGASLRQSCPRSGREQGQDGTAGAPGLLWMGLVLALALALALALALSDSRVLWAPAE
Sbjct  1    MPRYGASLRQSCPRSGREQGQDGTAGAPGLLWMGLVLALALALALALALSDSRVLWAPAE  60

Query  61   AHPLSPQGHPARLHRIVPRLRDVFGWGNLTCPICKGLFTAINLGLKKEPNVARVGSVAIK  120
            AHPLSPQGHPARLHRIVPRLRDVFGWGNLTCPICKGLFTAINLGLKKEPNVARVGSVAIK
Sbjct  61   AHPLSPQGHPARLHRIVPRLRDVFGWGNLTCPICKGLFTAINLGLKKEPNVARVGSVAIK  120

Query  121  LCNLLKIAPPAVCQSIVHLFEDDMVEVWRRSVLSPSEACGLLLGSTCGHWDIFSSWNISL  180
            LCNLLKIAPPAVCQSIVHLFEDDMVEVWRRSVLSPSEACGLLLGSTCGHWDIFSSWNISL
Sbjct  121  LCNLLKIAPPAVCQSIVHLFEDDMVEVWRRSVLSPSEACGLLLGSTCGHWDIFSSWNISL  180

Query  181  PTVPKPPPKPPSPPAPGAPVSRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASR  240
            PTVPKPPPKPPSPPAPGAPVSRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASR
Sbjct  181  PTVPKPPPKPPSPPAPGAPVSRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASR  240

Query  241  PGAGYWGEYSKCDLPLRTLESLLSGLGPAGPFDMVYWTGDIPAHDVWHQTRQDQLRALTT  300
            PGAGYWGEYSKCDLPLRTLESLLSGLGPAGPFDMVYWTGDIPAHDVWHQTRQDQLRALTT
Sbjct  241  PGAGYWGEYSKCDLPLRTLESLLSGLGPAGPFDMVYWTGDIPAHDVWHQTRQDQLRALTT  300

Query  301  VTALVRKFLGPVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEAL  360
            VTALVRKFLGPVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEAL
Sbjct  301  VTALVRKFLGPVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEAL  360

Query  361  RTLRIGGFYALSPYPGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGD  420
            RTLRIGGFYALSPYPGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGD
Sbjct  361  RTLRIGGFYALSPYPGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGD  420

Query  421  KVHIIGHIPPGHCLKSWSWNYYRIVARYENTLAAQFFGHTHVDEFEVFYDEETLSRPLAV  480
            KVHIIGHIPPGHCLKSWSWNYYRIVARYENTLAAQFFGHTHVDEFEVFYDEETLSRPLAV
Sbjct  421  KVHIIGHIPPGHCLKSWSWNYYRIVARYENTLAAQFFGHTHVDEFEVFYDEETLSRPLAV  480

Query  481  AFLAPSATTYIGLNPGYRVYQIDGNYSGSSHVVLDHETYILNLTQANIPGAIPHWQLLYR  540
            AFLAPSATTYIGLNPGYRVYQIDGNYSGSSHVVLDHETYILNLTQANIPGAIPHWQLLYR
Sbjct  481  AFLAPSATTYIGLNPGYRVYQIDGNYSGSSHVVLDHETYILNLTQANIPGAIPHWQLLYR  540

Query  541  ARETYGLPNTLPTAWHNLVYRMRGDMQLFQTFWFLYHKGHPPSEPCGTPCRLATLCAQLS  600
            ARETYGLPNTLPTAWHNLVYRMRGDMQLFQTFWFLYHKGHPPSEPCGTPCRLATLCAQLS
Sbjct  541  ARETYGLPNTLPTAWHNLVYRMRGDMQLFQTFWFLYHKGHPPSEPCGTPCRLATLCAQLS  600

Query  601  ARADSPALCRHLMPDGSLPEAQSLWPRPLFC  631
            ARADSPALCRHLMPDGSLPEAQSLWPRPLFC
Sbjct  601  ARADSPALCRHLMPDGSLPEAQSLWPRPLFC  631


>sp|Q0VD19|ASM_BOVIN Sphingomyelin phosphodiesterase OS=Bos taurus 
OX=9913 GN=SMPD1 PE=2 SV=1
Length=625

 Score = 867 bits (2239),  Expect = 0.0, Method: Composition-based stats.
 Identities = 535/631 (85%), Positives = 569/631 (90%), Gaps = 6/631 (1%)

Query  1    MPRYGASLRQSCPRSGREQGQDGTAGAPGLLWMGLVLALALALALALALSDSRVLWAPAE  60
            MPR+G S  Q  PRSGREQ  D + GAP       +  L L LALALAL +S VLW+PAE
Sbjct  1    MPRHGVSPGQGLPRSGREQASDRSLGAP------CLRLLWLGLALALALPNSPVLWSPAE  54

Query  61   AHPLSPQGHPARLHRIVPRLRDVFGWGNLTCPICKGLFTAINLGLKKEPNVARVGSVAIK  120
            A PL  QGHPA+  RI P+L++ FGW NLTCP CKGLFTAI+ GL+ + +VA VGSVAIK
Sbjct  55   ARPLPTQGHPAKFIRIAPQLQEAFGWWNLTCPTCKGLFTAIDFGLRNQASVAWVGSVAIK  114

Query  121  LCNLLKIAPPAVCQSIVHLFEDDMVEVWRRSVLSPSEACGLLLGSTCGHWDIFSSWNISL  180
            LC LLKIAPPAVCQS V LFEDDMVEVW RSVLSPSEACGLLLGS+CGHWDIFSSWNISL
Sbjct  115  LCVLLKIAPPAVCQSAVQLFEDDMVEVWTRSVLSPSEACGLLLGSSCGHWDIFSSWNISL  174

Query  181  PTVPKPPPKPPSPPAPGAPVSRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASR  240
            P VPKPPP+PP PPAPG+PVSR+LFLTDLHWDHDYLEGTDP+C +PLCCRR SG PPAS+
Sbjct  175  PAVPKPPPQPPKPPAPGSPVSRVLFLTDLHWDHDYLEGTDPNCENPLCCRRDSGPPPASQ  234

Query  241  PGAGYWGEYSKCDLPLRTLESLLSGLGPAGPFDMVYWTGDIPAHDVWHQTRQDQLRALTT  300
            PGAGYWGEYSKCDLPLRTLESLLSGLGPAGPFDMVYWTGDIPAH++W Q+RQDQLRALTT
Sbjct  235  PGAGYWGEYSKCDLPLRTLESLLSGLGPAGPFDMVYWTGDIPAHNIWQQSRQDQLRALTT  294

Query  301  VTALVRKFLGPVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEAL  360
            +TALV+KFLGPVPVYPAVGNHESTPVN FPPPFI+GN SS WLYEAMA+AWEPWLPAEAL
Sbjct  295  ITALVKKFLGPVPVYPAVGNHESTPVNGFPPPFIKGNQSSHWLYEAMAEAWEPWLPAEAL  354

Query  361  RTLRIGGFYALSPYPGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGD  420
            RTLRIGGFYALSP PGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGD
Sbjct  355  RTLRIGGFYALSPRPGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGD  414

Query  421  KVHIIGHIPPGHCLKSWSWNYYRIVARYENTLAAQFFGHTHVDEFEVFYDEETLSRPLAV  480
            KVHIIGHIPPGHCLKSWSWNYYRIV RYENTLA QFFGHTHVDEFEVFYDEETLSRPL+V
Sbjct  415  KVHIIGHIPPGHCLKSWSWNYYRIVERYENTLAGQFFGHTHVDEFEVFYDEETLSRPLSV  474

Query  481  AFLAPSATTYIGLNPGYRVYQIDGNYSGSSHVVLDHETYILNLTQANIPGAIPHWQLLYR  540
            AFLAPSATTYIGLNPGYRVYQIDGNYSGSSHVVLDHETYI+NLT+AN PGA PHW LLYR
Sbjct  475  AFLAPSATTYIGLNPGYRVYQIDGNYSGSSHVVLDHETYIMNLTEANEPGATPHWYLLYR  534

Query  541  ARETYGLPNTLPTAWHNLVYRMRGDMQLFQTFWFLYHKGHPPSEPCGTPCRLATLCAQLS  600
            ARETYGLPN LPTAWH+LVYRMR D QLFQTFWFLYHKGHPPSEPCGTPCRLATLCAQLS
Sbjct  535  ARETYGLPNALPTAWHDLVYRMRKDTQLFQTFWFLYHKGHPPSEPCGTPCRLATLCAQLS  594

Query  601  ARADSPALCRHLMPDGSLPEAQSLWPRPLFC  631
            AR+DSPALCRHL+PD SLP+ QSLW  PL C
Sbjct  595  ARSDSPALCRHLVPDASLPDVQSLWSMPLLC  625


>sp|Q04519|ASM_MOUSE Sphingomyelin phosphodiesterase OS=Mus musculus 
OX=10090 GN=Smpd1 PE=1 SV=2
Length=627

 Score = 864 bits (2232),  Expect = 0.0, Method: Composition-based stats.
 Identities = 519/633 (82%), Positives = 556/633 (88%), Gaps = 8/633 (1%)

Query  1    MPRYGASLRQSCPRSGREQGQDGTAGAP--GLLWMGLVLALALALALALALSDSRVLWAP  58
            MP + AS  Q   R+G EQ  + +  AP  GLLWMGL LAL       LAL DS VLW P
Sbjct  1    MPHHRASSGQDHLRAGWEQRLERSLPAPRVGLLWMGLGLAL------VLALFDSTVLWVP  54

Query  59   AEAHPLSPQGHPARLHRIVPRLRDVFGWGNLTCPICKGLFTAINLGLKKEPNVARVGSVA  118
            A A+PL  +GH  +   I P L+  FGW NLTCP CK LFTA+N GLKKEPNVARVGSVA
Sbjct  55   ARAYPLPSEGHSVKFSAIAPPLQSAFGWQNLTCPACKVLFTALNHGLKKEPNVARVGSVA  114

Query  119  IKLCNLLKIAPPAVCQSIVHLFEDDMVEVWRRSVLSPSEACGLLLGSTCGHWDIFSSWNI  178
            IK+C +L IAP  VCQS VHLFEDD+VEVW RSVLSPSEACGLLLGS+CGHWDIFS+WNI
Sbjct  115  IKICKMLNIAPLDVCQSAVHLFEDDVVEVWTRSVLSPSEACGLLLGSSCGHWDIFSTWNI  174

Query  179  SLPTVPKPPPKPPSPPAPGAPVSRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPA  238
            SLP+VPKPPPKPPSPPAPGAPVSR+LFLTDLHWDH+YLEGTDP CADPLCCRRGSG PP 
Sbjct  175  SLPSVPKPPPKPPSPPAPGAPVSRVLFLTDLHWDHEYLEGTDPYCADPLCCRRGSGWPPN  234

Query  239  SRPGAGYWGEYSKCDLPLRTLESLLSGLGPAGPFDMVYWTGDIPAHDVWHQTRQDQLRAL  298
            S+ GAG+WGEYSKCDLPLRTLESLL GLGPAGPF+MVYWTGDIPAHDVW Q+RQDQLRAL
Sbjct  235  SQKGAGFWGEYSKCDLPLRTLESLLKGLGPAGPFEMVYWTGDIPAHDVWQQSRQDQLRAL  294

Query  299  TTVTALVRKFLGPVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAE  358
            TT+T LVRKFLGPVPVYPAVGNHESTPVN FPPPFI+GN SS+WLYEAMAKAWEPWLPA+
Sbjct  295  TTITDLVRKFLGPVPVYPAVGNHESTPVNGFPPPFIKGNQSSQWLYEAMAKAWEPWLPAD  354

Query  359  ALRTLRIGGFYALSPYPGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDR  418
            AL TLRIGGFYAL+P PGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLV ELQAAE+R
Sbjct  355  ALHTLRIGGFYALTPRPGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVEELQAAENR  414

Query  419  GDKVHIIGHIPPGHCLKSWSWNYYRIVARYENTLAAQFFGHTHVDEFEVFYDEETLSRPL  478
            GDKVHIIGHIPPGHCLKSWSWNYY+I+ARYENTLA QFFGHTHVDEFE+FYDEETLSRPL
Sbjct  415  GDKVHIIGHIPPGHCLKSWSWNYYKIIARYENTLAGQFFGHTHVDEFEIFYDEETLSRPL  474

Query  479  AVAFLAPSATTYIGLNPGYRVYQIDGNYSGSSHVVLDHETYILNLTQANIPGAIPHWQLL  538
            AVAFLAPSATT+I LNPGYRVYQIDGNY GSSHVVLDHETYILNLTQAN  G  P W+ L
Sbjct  475  AVAFLAPSATTFINLNPGYRVYQIDGNYPGSSHVVLDHETYILNLTQANAAGGTPSWKRL  534

Query  539  YRARETYGLPNTLPTAWHNLVYRMRGDMQLFQTFWFLYHKGHPPSEPCGTPCRLATLCAQ  598
            YRARETYGLP+ +P +WHNLVYRMR D QLFQTFWFLYHKGHPPSEPCGTPCRLATLCAQ
Sbjct  535  YRARETYGLPDAMPASWHNLVYRMRDDEQLFQTFWFLYHKGHPPSEPCGTPCRLATLCAQ  594

Query  599  LSARADSPALCRHLMPDGSLPEAQSLWPRPLFC  631
            LSARADSPALCRHLMP+GSLP+A  LW RPL C
Sbjct  595  LSARADSPALCRHLMPNGSLPDANRLWSRPLLC  627


>sp|Q23498|ASM2_CAEEL Sphingomyelin phosphodiesterase 2 OS=Caenorhabditis 
elegans OX=6239 GN=asm-2 PE=1 SV=3
Length=618

 Score = 666 bits (1718),  Expect = 0.0, Method: Composition-based stats.
 Identities = 216/615 (35%), Positives = 329/615 (53%), Gaps = 41/615 (7%)

Query  35   LVLALALALALALALSDSRVLWAPAEAHPL----SPQGHPA-------RLHRIVPRLRDV  83
            ++L + + LAL   + +S VL  P + H      + +G+ A       ++ R   +  + 
Sbjct  6    IILGIGIVLALVSNV-ESGVLRKPVDEHEYEKWTNARGNEAAVPPPKYKMLRYAKKAINE  64

Query  84   FGWGNLTCPICKGLFTAINLGLKKEPNVARVGSVAIKLCNLLKIAPPAVCQSIVHLFEDD  143
                 ++C  C      +   + +      + +  + LC+L  +  P VC++I++ F+D+
Sbjct  65   PENRKMSCLFCTFAVDGVQALIAQNSTDNEIAAFLVNLCDLFDVEQPHVCKNIIYAFKDE  124

Query  144  MVEVWRRSVLSPSEACGLLLGSTCGHWD--IFSSWNISLPTVPKPPPKPPSPPAPGAPVS  201
            +V V  RSV +P E CG  + + CGH D  +   WNI++P   KPP KP        P  
Sbjct  125  VVFVLERSVFTPEEICGAFIAN-CGHSDKPLTHMWNITIPG-GKPPIKPWPKIPDNKPTF  182

Query  202  RILFLTDLHWDHDYLEGTDPDC-------ADPLCCRRGS----GLPPASRPG-----AGY  245
            ++L L+D+H DH Y+ GT+  C          +CCR  S    G P   +       AG 
Sbjct  183  KVLHLSDIHIDHQYVVGTEAYCQLDSALGTYAMCCRDYSQDSQGAPTNLKDKPIYVPAGP  242

Query  246  WGEYSKCDLPLRTLESLLSGLGPA-GPFDMVYWTGDIPAHDVWHQTRQDQLRALTTVTAL  304
            WG    CDLP +T ES +  +       D +  TGD  AHD W  T       +  +T +
Sbjct  243  WGMPYLCDLPYQTFESAMKHISKTFKDLDYIIITGDFEAHDSWDYTEDLTRENMNNMTNV  302

Query  305  VRKFLGPVPVYPAVGNHESTPVNSFPPPFIE--GNHSSRWLYEAMAKAWEPWLPAEALRT  362
              ++   VPVY ++GNHE  P ++  P  +        +WLY+ M++ W  W+P EAL T
Sbjct  303  FLEYFPGVPVYVSIGNHEGVPQDAMAPHTMPEYDTRGPQWLYKIMSEMWSHWIPQEALDT  362

Query  363  LRIGGFYALSPYPGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGDKV  422
            ++    YA+ P PGL+LISLN  +CS  NF+L +N  DP   L+WL+ ELQ +E++G+ V
Sbjct  363  VQYRASYAVYPKPGLKLISLNTIYCSEFNFYLYVNEVDPDATLEWLIEELQDSENKGELV  422

Query  423  HIIGHIPPG--HCLKSWSWNYYRIVARYENTLAAQFFGHTHVDEFEVFYD-EETLSRPLA  479
            HII HIPPG  +CLK WSWN++ IV RYENT+A  F+GHTH D+F V+YD ++   RP  
Sbjct  423  HIISHIPPGDNYCLKGWSWNFFEIVKRYENTIAQMFYGHTHYDQFMVYYDMDDPNRRPFH  482

Query  480  VAFLAPSATTYIGLNPGYRVYQIDGNYSGSSHVVLDHETYILNLTQANIPGAIPHWQLLY  539
              +++PS TTY  LNP YR+Y+IDG Y G+++ V D +TY  N+T+AN+    P W L Y
Sbjct  483  FNWISPSLTTYDWLNPAYRIYEIDGGYEGATYTVKDAKTYFANVTEANMKNKEPEWVLSY  542

Query  540  RARETYGLPNTLPTAWHNLVYRMRGDMQLFQTFWFLYHKGHPPSEPCGT--PCRLATLCA  597
              RE Y + +  P +W +L  ++  +  LF+ +  LY++ H  +E C T   CR   +C 
Sbjct  543  DTREHYQMADFSPQSWSDLSDKLWTNTTLFRDYVRLYYRNHYNNE-CYTDYKCRYTFVCD  601

Query  598  QLSARADSPALCRHL  612
                R+   + C HL
Sbjct  602  IKKGRSYDESFCDHL  616


>sp|Q9UAY4|ASM3_CAEEL Putative sphingomyelin phosphodiesterase 
asm-3 OS=Caenorhabditis elegans OX=6239 GN=asm-3 PE=3 SV=2
Length=589

 Score = 609 bits (1569),  Expect = 0.0, Method: Composition-based stats.
 Identities = 195/549 (36%), Positives = 286/549 (52%), Gaps = 18/549 (3%)

Query  91   CPICKGLFTAINLGLKKEPNVARVGSVAIKLCNLLKIAPPAVCQSIVHLFEDDMVEVWRR  150
            C  CK +   +     ++     V  +A+ +C    I    VC  I+  F D+ + V ++
Sbjct  21   CEECKSIVDLLQFEWGEKKTEECVMEIAVFICETFHIEDNDVCNFIISDFSDEFMYVIKQ  80

Query  151  SVLSPSEACGLLLGSTCGHW--DIFSSWNISLPTVPKPPPKPPSPPAPGAPVSRILFLTD  208
             +++P + CGLL+ + CG +   + + WN+++P   +PP  P     PG P  R L LTD
Sbjct  81   ILVTPHQLCGLLMKNDCGDFVDPLATIWNMTIPG-NQPPFVPKQVVPPGNPTLRALHLTD  139

Query  209  LHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPG-----AGYWGEYSKCDLPLRTLESLL  263
            LH D  Y  G + DC  P CCR           G     AG WG    CD P   L ++L
Sbjct  140  LHVDMFYTVGLEADCGTPQCCRPQDMNVEIVENGDVKQPAGPWGSVGSCDTPYWLLTNML  199

Query  264  SGLG-PAGPFDMVYWTGDIPAHDVWHQTRQDQLRALTTVTALVRKFLGPVPVYPAVGNHE  322
              +   AG  D +  +GD+ +H VW  T +     +  ++  +R +    PVY AVGNHE
Sbjct  200  QNIASTAGKLDYIMVSGDLVSHTVWAYTPETHSFMVKNLSDTIRSYFPKTPVYFAVGNHE  259

Query  323  STPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGGFYALSPYPGLRLISL  382
              PV++  P F    +   WLY+AM+ AW+ W+PA+  ++L   G Y    Y GLR+ISL
Sbjct  260  GVPVDNIAPHFTPKKYHMDWLYKAMSNAWQGWIPADQEKSLEYNGCYMKKIYDGLRMISL  319

Query  383  NMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGDKVHIIGHIP--PGHCLKSWSWN  440
            N  +  R NFWL IN TDP G LQWL+ +LQ AE+ GDKVHI+ HIP   G  L+ ++ N
Sbjct  320  NNVYGDRINFWLYINQTDPDGTLQWLINQLQDAENVGDKVHIVAHIPGSDGEALEGYALN  379

Query  441  YYRIVARYENTLAAQFFGHTHVDEFEVFYD--EETLSRPLAVAFLAPSATTYIGLNPGYR  498
            YY+I+ RY NT+  QFFGHTH ++F + Y   ++  S P  V + APS T Y    P YR
Sbjct  380  YYKIINRYANTVVGQFFGHTHSEKFYMMYANPDDYKSTPTNVVYSAPSVTPYSDYFPAYR  439

Query  499  VYQIDGNYSGSSHVVLDHETYILNLTQANIPGAIPHWQLLYR-ARETYGLPNTLPTAWHN  557
            +Y IDG + GS++ V+D+E +  NLT  N       W++LY+ A   YGL   +PT ++ 
Sbjct  440  IYTIDGVHKGSTYQVIDYEEWFFNLTSNNANPTNVKWEVLYQSANMEYGLKGQIPTEYNQ  499

Query  558  LVYRMRGDMQLFQTFWFLYHKG--HPPSEPC-GTPCRLATLCAQLSARADSPALCRHLMP  614
            ++ RM+ D  LF  ++  +++   +    PC    CR   LC        +  LC  L  
Sbjct  500  MIERMKTDDSLFNKYYENHNRRSIYDGRAPCNDQQCRNGYLCDARQFHQ-TQQLCTDLEG  558

Query  615  DGSLPEAQS  623
                PE + 
Sbjct  559  GIQKPEPKK  567


>sp|Q10916|ASM1_CAEEL Sphingomyelin phosphodiesterase 1 OS=Caenorhabditis 
elegans OX=6239 GN=asm-1 PE=1 SV=2
Length=564

 Score = 604 bits (1557),  Expect = 0.0, Method: Composition-based stats.
 Identities = 184/539 (34%), Positives = 283/539 (53%), Gaps = 21/539 (4%)

Query  82   DVFGWGNLTCPICKGLFTAINLGLKKEPNVARVGSVAIKLCNLLKIAPPAVCQSIVHLFE  141
            D +G+  L C  C GL +  +  LK + +   +   A  +C L    P AVC  I   F 
Sbjct  33   DKYGFQPL-CISCTGLISVASFFLKFDVSEPVILEFATIVCKLFAKQPWAVCDGISSQFR  91

Query  142  DDMVEVWRR-SVLSPSEACGLLLGSTCGHWD-IFSSWNISLPTVPKPPP--KPPSPPAPG  197
            D+   V+RR +  SPS+ CG++L       D   S W ++LP  PK     K      P 
Sbjct  92   DEFFYVFRRLANESPSQICGIILPDCADPTDPSESGWMVALPPKPKRTRISKKKVQKKPN  151

Query  198  APVSR---ILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGEYSKCDL  254
              +S+   +L LTDLH D +Y   ++ +C DP+CCR     P   +  AGYWG   KCD+
Sbjct  152  MSMSQNLNVLQLTDLHVDFEYKYPSEANCDDPVCCRVSVSEP---KKAAGYWGSVGKCDI  208

Query  255  PLRTLESLLSGLGPAGPFDMVYWTGDIPAHDVWHQTRQDQLRALTTVTALVRKFLGPVPV  314
            P  T+E++LS +      DMV  TGD   H  W  + ++ L  L  +  LV+      P+
Sbjct  209  PFWTVENMLSHINKTHMIDMVIMTGDYINHVDWEYSIEEHLSVLRKLHRLVQNTFPSTPI  268

Query  315  YPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGGFYALSPY  374
            Y A+GNHE  PVNSF P  ++      WLY+       PWL   A  +L   G Y+    
Sbjct  269  YWALGNHEGVPVNSFAPHSVDERFWPTWLYKEFQTMSGPWLSEGAKDSLLKRGSYSTQVM  328

Query  375  PGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGDKVHIIGHIPPG--H  432
             GL+LI+LN  FC   NF+L +N +DP   + W V EL  +E +G++V+++ HIPPG   
Sbjct  329  DGLKLITLNTGFCEVTNFFLYLNQSDPDSSMSWFVKELFESEKKGEQVYVLAHIPPGDSE  388

Query  433  CLKSWSWNYYRIVARYENTLAAQFFGHTHVDEFEVFYDE--ETLSRPLAVAFLAPSATTY  490
            CL+ W++NYYR++ R+ +T+AAQFFGH H+D F VFY++     S+P++V + +PS TT+
Sbjct  389  CLEGWAFNYYRVIQRFSSTIAAQFFGHDHLDYFTVFYEDMHNVSSKPISVGYASPSVTTF  448

Query  491  IGLNPGYRVYQIDGNYSGSSHVVLDHETYILNLTQANIPGAIPHWQLLYRARETYGLPNT  550
               NP YR+Y+ID     +   ++D  TY  +L +A      P W+ LY AR+ +G+ + 
Sbjct  449  EYQNPAYRIYEID---PYNKFKIVDFTTYYADLEKAT-EDKKPVWEKLYSARQAHGMDDL  504

Query  551  LPTAWHNLVYRMRGDMQLFQTFWFLYHKGHPPSEPCGTPCRLATLCAQLSARADSPALC  609
             P +W+ ++ ++    +  + F+    +   P   C + C++  +C       +S   C
Sbjct  505  SPLSWNKVIQKLFTSEKKREKFYQYAFRNFSPQ--CDSTCQMQLMCNLRMGHHNSTLYC  561


>sp|Q54C16|SGMB_DICDI Sphingomyelin phosphodiesterase B OS=Dictyostelium 
discoideum OX=44689 GN=sgmB PE=3 SV=1
Length=637

 Score = 564 bits (1454),  Expect = 0.0, Method: Composition-based stats.
 Identities = 202/536 (38%), Positives = 287/536 (54%), Gaps = 30/536 (6%)

Query  91   CPICKGLFTAINLGLKKEPNVARVGSVAIKLCNLLKIAPPAVCQSIVHLFEDDMVEVWRR  150
            C ICK     +   +  +  +  +   AI LC  L I    VC  ++ LF +    V   
Sbjct  77   CDICKFGINQVQKMIASKQGIEDISKYAIDLCTYLHIEKAEVCNGLIPLFANMTYNVLSY  136

Query  151  SVLSPSEACGLLLGSTCGHWDIFSSWNISLPTVPKPPPKPPSPPAPGAPVSRILFLTDLH  210
              ++    CG +    C +    SS NI     PKPP  PP  P+P +P  +IL ++D+H
Sbjct  137  PTVTGEYVCGFV--GFCPYVPRNSS-NIINFPKPKPPHVPPVAPSPNSPTMKILHISDIH  193

Query  211  WDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGEYSKCDLPLRTLESLLSGLGP--  268
             D  Y  G + DC +PLCCR  +G P      AG WG Y  CD+ ++ +ES+   +    
Sbjct  194  VDPVYESGMNADCGEPLCCRAPNG-PGVGEKAAGEWGHY-LCDINMKMVESMFEFIDQEF  251

Query  269  AGPFDMVYWTGDIPAHDVWHQTRQDQLRALTTVTALVRKFLGPV-PVYPAVGNHESTPVN  327
                D+V+WTGD P HD+W QT   Q+ A   VT LV+K+ G    V+PA+GNHES PVN
Sbjct  252  GEDIDIVFWTGDNPPHDIWEQTYDSQINASQLVTNLVKKYFGSTAKVFPAIGNHESLPVN  311

Query  328  SFPPPFIEGNHSSRWLYEAMAKAWEPWLP-AEALRTLRIGGFYALSPYPGLRLISLNMNF  386
            SFP P       S W++ A++  W  W+   E +  L+ GG+Y L    GLR+ISLNMN+
Sbjct  312  SFPLP-----PGSSWIFNALSYDWSDWVNVDEQVANLQYGGYYTLPVQSGLRVISLNMNW  366

Query  387  CSRENFWLLINSTDPAGQLQWLVGELQAAEDRGDKVHIIGHIPPG--HCLKSWSWNYYRI  444
            C+  N +L  NSTDPA  LQW+V  LQA+ED G+KV+++GHIPPG   C+ SWS    +I
Sbjct  367  CNNGNLYLAENSTDPANMLQWIVDTLQASEDIGEKVYLVGHIPPGIPDCIDSWSEQLLQI  426

Query  445  VARYENTLAAQFFGHTHVDEFEVFY---DEETLSRPL---AVAFLAPSATTYIGLNPGYR  498
            V RYE+T+ A F+GHTH DEF V+Y   DE   S P+    V +  PS TTY   NP +R
Sbjct  427  VNRYEDTILASFYGHTHRDEFSVYYTQSDENDPSSPMRASNVIYTTPSVTTYQHQNPSFR  486

Query  499  VYQIDGNYSGSSHVVLDHETYILNLTQANIPGAIPHWQLLYRARETYGLPNTLPTAWHNL  558
            ++ +D N    +  +++  TY  +L+QAN+ G  P W L Y    TY +PN  P +    
Sbjct  487  IFTVDSN----TGYLMESSTYHTDLSQANLNGK-PTWLLEYNTTNTYNIPNLTPISMDLA  541

Query  559  VYRMRGDMQLFQTFWFLYHKG--HPPSEPCGT-PCRLATLCAQLSARADSPALCRH  611
            +  +     + + +   Y+    +P S+PC +  C+L  +C   SA       C H
Sbjct  542  IQNINSSNSMLEDYHVHYYSASPYPESKPCTSISCKLDYICKMKSAAYLKYYECIH  597


>sp|Q55C09|SGMA_DICDI Sphingomyelin phosphodiesterase A OS=Dictyostelium 
discoideum OX=44689 GN=sgmA PE=3 SV=1
Length=583

 Score = 552 bits (1423),  Expect = 0.0, Method: Composition-based stats.
 Identities = 168/565 (30%), Positives = 273/565 (48%), Gaps = 47/565 (8%)

Query  72   RLHRIVPRLRDVFGWGNLTCPICKGLFTAINLGLKKEPNVARVGSVAIKLCNLLKIAPPA  131
            +L +             L+C +C+   + +   +KK  ++  +      LC   K   P 
Sbjct  36   KLDKAAATTLQHGENIQLSCDVCQIGASLLEDFIKKNASLTEIIKGLSDLCIASKEEQPE  95

Query  132  VCQSIVHLFEDDMVEVWRRSVLSPSEACGLL-LGSTCGHW----------DIFSSWNISL  180
            VC  I++ +   +V+V  +S  +PS+ CG   + S  G            + +   + + 
Sbjct  96   VCTGILNNYVPIIVDVLIQSDFTPSQLCGYFKICSATGSSESSSISNSFDNEYRQESFNK  155

Query  181  PTVP---KPPPKPPSPPAP-------GAPVSRILFLTDLHWDHDYLEGTDPDCADPLCCR  230
            PT+    KP  K  S   P          +  IL ++D+H+D DY  G++P+C  PLCCR
Sbjct  156  PTMKVNKKPQYKDLSNQEPLVKKFKGNDSIGYILQISDVHFDPDYKVGSNPNCGRPLCCR  215

Query  231  RGSGLPPASRPGAGYWGEYSKCDLPLRTLESLLSGLGP-AGPFDMVYWTGDIPAHDVWHQ  289
             G G        AG  G Y  CD+P  T+E +   L       D + WTGD P H+VW Q
Sbjct  216  DGVGS-------AGPIGHY-LCDIPFSTVELIFQHLATLTDQLDFIVWTGDNPPHNVWEQ  267

Query  290  TRQDQLRALTTVTALVRKFLGPVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAK  349
            ++  Q  A  T+  +++K     PV P++GNHE+ P + +  P       S+WL +++  
Sbjct  268  SQAQQELATATLAQVIQKTFPNTPVLPSLGNHEAYPADQYVLPN------SQWLLDSIYT  321

Query  350  AWEPWLPAEALRTLRIGGFYALSPYPGLRLISLNMNFCSRENFWLLINS--TDPAGQLQW  407
             W PWL A+AL  ++  G+Y     PGLR++SLN       NF+ L+ +    P  Q  W
Sbjct  322  YWAPWLDADALELVKERGYYTSLIKPGLRVMSLNTLENDMINFYNLLPTYLKGPNNQSDW  381

Query  408  LVGELQAAEDRGDKVHIIGHIP---PGHCLKSWSWNYYRIVARYENTLAAQFFGHTHVDE  464
            ++  L+ A+  G+KV IIGHIP          W   Y ++V ++ + +  Q +GHTH D+
Sbjct  382  MINTLEQAQSNGEKVLIIGHIPCTVKSASTDGWCAMYEQVVGQFSDVIIGQLYGHTHYDQ  441

Query  465  FEVFYDEETLSRPLAVAFLAPSATTYIGLNPGYRVYQIDGNYSGSSHVVLDHETYILNLT  524
            F VF D  T + P  + ++ PS TTY    PGYR+YQ D     S++ ++++  Y  N+T
Sbjct  442  FSVFSDVATHTIPTGMNYIVPSLTTYQNHEPGYRIYQFD----YSTNQIVNYYQYHANIT  497

Query  525  QANIPGAIPHWQLLYRARETYGLPNTLPTAWHNLVYRMRGDMQLFQTFWFLYHKGHPPSE  584
            +AN  GA+ ++QL Y A+E Y + +  PT+W  +  +M+ +  +F ++ F      P  E
Sbjct  498  EANETGAL-NFQLTYSAKELYNMDDLSPTSWTKVANQMKTNSTMFNSY-FENLSSSPIKE  555

Query  585  PCGTPCRLATLCAQLSARADSPALC  609
             C   C+   +C      +     C
Sbjct  556  SCDQACQTKWICQIFGITSSEFDKC  580


>sp|Q641Z7|ASM3A_RAT Cyclic GMP-AMP phosphodiesterase SMPDL3A 
OS=Rattus norvegicus OX=10116 GN=Smpdl3a PE=2 SV=1
Length=445

 Score = 473 bits (1216),  Expect = 2e-161, Method: Composition-based stats.
 Identities = 137/450 (30%), Positives = 212/450 (47%), Gaps = 46/450 (10%)

Query  186  PPPKPPSPPAPGAP-VSRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAG  244
            P    P  PA GAP V +   +TDLH D  Y   TD D        +G+ +        G
Sbjct  19   PGLGVPLAPAYGAPAVGQFWHVTDLHLDPTY-HITD-DHTKVCASSKGANVS-----NPG  71

Query  245  YWGEYSKCDLPLRTLESLLSGLGPAG-PFDMVYWTGDIPAHDVWHQ-TRQDQLRALTTVT  302
             +G+   CD P + + S    +  +G     + WTGD P H    + +    +  +T +T
Sbjct  72   PFGDV-LCDSPYQLILSAFDFIKNSGQEASFMIWTGDSPPHVPVRELSTGSVIEVITNMT  130

Query  303  ALVRKFLGPVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRT  362
              V+     + V+PA+GNH+  P +  P        ++  +Y A++  W+PWL  EA+ T
Sbjct  131  VTVQNLFPNLQVFPALGNHDYWPQDQLPI-------ATSKVYSAVSDLWKPWLDEEAIST  183

Query  363  LRIGGFYALSP--YPGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGD  420
            LR GGFY+      P LR+ISLN N     N  + +N TDPA Q +WL   L ++    +
Sbjct  184  LRKGGFYSQKVASNPDLRIISLNTNLYYGPNI-MTLNKTDPANQFEWLENTLNSSLRNKE  242

Query  421  KVHIIGHIPPGH---------CLKSWSWNYYRIVARYENTLAAQFFGHTHVDEFEVFYDE  471
            KV++I H+P G+           + ++     I  RY + +A QF+GHTH D   V  D+
Sbjct  243  KVYVIAHVPVGYLPYATKTPAMRQYYNEKLVDIFRRYSSVIAGQFYGHTHRDSLMVLSDK  302

Query  472  ETLSRPLAVAFLAPSATTYIGL------NPGYRVYQIDGNYSGSSHVVLDHETYILNLTQ  525
                 P+   F+AP+ T   G+      NPG R++Q    Y    + +LD   Y LNLT+
Sbjct  303  N--GNPINSVFVAPAVTPVKGVLEKETNNPGVRLFQ----YKPGDYTLLDMLQYYLNLTE  356

Query  526  ANIPGAIPHWQLLYRARETYGLPNTLPTAWHNLVYRMRG-DMQLFQTFWFLYHKGHPPSE  584
            AN+ G   +W L Y   + YG+ +  P + H L  ++   D + F  ++  +   +  S 
Sbjct  357  ANLKGE-SNWTLEYTLTQAYGVADLQPKSLHGLAQQLATIDSKQFLKYYHYFFVSYDSSA  415

Query  585  PCGTPCRLATLCAQLSARADSPALC--RHL  612
            PC   C+   +CA ++    S   C  RHL
Sbjct  416  PCDQRCKTLQICAIMNLDLVSYEDCLKRHL  445


>sp|Q92484|ASM3A_HUMAN Cyclic GMP-AMP phosphodiesterase SMPDL3A 
OS=Homo sapiens OX=9606 GN=SMPDL3A PE=1 SV=2
Length=453

 Score = 469 bits (1208),  Expect = 5e-160, Method: Composition-based stats.
 Identities = 129/453 (28%), Positives = 204/453 (45%), Gaps = 49/453 (11%)

Query  178  ISLPTVPKPPPKPPSPPAPGAPVSRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPP  237
            + LP  P     PP        + +   +TDLH D  Y   TD D        +G+    
Sbjct  21   LGLPVAPAGGRNPPPA------IGQFWHVTDLHLDPTY-HITD-DHTKVCASSKGANAS-  71

Query  238  ASRPGAGYWGEYSKCDLPLRTLESLLSGLGPAG-PFDMVYWTGDIPAHDVWHQ-TRQDQL  295
                  G +G+   CD P + + S    +  +G     + WTGD P H    + +    +
Sbjct  72   ----NPGPFGDV-LCDSPYQLILSAFDFIKNSGQEASFMIWTGDSPPHVPVPELSTDTVI  126

Query  296  RALTTVTALVRKFLGPVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWL  355
              +T +T  ++     + V+PA+GNH+  P +  P         +  +Y A+A  W+PWL
Sbjct  127  NVITNMTTTIQSLFPNLQVFPALGNHDYWPQDQLPV-------VTSKVYNAVANLWKPWL  179

Query  356  PAEALRTLRIGGFYALSP--YPGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVGELQ  413
              EA+ TLR GGFY+      P LR+ISLN N     N  + +N TDPA Q +WL   L 
Sbjct  180  DEEAISTLRKGGFYSQKVTTNPNLRIISLNTNLYYGPNI-MTLNKTDPANQFEWLESTLN  238

Query  414  AAEDRGDKVHIIGHIPPGH---------CLKSWSWNYYRIVARYENTLAAQFFGHTHVDE  464
             ++   +KV+II H+P G+           + ++     I  +Y + +A QF+GHTH D 
Sbjct  239  NSQQNKEKVYIIAHVPVGYLPSSQNITAMREYYNEKLIDIFQKYSDVIAGQFYGHTHRDS  298

Query  465  FEVFYDEETLSRPLAVAFLAPSATTY------IGLNPGYRVYQIDGNYSGSSHVVLDHET  518
              V  D++    P+   F+AP+ T           NPG R++Q    Y    + +LD   
Sbjct  299  IMVLSDKK--GSPVNSLFVAPAVTPVKSVLEKQTNNPGIRLFQ----YDPRDYKLLDMLQ  352

Query  519  YILNLTQANIPGAIPHWQLLYRARETYGLPNTLPTAWHNLVYRMRG-DMQLFQTFWFLYH  577
            Y LNLT+AN+ G    W+L Y   +TY + +  P + + L  +    D + F  ++  + 
Sbjct  353  YYLNLTEANLKGE-SIWKLEYILTQTYDIEDLQPESLYGLAKQFTILDSKQFIKYYNYFF  411

Query  578  KGHPPSEPCGTPCRLATLCAQLSARADSPALCR  610
              +  S  C   C+   +CA ++    S A C 
Sbjct  412  VSYDSSVTCDKTCKAFQICAIMNLDNISYADCL  444


>sp|P70158|ASM3A_MOUSE Cyclic GMP-AMP phosphodiesterase SMPDL3A 
OS=Mus musculus OX=10090 GN=Smpdl3a PE=1 SV=2
Length=445

 Score = 468 bits (1205),  Expect = 8e-160, Method: Composition-based stats.
 Identities = 137/450 (30%), Positives = 209/450 (46%), Gaps = 46/450 (10%)

Query  186  PPPKPPSPPAPGAP-VSRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAG  244
            P    P  PA  AP V +   +TDLH D  Y    D        C    G   A+    G
Sbjct  19   PGLGVPLAPADRAPAVGQFWHVTDLHLDPTYHITDD----RTKVCASSKG---ANASNPG  71

Query  245  YWGEYSKCDLPLRTLESLLSGLGPAG-PFDMVYWTGDIPAHDVWHQ-TRQDQLRALTTVT  302
             +G+   CD P + + S    +  +G     + WTGD P H    + +    ++ +T +T
Sbjct  72   PFGDV-LCDSPYQLILSAFDFIKNSGQEASFMIWTGDSPPHVPVPELSTGTVIKVITNMT  130

Query  303  ALVRKFLGPVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRT  362
              V+     + V+PA+GNH+  P +  P         +  +Y A+A  W+PWL  EA+ T
Sbjct  131  MTVQNLFPNLQVFPALGNHDYWPQDQLPI-------VTSKVYSAVADLWKPWLGEEAIST  183

Query  363  LRIGGFYALSP--YPGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGD  420
            L+ GGFY+      PGLR+ISLN N     N  + +N TDPA Q +WL   L ++    +
Sbjct  184  LKKGGFYSQKVASNPGLRIISLNTNLYYGPNI-MTLNKTDPANQFEWLENTLNSSLWNKE  242

Query  421  KVHIIGHIPPGHC---------LKSWSWNYYRIVARYENTLAAQFFGHTHVDEFEVFYDE  471
            KV+II H+P G+           + ++     I  RY + +A QF+GHTH D   V  D+
Sbjct  243  KVYIIAHVPVGYLPYATDTPAIRQYYNEKLLDIFRRYSSVIAGQFYGHTHRDSLMVLSDK  302

Query  472  ETLSRPLAVAFLAPSATTYIGL------NPGYRVYQIDGNYSGSSHVVLDHETYILNLTQ  525
                 PL   F+AP+ T   G+      NPG R++Q    Y    + +LD   Y LNLT+
Sbjct  303  N--GNPLNSVFVAPAVTPVKGVLQKETNNPGVRLFQ----YKPGDYTLLDMVQYYLNLTE  356

Query  526  ANIPGAIPHWQLLYRARETYGLPNTLPTAWHNLVYRMRG-DMQLFQTFWFLYHKGHPPSE  584
            AN+ G   +W L Y   + Y + +  P + + LV +    D + F  ++  Y   +  S 
Sbjct  357  ANLKGE-SNWTLEYVLTQAYSVADLQPKSLYALVQQFATKDSKQFLKYYHYYFVSYDSSA  415

Query  585  PCGTPCRLATLCAQLSARADSPALC--RHL  612
             C   C+   +CA ++  + S   C  +HL
Sbjct  416  TCDQHCKTLQVCAIMNLDSMSYDDCLKQHL  445


>sp|Q3ZC91|ASM3A_BOVIN Cyclic GMP-AMP phosphodiesterase SMPDL3A 
OS=Bos taurus OX=9913 GN=SMPDL3A PE=2 SV=1
Length=450

 Score = 465 bits (1196),  Expect = 2e-158, Method: Composition-based stats.
 Identities = 124/440 (28%), Positives = 197/440 (45%), Gaps = 43/440 (10%)

Query  190  PPSPPAPGAPVSRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGEY  249
            P +P   G  V +   +TD H D  Y    D        C    G   +     G +G+ 
Sbjct  24   PLAPAGTGPAVGQFWHVTDFHLDPTYHITGD----HTKVCASSKGAEASD---PGPFGDV  76

Query  250  SKCDLPLRTLESLLSGLGPAG-PFDMVYWTGDIPAHDVW-HQTRQDQLRALTTVTALVRK  307
              CD P R + S L  +  +G     + WTGD P H      +    +     +T  +++
Sbjct  77   -MCDSPYRLIFSALDFIKNSGQKVSFMIWTGDSPPHVPVLELSTDKVINVTANITTTIQR  135

Query  308  FLGPVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGG  367
                + V+PA+GNH+  P +  P         +  +Y A+A  W+PWL  +A+ TLR GG
Sbjct  136  LFPNLQVFPALGNHDYWPQDQLPV-------VNSKVYNAVANLWKPWLTEDAITTLRKGG  188

Query  368  FYALSP--YPGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGDKVHII  425
            FY       P LR+ISLN N     N  + +N TDPA Q +WL   L  ++   +KV+II
Sbjct  189  FYTQKVSNNPKLRIISLNTNLYYGPN-SVTLNQTDPANQFEWLENTLNISQQNKEKVYII  247

Query  426  GHIPPGH---------CLKSWSWNYYRIVARYENTLAAQFFGHTHVDEFEVFYDEETLSR  476
             H+P G+           K  +     I  +Y + +A QF+GHTH D   V  D++   +
Sbjct  248  AHVPVGYLPYARGISAMRKYHNEKLIDIFRKYSDIIAGQFYGHTHRDSIMVLSDKK--GK  305

Query  477  PLAVAFLAPSATTYIGL------NPGYRVYQIDGNYSGSSHVVLDHETYILNLTQANIPG  530
            P+   F+AP+ T    +      NPG R++Q    Y    + +LD   Y LNLT AN+ G
Sbjct  306  PVNSLFVAPAVTPVRSVLERLTNNPGVRLFQ----YDPRDYKLLDMLQYYLNLTDANLKG  361

Query  531  AIPHWQLLYRARETYGLPNTLPTAWHNLVYRMR-GDMQLFQTFWFLYHKGHPPSEPCGTP  589
               +W+L Y   + Y + +  P + + L  +    + + F  ++  +   +  S  C   
Sbjct  362  E-SNWKLEYNLTQAYDIQDLQPKSLYKLAKQFAIQESKQFIKYYKYFFVSYDSSVICQGK  420

Query  590  CRLATLCAQLSARADSPALC  609
            C++  +CA ++    S   C
Sbjct  421  CKIFQICAIMNLDVISYTDC  440


>sp|Q92485|ASM3B_HUMAN Acid sphingomyelinase-like phosphodiesterase 
3b OS=Homo sapiens OX=9606 GN=SMPDL3B PE=1 SV=2
Length=455

 Score = 458 bits (1177),  Expect = 2e-155, Method: Composition-based stats.
 Identities = 134/452 (30%), Positives = 200/452 (44%), Gaps = 49/452 (11%)

Query  194  PAPGAPVSRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGEYSKCD  253
                A   +   + DLH D DY    DP    P      +G  P   P AG WG+Y  CD
Sbjct  14   GGARAEPGKFWHIADLHLDPDYKVSKDPFQVCP-----SAGSQPV--PDAGPWGDY-LCD  65

Query  254  LPLRTLESLLSGLGPAGPF-DMVYWTGDIPAHDVWHQTRQD-QLRALTTVTALVRKFLGP  311
             P   + S +  +    P  D + WTGD   H    +  +   L  +  +T L+R+    
Sbjct  66   SPWALINSSIYAMKEIEPEPDFILWTGDDTPHVPDEKLGEAAVLEIVERLTKLIREVFPD  125

Query  312  VPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGGFYAL  371
              VY A+GNH+  P N FP         S  +Y  +A+ W+PWL  E++   + G FY  
Sbjct  126  TKVYAALGNHDFHPKNQFPA-------GSNNIYNQIAELWKPWLSNESIALFKKGAFYCE  178

Query  372  S---PYPGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGDKVHIIGHI  428
                P    R++ LN N     N  L  +  DP  Q QWL   L  A   GD V+I+GH+
Sbjct  179  KLPGPSGAGRIVVLNTNLYYTSNA-LTADMADPGQQFQWLEDVLTDASKAGDMVYIVGHV  237

Query  429  PPGHCLK---------SWSWNYYRIVARYENTLAAQFFGHTHVDEFEVFYDEETLSRPLA  479
            PPG   K          ++  Y ++V ++   +A QFFGH H D F + YD+     P++
Sbjct  238  PPGFFEKTQNKAWFREGFNEKYLKVVRKHHRVIAGQFFGHHHTDSFRMLYDDA--GVPIS  295

Query  480  VAFLAPSATTYIG---------LNPGYRVYQIDGNYSGSSHVVLDHETYILNLTQANIPG  530
              F+ P  T +            NP  RV++    Y  ++  + D  TY +NL+QAN  G
Sbjct  296  AMFITPGVTPWKTTLPGVVNGANNPAIRVFE----YDRATLSLKDMVTYFMNLSQANAQG  351

Query  531  AIPHWQLLYRARETYGLPNTLPTAWHNLVYRMRGDMQLFQTFWFLYHKGHPPSEPCGTPC  590
              P W+L Y+  E YG+P+    + H ++ R+ GD    Q ++ +Y+     +  C   C
Sbjct  352  T-PRWELEYQLTEAYGVPDASAHSMHTVLDRIAGDQSTLQRYY-VYNSVSYSAGVCDEAC  409

Query  591  RLATLCAQLSARADSPALCRHLMPDGSLPEAQ  622
             +  +CA      D+   C  L   G+ P  Q
Sbjct  410  SMQHVCAMRQVDIDAYTTC--LYASGTTPVPQ  439


>sp|P58242|ASM3B_MOUSE Acid sphingomyelinase-like phosphodiesterase 
3b OS=Mus musculus OX=10090 GN=Smpdl3b PE=1 SV=1
Length=456

 Score = 441 bits (1134),  Expect = 6e-149, Method: Composition-based stats.
 Identities = 130/446 (29%), Positives = 198/446 (44%), Gaps = 47/446 (11%)

Query  197  GAPVSRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGEYSKCDLPL  256
            GA + R   ++DLH D +Y    DP    P      +G  P     AG WG+Y  CD P 
Sbjct  17   GAQLGRFWHISDLHLDPNYTVSKDPLQVCP-----SAGSQPVLN--AGPWGDY-LCDSPW  68

Query  257  RTLESLLSGLGPAGPF-DMVYWTGDIPAHDVWHQTRQDQLRAL-TTVTALVRKFLGPVPV  314
              + S L  +    P  D + WTGD   H       +  + A+   +T L+++      V
Sbjct  69   ALINSSLYAMKEIEPKPDFILWTGDDTPHVPNESLGEAAVLAIVERLTNLIKEVFPDTKV  128

Query  315  YPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGGFYALS--  372
            Y A+GNH+  P N FP         S  +Y  +A+ W PWL  E+    + G FY+    
Sbjct  129  YAALGNHDFHPKNQFPA-------QSNRIYNQVAELWRPWLSNESYALFKRGAFYSEKLP  181

Query  373  -PYPGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGDKVHIIGHIPPG  431
             P    R++ LN N     N        DP  Q +WL   L  A   G+ V++IGH+PPG
Sbjct  182  GPSRAGRVVVLNTNLYYSNN-EQTAGMADPGEQFRWLGDVLSNASRDGEMVYVIGHVPPG  240

Query  432  HCLK---------SWSWNYYRIVARYENTLAAQFFGHTHVDEFEVFYDEETLSRPLAVAF  482
               K         S++  Y +++ ++   +A QFFGH H D F +FYD      P+ V F
Sbjct  241  FFEKTQNKAWFRESFNEEYLKVIQKHHRVIAGQFFGHHHTDSFRMFYD--NTGAPINVMF  298

Query  483  LAPSATTYIG---------LNPGYRVYQIDGNYSGSSHVVLDHETYILNLTQANIPGAIP  533
            L P  T +            NPG R+++    Y  ++  + D  TY LNL QAN+    P
Sbjct  299  LTPGVTPWKTTLPGVVDGANNPGIRIFE----YDRATLNLKDLVTYFLNLRQANVQ-ETP  353

Query  534  HWQLLYRARETYGLPNTLPTAWHNLVYRMRGDMQLFQTFWFLYHKGHPPSEPCGTPCRLA  593
             W+  YR  E Y +P+   ++ H  + R+  +  + Q ++ +Y+        C   CR+ 
Sbjct  354  RWEQEYRLTEAYQVPDASVSSMHTALTRIASEPHILQRYY-VYNSVSYNHLTCEDSCRIE  412

Query  594  TLCAQLSARADSPALCRHLMPDGSLP  619
             +CA      ++ A C H +    +P
Sbjct  413  HVCAIQHVAFNTYATCLHGLGAKLVP  438


>sp|Q54SR8|SGMC_DICDI Sphingomyelinase phosphodiesterase C OS=Dictyostelium 
discoideum OX=44689 GN=sgmC PE=3 SV=1
Length=446

 Score = 426 bits (1096),  Expect = 2e-143, Method: Composition-based stats.
 Identities = 130/431 (30%), Positives = 202/431 (47%), Gaps = 40/431 (9%)

Query  201  SRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGEYSKCDLPLRTLE  260
             +   +TD H+D  Y+EG D D      CR  +      + GA   G Y KCD     L+
Sbjct  32   GKFWHITDTHYDFMYIEGGDEDKQ----CREVTYKSKYEKGGASSIGNY-KCDTSFELLQ  86

Query  261  SLLSGLGPAGPF-DMVYWTGDIPAHDVWHQTRQD-QLRALTTVTALVRKFLGPVPVYPAV  318
            S    +       D + WTGD P H    Q  +   L+++T +T L++ +   +P++P++
Sbjct  87   SSFEYMVKHEEKPDFIIWTGDDPPHLGNSQLNETLVLQSITNMTNLIKGYFPDIPIFPSI  146

Query  319  GNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGGFYALSPYPGLR  378
            GNH+S P +              WL+E +A+ W P+L  +++ T ++GG+Y      G R
Sbjct  147  GNHDSYPQHQIGV-------GPNWLFENVAQLWSPFLSNDSIETFKLGGYYTELVSEGFR  199

Query  379  LISLNMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGDKVHIIGHIPPGHCLKSWS  438
            +ISLN  F   EN    +N TDPAGQL WL   L  A   G++V IIGH+PPG+  K   
Sbjct  200  IISLNTVFYYNENRQ-CLNLTDPAGQLLWLNETLANASLAGERVWIIGHVPPGYNEKYDV  258

Query  439  WNYYR--------IVARYENTLAAQFFGHTHVDEFEVFYDEETLS----RPLAVAFLAPS  486
            +N+++          ++Y + +    +GH H D F +FYD+         P  + FL+PS
Sbjct  259  FNFHKQFNDEYLFSFSQYSDIIEFHIYGHEHTDTFRLFYDDPNDHINDIEPTGIMFLSPS  318

Query  487  ATTYIGL-------NPGYRVYQIDGNYSGSSHVVLDHETYILNLTQANIPGAIPHWQLLY  539
             T ++         NPG R+Y+    Y+ +S  +LD+  +  NLT   I G I  WQL Y
Sbjct  319  LTPWMNQFLPALPNNPGLRLYE----YNITSFALLDYYQFWTNLTDNIISGNID-WQLEY  373

Query  540  RARETYGLPNTLPTAWHNLVYRMRGDMQLFQTFWFLYHKGHPPSEPCGTPCRLATLCAQL  599
            RA E +   N  P + +     ++        F F Y+    P++ C   C+   LC+  
Sbjct  374  RATEFFNTFNLSPVSMYEAYLLIQSVTSQLLKFHF-YNSVSYPTKGCDEICKKIQLCSIR  432

Query  600  SARADSPALCR  610
                     C 
Sbjct  433  HPFTKGFKECL  443


>sp|Q9C1W8|PPN1_SCHPO Endopolyphosphatase OS=Schizosaccharomyces 
pombe (strain 972 / ATCC 24843) OX=284812 GN=ppn1 PE=3 SV=1
Length=577

 Score = 315 bits (807),  Expect = 2e-98, Method: Composition-based stats.
 Identities = 92/365 (25%), Positives = 149/365 (41%), Gaps = 48/365 (13%)

Query  195  APGAP-VSRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYW--GEYSK  251
            + G P V R L +TD+H D  Y +G+  D          S   P  +   GY   G   +
Sbjct  40   SKGKPLVGRFLHITDMHPDIYYEKGSTVDHYCH-SYDHNSDDTPLGKSKVGYLSPGPGYE  98

Query  252  CDLPLRTLESLLSGLGPA-----GPFDMVYWTGDIPAHDVWHQTRQDQLRALTTVTALVR  306
            CD     ++  L  L        G  D + WTGD   HD  +   + Q   L +   LV 
Sbjct  99   CDSSPALIDKTLEWLKEHQDDVLGGIDFILWTGDNSRHDNDNHFPRTQSEILASNEDLVN  158

Query  307  KF---LGPVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTL  363
            K       VP+  A+GN++  P N               +   +A AW+  +P E   T 
Sbjct  159  KMIEAFPDVPIVSAIGNNDIYPHNIM-------EAGPSSMTRQLAGAWDALIPYEERHTF  211

Query  364  RIGGFYALSPYPG-LRLISLNMNFCSRENFWLL---INSTDPAGQL--QWLVGELQAAED  417
              G +Y     P  L  IS+N  + S +N  +     ++ D  G L  +W   +L+A   
Sbjct  212  EKGSYYLCDVIPDKLAAISINTLYLSNKNAAVDGCPDDNLDEPGSLFMRWFKIQLEAYRL  271

Query  418  RGDKVHIIGHIPP--GHCLKSWSWNYYRIVARYENTLAAQFFGHTHVDEFEVFYDEETLS  475
            +G KV ++GHIPP  G   +    ++  ++  + + +  Q +GH +++ F VF + + L 
Sbjct  272  KGMKVWLLGHIPPTRGQWYEDCYTSFTDLLYEFRDIIVGQLYGHMNINHF-VFLEFDKL-  329

Query  476  RPLAVAFLAPSATTYIGLN---PGYRVYQIDGNYSGSSHVVLDHETYILNLTQANIPGAI  532
                     P  T   G+    P Y    ID  Y+       +  T+  NLT+  + G +
Sbjct  330  ---------PVDTESYGIKSAQPKYVKSLIDAQYA-------ELPTFPENLTEEFLNGTV  373

Query  533  PHWQL  537
             ++ L
Sbjct  374  GNYSL  378


 Score = 34.7 bits (78),  Expect = 2.7, Method: Composition-based stats.
 Identities = 12/65 (18%), Positives = 26/65 (40%), Gaps = 3/65 (5%)

Query  506  YSGSSHVVLDHETYILNLTQ--ANIPGAIPHWQLLYRARET-YGLPNTLPTAWHNLVYRM  562
            Y  S    +  + Y LN +            ++LLY ++++ Y +P+     +  L  R+
Sbjct  465  YVPSLFTPISFKQYFLNTSNYMDATKDTEISYELLYTSKDSPYNMPDLTVPEYMRLAKRI  524

Query  563  RGDMQ  567
                +
Sbjct  525  ATCDK  529


>sp|Q6FMQ0|PPN1_CANGA Endopolyphosphatase OS=Candida glabrata 
(strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL 
Y-65 / CBS 138) OX=284593 GN=PPN1 PE=3 SV=1
Length=663

 Score = 317 bits (813),  Expect = 3e-98, Method: Composition-based stats.
 Identities = 78/314 (25%), Positives = 117/314 (37%), Gaps = 41/314 (13%)

Query  178  ISLPTVPKPPPKPPS--PPAPGAPVSRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGL  235
            ISL   P+ P                R L +TD+H D  Y+ GT  D          SG 
Sbjct  60   ISLGLTPRKPVVITDLRTGNKRKLHGRFLHITDMHPDEYYVAGTSIDNVC------HSGE  113

Query  236  PPASRPGAGYWGE-YSKCDLPLRTLESLLSGLGP--AGPFDMVYWTGDIPAHDVW---HQ  289
            P   +  A  +G   S CD P+  ++  L  +        D V WTGD   HD      +
Sbjct  114  PTKGKDRAAKFGNAMSGCDSPMLLMDMTLDWIDKNLKDQIDFVVWTGDNIRHDNDRTYPR  173

Query  290  TRQDQLRALTTVTALVRKFLG----------PVPVYPAVGNHESTPVNSFPPPFIEGNHS  339
            T  +  R    V   ++K              VPV P++GN++  P N F          
Sbjct  174  TEDEIFRMNAEVAEKIKKIFRTPNSPDPRDFAVPVVPSIGNNDVFPHNLFS-------LG  226

Query  340  SRWLYEAMAKAWEPWLPAEALRTLRIGGFYALSPYPG-LRLISLNMNFCSRENFWLLINS  398
                     + W  ++P E  R       +     PG L ++S N  +  + N   L+++
Sbjct  227  PTLQTREYYRLWGDFIPEEQQRMFDRDASFFTEVIPGKLAVLSFNTLYLFKAN--PLVDN  284

Query  399  TDPAGQ-----LQWLVGELQAAEDRGDKVHIIGHIPP--GHCLKSWSWNYYRIVARYENT  451
             D   Q     L WL   L    +RG KV I GH+PP   +   S    +   +  Y + 
Sbjct  285  CDSRKQPGYQLLLWLGYVLDEIRERGMKVWISGHVPPIAKNYDSSCYDKFSLWMHEYRDV  344

Query  452  LAAQFFGHTHVDEF  465
            +    +GH ++D F
Sbjct  345  IIGGLYGHMNMDHF  358


>sp|Q6BKG0|PPN1_DEBHA Endopolyphosphatase OS=Debaryomyces hansenii 
(strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / 
NBRC 0083 / IGC 2968) OX=284592 GN=PPN1 PE=3 SV=3
Length=713

 Score = 313 bits (802),  Expect = 4e-96, Method: Composition-based stats.
 Identities = 74/310 (24%), Positives = 114/310 (37%), Gaps = 42/310 (14%)

Query  180  LPTVPKPPPKPPSPPAPGAPVSRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPAS  239
            L   PKP  K            R L +TD+H D  Y  G D        C  G G     
Sbjct  74   LGLSPKPKLKIVKGGDEQVLHGRFLHITDMHPDKYYKTGADVGS----LCHSGKGS----  125

Query  240  RPGAGYWGE-YSKCDLPLRTLESLLSGLGP--AGPFDMVYWTGDIPAHDVW---HQTRQD  293
               AG +G+    CD P+  +E  L  +        D V WTGD   HD      +T  +
Sbjct  126  ---AGKYGDAVLGCDSPMVLMEDTLKWVKENLKDKIDFVVWTGDNVRHDNDRRYPRTESN  182

Query  294  QLRALTTVTALVRKFLG------------PVPVYPAVGNHESTPVNSFPPPFIEGNHSSR  341
                   V+ L+ +                +P+ P++GN++  P N F P          
Sbjct  183  IFDMNQRVSELMYETFKEENPRGGRPRQLKIPLVPSLGNNDVFPHNLFSP-------GPT  235

Query  342  WLYEAMAKAWEPWLPAEALRTLRIGGFYALSPYPG-LRLISLNMNFCSRENFWL--LINS  398
                 + K W  ++PA  L     G ++     P  L ++S+N  +  + N  +      
Sbjct  236  LQTRELFKIWHDFVPAAQLHIFNRGAYFFKEIIPNELAVLSINTLYLFQSNPLVDNCDRK  295

Query  399  TDPAGQ-LQWLVGELQAAEDRGDKVHIIGHIPPGH--CLKSWSWNYYRIVARYENTLAAQ  455
             DP  +  +WL   L+    R  KV + GH+PP       S    Y   +  Y + +   
Sbjct  296  KDPGHKLFEWLGYTLKEMRARNMKVWLSGHVPPNEKNYDISCLRKYIVWMHEYRDVIIGG  355

Query  456  FFGHTHVDEF  465
             +GH ++D F
Sbjct  356  LYGHMNIDHF  365


>sp|Q55GC7|SGMD_DICDI Sphingomyelinase phosphodiesterase D OS=Dictyostelium 
discoideum OX=44689 GN=sgmD PE=3 SV=1
Length=438

 Score = 304 bits (779),  Expect = 5e-96, Method: Composition-based stats.
 Identities = 101/450 (22%), Positives = 171/450 (38%), Gaps = 60/450 (13%)

Query  197  GAPVSRILFLTDLHWDH---DYLEGTDPDCADPLCCRRGS---------GLPPASRPGAG  244
             A  ++ L ++D+H+       L      C  P   +                 + P  G
Sbjct  16   NALNNQFLHISDVHYSSAMNSLLYNASVMCIGPTVTKEFDHKEHEDLIEDTERLNLPTNG  75

Query  245  YWGEYSKCDLPLRTLESLLSGLGPAGPF-DMVYWTGDIPAHD----VWHQTRQDQLRALT  299
             +G Y  CD     L  ++S +       D + +TGD   H      W +++        
Sbjct  76   LYGRYG-CDTNQLLLSEVISEMLNVNSNPDFIIYTGDGAGHGLPNGPWSESQST------  128

Query  300  TVTALVRKFLGPVPVYPAVGNHESTPVNSFPPPFIEGNHSS-RWLYEAMAKAWEPWLPAE  358
             +   +          P +GN++  P         + N S+ ++LYE     W  W+P  
Sbjct  129  -LAKSLYGAYPNTQFIPTIGNNDVFP-----DYNSQCNDSNLQFLYET----WAQWIPTN  178

Query  359  ALRTLRIGGFYALSPYPGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDR  418
             + +    G + +SP  GL +ISLN    S +N        DP GQ  WL  +L AA+  
Sbjct  179  QVSSFLYRGSFVVSPVSGLTIISLNTILYSVKNKNTFSTPQDPCGQFAWLEQQLIAAKQA  238

Query  419  GDKVHIIGHIPPG----HCLKSWSWNY----YRIVARYENTLAAQFFGHTHVDEFE-VFY  469
            G+ V+IIGHI PG    +   +W   Y    + I + Y+ T+ A FFGH H DE   + +
Sbjct  239  GNSVYIIGHIFPGLDPFYLQGTWKSQYQTAFFNITSDYQTTITAGFFGHIHRDEIRSIQF  298

Query  470  DEETLSRPLAV-AFLAPSATTYIGLNPGYRVYQIDGNYSGSSHVVLDHETYILNLTQANI  528
            D  +L+       F+  S T     NP ++ +     Y   S  + D   Y  ++  +N+
Sbjct  299  DNPSLTNNHYFPMFIGSSITPVYFNNPTFKQFT----YDSQSKNITDITAYFSDVYISNL  354

Query  529  PGAIPHWQLLYRARETYGLPNTLPTA---WHNLVYRMRGDMQLFQTFWFLYHKGHPPSEP  585
             G + +W   Y     Y + N         ++L+ RM     +F  +       +    P
Sbjct  355  KGHM-NWTEEYDFVSIYDIDNQYGIGGDQLNSLMERMVSSNSIFNNYDNFRSGSYLSDSP  413

Query  586  CGTPCRLATLCAQLSARADSPALCRHLMPD  615
                   +  C   +A  D    C ++  +
Sbjct  414  -------SMTCLINAATIDELNACTYIAAN  436


>sp|Q6CWT7|PPN1_KLULA Endopolyphosphatase OS=Kluyveromyces lactis 
(strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL 
Y-1140 / WM37) OX=284590 GN=PPN1 PE=3 SV=1
Length=681

 Score = 310 bits (794),  Expect = 2e-95, Method: Composition-based stats.
 Identities = 79/310 (25%), Positives = 113/310 (36%), Gaps = 36/310 (12%)

Query  179  SLPTVPKPPPKPPSPPAPGAPV-SRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPP  237
            SL   P  P K          +  R L +TD+H D  Y E T  D      C R  G P 
Sbjct  87   SLGLTPNQPVKITDIGGKEKSIKGRFLHITDMHPDLYYKENTSIDDT----CHR--GKPK  140

Query  238  ASRPGAGYWGE-YSKCDLPLRTLESLLSGLGP--AGPFDMVYWTGDIPAHDVW---HQTR  291
                 A  +G     CD P   +   L  +    +   D + WTGD   HD      +T 
Sbjct  141  NDGDRAARFGNAMKGCDGPPDLMYYTLDWIHKNLSDEIDFIIWTGDNVRHDNDRRIPRTE  200

Query  292  QDQLRALTTVTALVRKFLGP----------VPVYPAVGNHESTPVNSFPPPFIEGNHSSR  341
            Q        V+ L  K              V + P++GN++  P N F P          
Sbjct  201  QQIFDMNRQVSELFLKTFKDHESDDPRDLKVKIIPSLGNNDVFPHNLFSP-------GPT  253

Query  342  WLYEAMAKAWEPWLPAEALRTLRIGGFYALSPYPG-LRLISLNMNFCSRENFWL--LINS  398
                 +   W  ++P     T      + +   PG L +ISLN  +  + N  +    N 
Sbjct  254  LQTRELYDIWSQFIPPAQQNTFDRYASFFVEAIPGKLAVISLNTLYMFKGNPLVDNCSNK  313

Query  399  TDPA-GQLQWLVGELQAAEDRGDKVHIIGHIPP--GHCLKSWSWNYYRIVARYENTLAAQ  455
              P    L W+   LQ   DRG KV + GH+PP   +   S S      +  Y + +   
Sbjct  314  KQPGYKMLLWVGFTLQELRDRGMKVWLSGHVPPIPKNFDSSCSDKLALWLHEYSDIIIGG  373

Query  456  FFGHTHVDEF  465
            F+GH ++D F
Sbjct  374  FYGHMNMDHF  383


>sp|Q04119|PPN1_YEAST Endopolyphosphatase OS=Saccharomyces cerevisiae 
(strain ATCC 204508 / S288c) OX=559292 GN=PPN1 PE=1 
SV=1
Length=674

 Score = 308 bits (790),  Expect = 7e-95, Method: Composition-based stats.
 Identities = 71/310 (23%), Positives = 115/310 (37%), Gaps = 37/310 (12%)

Query  180  LPTVPKPP--PKPPSPPAPGAPVSRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPP  237
            L   P+ P   K            R L +TD+H D  Y+EG+  D          +G P 
Sbjct  72   LGLTPREPVIIKDVKTGKERKLHGRFLHITDIHPDPYYVEGSSIDAVC------HTGKPS  125

Query  238  ASRPGAGYWGE-YSKCDLPLRTLESLLSGLGPA--GPFDMVYWTGDIPAHDVW---HQTR  291
              +  A  +G+  S CD P+  +E  L  +        D V WTGD   HD      +T 
Sbjct  126  KKKDVAPKFGKAMSGCDSPVILMEETLRWIKENLRDKIDFVIWTGDNIRHDNDRKHPRTE  185

Query  292  QDQLRALTTVTALVRKFLG----------PVPVYPAVGNHESTPVNSFPPPFIEGNHSSR  341
                     V   + +              V V P++GN++  P N F            
Sbjct  186  AQIFDMNNIVADKMTELFSAGNEEDPRDFDVSVIPSLGNNDVFPHNMFA-------LGPT  238

Query  342  WLYEAMAKAWEPWLPAEALRTLRIGGFYALSPYPG-LRLISLNMNFCSRENFWL--LINS  398
                   + W+ ++P +  RT      +     PG L ++S+N  +  + N  +    + 
Sbjct  239  LQTREYYRIWKNFVPQQQQRTFDRSASFLTEVIPGKLAVLSINTLYLFKANPLVDNCNSK  298

Query  399  TDPAGQ-LQWLVGELQAAEDRGDKVHIIGHIPP--GHCLKSWSWNYYRIVARYENTLAAQ  455
             +P  Q L W    L+    RG KV + GH+PP   +  +S    +      Y + +   
Sbjct  299  KEPGYQLLLWFGYVLEELRSRGMKVWLSGHVPPIAKNFDQSCYDKFTLWTHEYRDIIIGG  358

Query  456  FFGHTHVDEF  465
             +GH ++D F
Sbjct  359  LYGHMNIDHF  368


 Score = 39.0 bits (89),  Expect = 0.14, Method: Composition-based stats.
 Identities = 9/91 (10%), Positives = 28/91 (31%), Gaps = 9/91 (10%)

Query  499  VYQIDGNYSGSSHVVLDHETYILNLTQANIPGAIP--------HWQLLYRARET-YGLPN  549
             Y++   Y            +  +L + N               +++ Y + E  Y + +
Sbjct  579  KYELGPAYVPQLFTPTRFVQFYADLEKINQELHNSFVESKDIFRYEIEYTSDEKPYSMDS  638

Query  550  TLPTAWHNLVYRMRGDMQLFQTFWFLYHKGH  580
                ++ +L  R+  +   ++ +        
Sbjct  639  LTVGSYLDLAGRLYENKPAWEKYVEWSFASS  669


>sp|Q5KH67|PPN1_CRYNJ Endopolyphosphatase OS=Cryptococcus neoformans 
var. neoformans serotype D (strain JEC21 / ATCC MYA-565) 
OX=214684 GN=PPN1 PE=3 SV=1
Length=678

 Score = 302 bits (774),  Expect = 2e-92, Method: Composition-based stats.
 Identities = 81/337 (24%), Positives = 125/337 (37%), Gaps = 52/337 (15%)

Query  179  SLPTVPKPPPKPPSPPAPGAPVSRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPA  238
            S+P +     +            R L +TD+H D  Y  G+  D      C R       
Sbjct  34   SVPQLDHSELQNVRINKKRPLKGRFLHITDIHPDPHYKTGSTFDSG----CHRKPKKDGK  89

Query  239  SRPG--------------------------AGYWGE-YSKCDLPLRTLESLLSGLGP--A  269
            S                             AG WG   S CD P+  +      L    A
Sbjct  90   SEGKKATENERGNEDLDDKEFDTLIKNEDLAGKWGTAVSDCDCPMSLVNITFDWLKEEWA  149

Query  270  GPFDMVYWTGDIPAHDVWHQTRQDQLRALTTVTALVRKFLG----PVPVYPAVGNHESTP  325
               D V WTGD   HD+  +  +       +   +V + L      +P+ P++GN++  P
Sbjct  150  NEVDFVVWTGDNARHDIDRRIPRTPKEIFDSNRMIVDRMLDAFGRDMPIVPSIGNNDIYP  209

Query  326  VNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGGFYALSPYPG-LRLISLNM  384
             N               + E     W+ ++P+EA      G ++++   P  L +ISLN 
Sbjct  210  HNVLAA-------GPSRITEEFLLIWKHFIPSEAAHVFERGAYFSVEVIPDRLAVISLNT  262

Query  385  NFCSRENF---WLLINSTDPAG-QLQWLVGELQAAEDRGDKVHIIGHIPP--GHCLKSWS  438
             F    N        +S DP   ++ WL  +L     RG +V + GH+PP   H   +  
Sbjct  263  LFWYDANTLVDGCRDHSNDPGALEMDWLEVQLNNFRQRGMQVWLTGHVPPHMNHYYDNCY  322

Query  439  WNYYRIVARYENTLAAQFFGHTHVDEFEVFYDEETLS  475
              Y  +  RY++T+    FGH +VD F  F D + L 
Sbjct  323  LRYGDLALRYQDTIVGHLFGHMNVDHF-FFIDVDELE  358


>sp|Q756F2|PPN1_EREGS Endopolyphosphatase OS=Eremothecium gossypii 
(strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) 
OX=284811 GN=PPN1 PE=3 SV=2
Length=594

 Score = 296 bits (758),  Expect = 5e-91, Method: Composition-based stats.
 Identities = 71/292 (24%), Positives = 111/292 (38%), Gaps = 44/292 (15%)

Query  201  SRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGE-YSKCDLPLRTL  259
             R L +TD+H D  Y+EG+         C        + R  AG +G+    CD P+  +
Sbjct  69   GRFLHITDIHPDPLYVEGSSIAG----ACHGDPARDASDR--AGRFGDAMGGCDAPMDLM  122

Query  260  ESLLSGLGPA--GPFDMVYWTGDIPAHDVWHQTRQDQLRALTTVTALVRKFLG-------  310
               L+ +        D V WTGD   HD   +  +   + L     +  +F         
Sbjct  123  NYTLAWVATHLRDEIDFVVWTGDNARHDNDRRQPRTAEQILHMNAQVADQFYELFQQQRD  182

Query  311  -----PVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRI  365
                  VPV P++GN++  P N F             +   + + W  ++P E  +    
Sbjct  183  GDTMQGVPVVPSLGNNDVFPHNMFS-------LGPTLMTRQLQRIWAKFIPEEQRQAFEH  235

Query  366  GGFYALSPYPG-LRLISLNMNFCSRENFWLLINSTDPA----GQLQWLVGELQAAEDRGD  420
               + +   P  L +IS N  +  + N  L+ N  D A      L WL   L+    R  
Sbjct  236  DTSFFVEVIPDRLAVISFNTLYFFKSNP-LVDNCNDKAQPGHALLLWLGSVLEEMRARNM  294

Query  421  KVHIIGHIPP------GHCLKSWSWNYYRIVARYENTLAAQFFGHTHVDEFE  466
            KV + GH+PP      G C    +W  Y     Y + +    +GH +VD F 
Sbjct  295  KVWLSGHVPPIPKNFEGSCYNKLAWWTY----EYRDVIIGGLYGHMNVDHFY  342


>sp|Q9P3S1|PPN1_NEUCR Endopolyphosphatase OS=Neurospora crassa 
(strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 
987) OX=367110 GN=epp-1 PE=3 SV=3
Length=731

 Score = 295 bits (756),  Expect = 2e-89, Method: Composition-based stats.
 Identities = 79/325 (24%), Positives = 128/325 (39%), Gaps = 42/325 (13%)

Query  191  PSPPAPGAPVSRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGEYS  250
            P   +      + L +TDLH D  Y   +  D AD   C RG G      P   Y  E S
Sbjct  45   PIANSARKLHGKFLHITDLHPDQFYKPHSSTDEAD--ACHRGKG------PAGVYGAEVS  96

Query  251  KCDLPLRTLESLLSGLGP--AGPFDMVYWTGDIPAHDVWHQTRQDQLRALTTVTALVRKF  308
             CD P   + +    +        D V WTGD   HD      ++  + L T   +  K 
Sbjct  97   DCDSPFALINATFDWIAANVKDDIDFVIWTGDTARHDSDEGVPRNADQVLGTNRWIADKM  156

Query  309  LG----------PVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAE  358
                         +P+ P +GN++  P N   P        + WL +     W  ++P  
Sbjct  157  AELFSDSTGRHLEIPIVPTLGNNDILPHNILLP------GPNSWL-QHYTHIWRRFVPEA  209

Query  359  ALRTLRIGGFYALSPYPG-LRLISLNMNFCSRENFWL--LINSTDPA-GQLQWLVGELQA  414
               + + GG++ +   P  L + SLN  +    N       + ++P   Q++WL  +L  
Sbjct  210  QRHSFQFGGWFYVEVIPNRLAIFSLNTLYFFDRNAGTDGCASPSEPGYKQMEWLRIQLHI  269

Query  415  AEDRGDKVHIIGHIPPGH------CLKSWSWNYYRIVARYENTLAAQFFGHTHVDEFEVF  468
              +RG K  ++GH+PP          ++    Y   + +Y + + +  FGH ++D F   
Sbjct  270  MRERGMKAILMGHVPPARTDSKKLWDENCWQKYSLWLRQYRDVVVSGVFGHMNIDHF-FI  328

Query  469  YDEETLSRPLAVAFLAPSATTYIGL  493
            +DE    R + V  LA  A   I +
Sbjct  329  HDE----RDINVGQLAGLADNSIDI  349


>sp|Q6CEE7|PPN1_YARLI Endopolyphosphatase OS=Yarrowia lipolytica 
(strain CLIB 122 / E 150) OX=284591 GN=PPN1 PE=3 SV=1
Length=747

 Score = 277 bits (707),  Expect = 5e-82, Method: Composition-based stats.
 Identities = 77/411 (19%), Positives = 133/411 (32%), Gaps = 69/411 (17%)

Query  201  SRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASR--------------------  240
             + L +TD+H D  +  G   +    +         P                       
Sbjct  49   GKFLHITDIHPDPYFHVGAVAEDKCHVDPDHKDSDYPDEDSELVWFRATGKKKHNHHKGK  108

Query  241  -----PGAGYWGEY-SKCDLPLRTLESLLSGLGPA--GPFDMVYWTGDIPAHDVW---HQ  289
                 P AGY+G   S CD P+  + +    +        D + WTGD   HD      +
Sbjct  109  DHEKMPKAGYYGHPLSSCDGPISLMNATFDWIDQNIRDEIDFIIWTGDNVRHDNDNRYPR  168

Query  290  TRQDQLRALTTVTALVRKFLG--------------------PVPVYPAVGNHESTPVNSF  329
              QD       V++   +                        +P+ P++GN++  P N +
Sbjct  169  LEQDIFGYNQIVSSKFHELFRYNETRDGEGHNGGGDPQHPLVIPIIPSLGNNDVFPHNLY  228

Query  330  PPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGGFYALSPYPG-LRLISLNMNFCS  388
                        +    M + W  ++P         G +Y      G L +ISLN  +  
Sbjct  229  LA-------GPSFQSRRMLQIWSEFVPEAQQHIFSRGSYYFQEVITGKLAVISLNTLYFY  281

Query  389  RENFWL--LINSTDPA-GQLQWLVGELQAAEDRGDKVHIIGHIPP--GHCLKSWSWNYYR  443
            + N         TDP    L WL   L     RG KV + GH+PP   +   S       
Sbjct  282  KSNPMSDGCDEKTDPGYKHLVWLGVVLDEMRQRGMKVWLSGHVPPVEKNYEDSCHLKLAY  341

Query  444  IVARYENTLAAQFFGHTHVDEFEVFYDEETLSRPLAVAFLAPSATTYIGLNPGYRVYQID  503
             +  Y + +    FGH ++D F V  D + + +  +     P    Y      +    I 
Sbjct  342  WLTEYRDIIVGSVFGHMNIDHFVVM-DPKKIEKAQSQDLGTPGL-GYKSHVTDFLDVAIS  399

Query  504  GNYSGSSHVVLDHETYILNLTQANIPGAIP-HWQLLYRARETYGLPNTLPT  553
             ++   +   +    YI ++ +       P  W   Y +   + + +  P+
Sbjct  400  ASHPVHTFGSIYKRNYIESVREDYSEIPGPKKWLDEYASN--FAIAHVSPS  448


>sp|P07602|SAP_HUMAN Prosaposin OS=Homo sapiens OX=9606 GN=PSAP 
PE=1 SV=2
Length=524

 Score = 53.2 bits (126),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 21/82 (26%), Positives = 34/82 (41%), Gaps = 1/82 (1%)

Query  82   DVFGWGNLTCPICKGLFTAINLGLKKEPNVARVGSVAIKLCNLL-KIAPPAVCQSIVHLF  140
            +     +L C ICK + TA    LK       +     K C+ L K    A C+ IV  +
Sbjct  54   NKPTVKSLPCDICKDVVTAAGDMLKDNATEEEILVYLEKTCDWLPKPNMSASCKEIVDSY  113

Query  141  EDDMVEVWRRSVLSPSEACGLL  162
               ++++ +  +  P E C  L
Sbjct  114  LPVILDIIKGEMSRPGEVCSAL  135


 Score = 44.0 bits (102),  Expect = 0.004, Method: Composition-based stats.
 Identities = 15/84 (18%), Positives = 33/84 (39%), Gaps = 1/84 (1%)

Query  79   RLRDVFGWGNLTCPICKGLFTAINLGLKKEPNVARVGSVAIKLCNLLKIAPPAVCQSIVH  138
            +  +V    ++ C +C+ L   +   +        +     K+C+ L  +    CQ +V 
Sbjct  303  KKHEVPAKSDVYCEVCEFLVKEVTKLIDNNKTEKEILDAFDKMCSKLPKSLSEECQEVVD  362

Query  139  LFEDDMVEVWRRSVLSPSEACGLL  162
             +   ++ +    V SP   C +L
Sbjct  363  TYGSSILSILLEEV-SPELVCSML  385


 Score = 40.5 bits (93),  Expect = 0.052, Method: Composition-based stats.
 Identities = 19/79 (24%), Positives = 31/79 (39%), Gaps = 3/79 (4%)

Query  91   CPICKGLFTAINLGLKKEPNVARVGSVAIKLCNLLKIAPPAVCQSIVHLFEDDMVEVWRR  150
            C +CK L   ++  L+K      + +   K C+ L       C   V  +E  ++E+   
Sbjct  409  CEVCKKLVGYLDRNLEKNSTKQEILAALEKGCSFLPDPYQKQCDQFVAEYEPVLIEILVE  468

Query  151  SVLSPSEACGLLLGSTCGH  169
             V+ PS  C  L    C  
Sbjct  469  -VMDPSFVC--LKIGACPS  484


>sp|P10960|SAP_RAT Prosaposin OS=Rattus norvegicus OX=10116 GN=Psap 
PE=1 SV=1
Length=554

 Score = 51.7 bits (122),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 27/129 (21%), Positives = 50/129 (39%), Gaps = 5/129 (4%)

Query  78   PRLRDVFGWGN-LTCPICKGLFTAINLGLKKEPNVARVGSVAIKLCNLLKIAPPAVCQSI  136
            P  +DV    N + C +C+ +   ++  +        +     K C+LL       CQ +
Sbjct  300  PYEQDVIQAQNVIFCQVCQLVMRKLSELIINNATEELLIKGLSKACSLLPAPASTKCQEV  359

Query  137  VHLFEDDMVEVWRRSVLSPSEACGLL-LGSTCGHWD--IFSSWNISLPTVPKPPPKPPSP  193
            +  F   +++V    V +P+  CG++ L S   +    +       +  +PK P  P  P
Sbjct  360  LVTFGPSLLDVLMHEV-NPNFLCGVISLCSANPNLVGTLEQPAAAIVSALPKEPAPPKQP  418

Query  194  PAPGAPVSR  202
              P     R
Sbjct  419  EEPKQSALR  427


 Score = 49.4 bits (116),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 17/82 (21%), Positives = 32/82 (39%), Gaps = 1/82 (1%)

Query  82   DVFGWGNLTCPICKGLFTAINLGLKKEPNVARVGSVAIKLCNLLKIAP-PAVCQSIVHLF  140
                  +L C ICK + T     LK       +     K C  +  +   A C+ +V  +
Sbjct  54   SKPTAKSLPCDICKTVVTEAGNLLKDNATEEEILHYLEKTCAWIHDSSLSASCKEVVDSY  113

Query  141  EDDMVEVWRRSVLSPSEACGLL  162
               ++++ +  + +P E C  L
Sbjct  114  LPVILDMIKGEMSNPGEVCSAL  135


 Score = 44.4 bits (103),  Expect = 0.003, Method: Composition-based stats.
 Identities = 27/116 (23%), Positives = 44/116 (38%), Gaps = 12/116 (10%)

Query  44   ALALALSDSRVLWAPAEAHPLSPQGHPARLHRIVPRLRDVFGWGNLTCPICKGLFTAINL  103
            A+  AL       AP +      Q   + L   VP  ++  G+    C +CK L   +  
Sbjct  403  AIVSALPKEP---APPKQPEEPKQ---SALRAHVPPQKNG-GF----CEVCKKLVIYLEH  451

Query  104  GLKKEPNVARVGSVAIKLCNLLKIAPPAVCQSIVHLFEDDMVEVWRRSVLSPSEAC  159
             L+K      + +   K C+ L       C   V  +E  ++E+    V+ PS  C
Sbjct  452  NLEKNSTKEEILAALEKGCSFLPDPYQKQCDEFVAEYEPLLLEILVE-VMDPSFVC  506


>sp|Q61207|SAP_MOUSE Prosaposin OS=Mus musculus OX=10090 GN=Psap 
PE=1 SV=2
Length=557

 Score = 50.9 bits (120),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 23/115 (20%), Positives = 40/115 (35%), Gaps = 10/115 (9%)

Query  91   CPICKGLFTAINLGLKKEPNVARVGSVAIKLCNLLKIAPPAVCQSIVHLFEDDMVEVWRR  150
            C  C+ +    +  +        +       C LL       CQ +V  F   +++++  
Sbjct  317  CQTCQFVMNKFSELIVNNATEELLVKGLSNACALLPDPARTKCQEVVGTFGPSLLDIFIH  376

Query  151  SVLSPSEACGLL-LGSTCG--------HWDIFSSWNISLPTVPKPPPKPPSPPAP  196
             V +PS  CG++ L +                 S  +  PT PK P +P     P
Sbjct  377  EV-NPSSLCGVIGLCAARPELVEALEQPAPAIVSALLKEPTPPKQPAQPKQSALP  430


 Score = 49.0 bits (115),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 17/82 (21%), Positives = 32/82 (39%), Gaps = 1/82 (1%)

Query  82   DVFGWGNLTCPICKGLFTAINLGLKKEPNVARVGSVAIKLCNLLKIAP-PAVCQSIVHLF  140
                  +L C ICK + T     LK       +     K C  +  +   A C+ +V  +
Sbjct  54   SKPTAKSLPCDICKTVVTEAGNLLKDNATQEEILHYLEKTCEWIHDSSLSASCKEVVDSY  113

Query  141  EDDMVEVWRRSVLSPSEACGLL  162
               ++++ +  + +P E C  L
Sbjct  114  LPVILDMIKGEMSNPGEVCSAL  135


 Score = 41.7 bits (96),  Expect = 0.019, Method: Composition-based stats.
 Identities = 24/108 (22%), Positives = 40/108 (37%), Gaps = 7/108 (6%)

Query  52   SRVLWAPAEAHPLSPQGHPARLHRIVPRLRDVFGWGNLTCPICKGLFTAINLGLKKEPNV  111
            S +L  P        Q   + L   VP  ++  G+    C +CK L   +   L+K    
Sbjct  409  SALLKEPTPPKQ-PAQPKQSALPAHVPPQKNG-GF----CEVCKKLVLYLEHNLEKNSTK  462

Query  112  ARVGSVAIKLCNLLKIAPPAVCQSIVHLFEDDMVEVWRRSVLSPSEAC  159
              + +   K C+ L       C   V  +E  ++E+    V+ P   C
Sbjct  463  EEILAALEKGCSFLPDPYQKQCDDFVAEYEPLLLEILVE-VMDPGFVC  509


>sp|Q9SB68|ADPRM_ARATH Manganese-dependent ADP-ribose/CDP-alcohol 
diphosphatase OS=Arabidopsis thaliana OX=3702 GN=At4g24730 
PE=2 SV=1
Length=311

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 49/229 (21%), Positives = 76/229 (33%), Gaps = 56/229 (24%)

Query  267  GPAGPFDMVYWTGDIPAHDVWHQTRQDQLRALTTVTALVRKFLG-PVPVYPAVGNHESTP  325
               G    V   GDI    V     +DQ  A T    LV +F     PVY  +GNH    
Sbjct  51   NQHGNLKFVINMGDI----VDGFCPKDQSLAATK--KLVHEFEKFNGPVYHMIGNHCLYN  104

Query  326  VNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGGFYALSP---------YPG  376
            +       +               A+  + P    R + + G+   +             
Sbjct  105  LPREELLPLLKIPGRD------GNAYYDFSPTPEYRVVVLDGYDISAVGWPQEHPNTIAA  158

Query  377  LRLISLNMNFCSRENFWLLINSTDPAG------------------QLQWLVGELQAAEDR  418
            L+++         +N     +   PAG                  QLQWL   LQ A + 
Sbjct  159  LKIL-------EEKNPNT--DKNSPAGLEDVARRFVKYNGGVGEKQLQWLDSVLQDASNS  209

Query  419  GDKVHIIGHIP--PGHCLKS---WSW-NYYRIVARYENTLAAQFFGHTH  461
              +V + GH+P  PG   K+   W++     I+ +Y++       GH H
Sbjct  210  NQRVIVCGHVPMSPGVASKAALLWNFDEVMNIIHKYDSVKVC-LSGHDH  257


>sp|P20097|SAP_CAVPO Saposin-C OS=Cavia porcellus OX=10141 GN=PSAP 
PE=1 SV=1
Length=81

 Score = 45.9 bits (107),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 15/73 (21%), Positives = 31/73 (42%), Gaps = 1/73 (1%)

Query  87   GNLTCPICKGLFTAINLGLKKEPNVARVGSVAIKLCNLLKIAPPAVCQSIVHLFEDDMVE  146
             ++TC  C+ +   +   +       ++      +C LL  +   VCQ +V  + D +V 
Sbjct  1    ESVTCKACEYVVKKVMELIDNNRTEEKIIHALDSVCALLPESVSEVCQEVVDTYGDSIVA  60

Query  147  VWRRSVLSPSEAC  159
            +  +  +SP   C
Sbjct  61   LLLQE-MSPELVC  72


>sp|P38887|YH02_YEAST Uncharacterized protein YHR202W OS=Saccharomyces 
cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YHR202W 
PE=1 SV=1
Length=602

 Score = 50.5 bits (119),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 70/422 (17%), Positives = 140/422 (33%), Gaps = 50/422 (12%)

Query  180  LPTVPKPPPKPPSPPAPGAPVSRILFLTDLHW-DHDYLEGTDPDCADPLCCRRGSGLPPA  238
            +   P    +    P+   P      L D+H  D +++  TD             G   +
Sbjct  16   IFAKPYQQQQAVLAPSQDVP------LRDIHIGDINFIHTTDT--------HGWLGSHLS  61

Query  239  SRPGAGYWGEYSKCDLPLRTLESLLSGLGPAGPFDMVYWTGDIPAHDVWHQTRQDQLRAL  298
                   WG++      +  ++ L   +       +V  TGD    D    +       L
Sbjct  62   QNDYDADWGDF------VAFVDILREKILRQSRDVIVIDTGD--KRDGNGLSDATWPPGL  113

Query  299  TTVTALVRKFLGPVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAE  358
             + + +       +     +GNHE     S       G   S    +    +   ++  +
Sbjct  114  RS-SEIFNMMDYDL---LTLGNHELYTAES-AILEYRGTSQSSKFKDKYVCSNVEFIEDD  168

Query  359  ALRTLRIGGFY--ALSPYPGLRLISLNMNFCSRE--NFWLLINSTDPAGQLQWLVGELQA  414
              R +  G  Y    +P    R+++L+  F  +   N  ++    +   Q  W    ++ 
Sbjct  169  GTR-VPFGNKYITFETPIMKQRVLALSFLFSFQRANNRAIVTPPLEEITQKSWFQNMVET  227

Query  415  AEDRG-DKVHIIGHIPPGHCLKSWSWNYYRIVARYE-NTLAAQFFGHTHVDEFEVFYDEE  472
              +   D + + GH+P     +      + ++ +Y  NT+   F GHTH+ +F V  D +
Sbjct  228  NREEEIDLIIVFGHLPATDPTEREMHKIHALIRKYYPNTVIQYFGGHTHIRDF-VQLDSK  286

Query  473  TLSRPLA-----VAFLAPSAT-TYIGLNPGYRVYQIDGNYSGSSHVVLDHETYILNLTQA  526
            +           V FL+ + T      +P +    ID N     + +     +  N+  +
Sbjct  287  STCLQSGRFAETVGFLSINMTDPVDAESPIFSRRYIDFNKEAFKYHLSKL-GHDSNVPVS  345

Query  527  NIPGAIPHWQLLYRARETYGLP---NTLPTAWHNLVYRMRGDMQLFQTFWFLYHKGHPPS  583
               G     +L+   R    L      +P  ++     +  +  L   +  + HK  P  
Sbjct  346  TKKGKTIS-RLVNDLRHELNLNEKLGYIPQTYYVSTRPLNSEENL---YHLITHKILPNL  401

Query  584  EP  585
             P
Sbjct  402  IP  403


>sp|Q8C1C1|SAPL1_MOUSE Proactivator polypeptide-like 1 OS=Mus 
musculus OX=10090 GN=Psapl1 PE=1 SV=2
Length=522

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 23/125 (18%), Positives = 52/125 (42%), Gaps = 4/125 (3%)

Query  89   LTCPICKGLFTAINLGLKKEPNVARVGSVAIKLCNLLKIAPPAVCQSIVHLFEDDMVEVW  148
            LTC +C  L   ++  L      A +     ++C ++       C ++V  +  ++V++ 
Sbjct  293  LTCDVCLNLVQELDKWLVTNSTEALISHTLERVCTVVPEPLVQQCITLVDTYSPELVQLM  352

Query  149  RRSVLSPSEACGLLLGSTCGHWDIFSSWNISLPTVPKPPPKPPSPPAPGAPVSRILFLTD  208
             +  ++P + C  +    CG      S + ++ T P  P    +  +      R+L ++ 
Sbjct  353  SK--VTPEKVCETI--KLCGSKRRARSISRAVATTPSLPVDEENQGSFCQGCKRLLGMSS  408

Query  209  LHWDH  213
             + DH
Sbjct  409  QNLDH  413


>sp|Q28FE0|CPPED_XENTR Serine/threonine-protein phosphatase CPPED1 
OS=Xenopus tropicalis OX=8364 GN=cpped1 PE=2 SV=1
Length=311

 Score = 49.4 bits (116),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 40/234 (17%), Positives = 72/234 (31%), Gaps = 51/234 (22%)

Query  248  EYSKCD-------LPLRTLESLLSGLGPAGPF-DMVYWTGDIPAHDVWHQTRQDQLRALT  299
            E   CD         +R  E  +  +    P        GD+       + +++Q + L 
Sbjct  48   EIGDCDYGGDEWEQEIRLTEEAVKAINKLSPKPKFFVLCGDLVHSMPGIEWKEEQEKDLK  107

Query  300  TVTALVRKFLGPVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEA  359
             V   ++K    +P+    GNH+             GN  +    +A   +W      + 
Sbjct  108  NV---LQKTHQEIPLVFVSGNHDI------------GNAPTPETIQAYCDSWG-----DD  147

Query  360  LRTLRIGGFYALSPYPGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRG  419
              +  +GG +          + LN       +    +         +WL  +L  AE+R 
Sbjct  148  YFSFWVGGVFF---------LVLNSQLFFDASKCPEL----KDNHDRWLAAQLAIAEERK  194

Query  420  DK-VHIIGHIPPGHCLKSWSWNYYRIVARYENTLAAQFF---------GHTHVD  463
             K   +  HIP          +Y+ I       +   F          GH H +
Sbjct  195  CKHAIVFQHIPLFLQKADEDNDYFNIEKSLRQEILQMFLKAGIKAVFSGHYHRN  248


>sp|P26779|SAP_BOVIN Prosaposin OS=Bos taurus OX=9913 GN=PSAP 
PE=1 SV=3
Length=525

 Score = 48.6 bits (114),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 28/107 (26%), Positives = 44/107 (41%), Gaps = 9/107 (8%)

Query  62   HPLSPQGHPARLHRIVPRLRDVFGWGNLTCPICKGLFTAINLGLKKEPNVARVGSVAIKL  121
            H  S +G PA   R++PR    F      C +CK L   ++  L+K     ++ +   K 
Sbjct  387  HLCSSRGLPAATVRVMPRKDGGF------CEVCKKLVGYLDRNLEKNSTKEQILAALEKG  440

Query  122  CNLLKIAPPAVCQSIVHLFEDDMVEVWRRSVLSPSEACGLLLGSTCG  168
            C+ L       C   V  +E  ++E+    V+ PS  C  L    C 
Sbjct  441  CSFLPDQYRKQCDQFVTEYEPVLIEILVE-VMDPSFVC--LKIGACP  484


 Score = 48.2 bits (113),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 20/82 (24%), Positives = 33/82 (40%), Gaps = 1/82 (1%)

Query  82   DVFGWGNLTCPICKGLFTAINLGLKKEPNVARVGSVAIKLCNLL-KIAPPAVCQSIVHLF  140
                  +L C ICK + TA    LK       +     + C+ L K    A C+ IV  +
Sbjct  54   SKPTVKSLPCDICKDVITAAGNLLKDNATEQEILMYLERTCDWLPKPNMSASCKEIVDSY  113

Query  141  EDDMVEVWRRSVLSPSEACGLL  162
               ++++ +  +  P E C  L
Sbjct  114  LPVILDMIKGQMSHPGEVCSAL  135


 Score = 42.8 bits (99),  Expect = 0.008, Method: Composition-based stats.
 Identities = 15/87 (17%), Positives = 33/87 (38%), Gaps = 2/87 (2%)

Query  83   VFGWGNLTCPICKGLFTAINLGLKKEPNVARVGSVAIKLCNLLKIAPPAVCQSIVHLFED  142
                 ++ C +C+ +   +   +        +     K+C+ L  +    CQ +V  +  
Sbjct  308  APAKADIYCEVCEFVVKEVAKLIDNNRTEEEILHALDKVCSKLPTSLAEQCQEVVDTYGS  367

Query  143  DMVEVWRRSVLSPSEACGLL-LGSTCG  168
             ++ +      SP   C +L L S+ G
Sbjct  368  SILSILLDEA-SPELVCSMLHLCSSRG  393


>sp|O13035|SAP_CHICK Prosaposin OS=Gallus gallus OX=9031 GN=PSAP 
PE=1 SV=1
Length=518

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 18/82 (22%), Positives = 30/82 (37%), Gaps = 1/82 (1%)

Query  82   DVFGWGNLTCPICKGLFTAINLGLKKEPNVARVGSVAIKLCNLLKIAPPAV-CQSIVHLF  140
                  ++ C +CK L T +   LK       + S   K C  L     A  C+ IV  +
Sbjct  55   SKPAVNSIPCDLCKELVTVVGKVLKDNGTEDEIRSYLEKRCEFLPDQGLASECKEIVDSY  114

Query  141  EDDMVEVWRRSVLSPSEACGLL  162
               ++++ +     P   C  L
Sbjct  115  LPVIMDMIKEEFDKPEVVCSAL  136


 Score = 44.7 bits (104),  Expect = 0.002, Method: Composition-based stats.
 Identities = 17/129 (13%), Positives = 41/129 (32%), Gaps = 19/129 (15%)

Query  69   HPARLHRIVPRLRDVFGWGNLTCPICKGLFTAINLGLKKEPNVARVGSVAIKLCNLLKIA  128
            H  ++  +         +    C IC+ +   +   L+       +      +C LL  +
Sbjct  291  HEVKMETVEKATVQEKTFS--VCEICETMVKEVTGLLESNKTEEEIVHEMEVVCYLLPAS  348

Query  129  PPAVCQSIVHLFEDDMVEVWRRSVLSPSEACGLLLGSTCGHWDIFSSWNISLPTVPKPPP  188
                C+  + ++   ++++   +  +P   C  ++   C                 KPP 
Sbjct  349  VKDQCKDFIEVYGQALIDMLLEAT-NPEAVC--VMLKCC--------------AANKPPQ  391

Query  189  KPPSPPAPG  197
            +P      G
Sbjct  392  QPVVVKPAG  400


 Score = 44.0 bits (102),  Expect = 0.004, Method: Composition-based stats.
 Identities = 18/78 (23%), Positives = 34/78 (44%), Gaps = 3/78 (4%)

Query  91   CPICKGLFTAINLGLKKEPNVARVGSVAIKLCNLLKIAPPAVCQSIVHLFEDDMVEVWRR  150
            C ICK +    +  L+K      + ++  K+C+ L  +    C   V  +E  +V++   
Sbjct  403  CDICKMIVAYADKELEKNATTTEIEALLEKVCHFLPESVSDQCVQFVEQYEPVVVQLLAE  462

Query  151  SVLSPSEACGLLLGSTCG  168
             ++ P+  C  L    CG
Sbjct  463  -MMDPTFVCTKL--GVCG  477


>sp|Q5U3W0|CPPED_DANRE Serine/threonine-protein phosphatase CPPED1 
OS=Danio rerio OX=7955 GN=cpped1 PE=2 SV=1
Length=309

 Score = 45.9 bits (107),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 42/250 (17%), Positives = 73/250 (29%), Gaps = 54/250 (22%)

Query  232  GSGLPPASRPGAGYWGEYSKCDL-------PLRTLESLLSGLGPAGPFD-MVYWTGDIPA  283
             +  P      A   G+   CD         ++  +  +  +    P    +   GD+  
Sbjct  35   QAADPQLGLMKAWRIGD---CDSGGDEWDEEVQLTKQAVQAINKLQPKPRFIVLCGDLVH  91

Query  284  HDVWHQTRQDQLRALTTVTALVRKFLGPVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWL  343
                   R+ Q++ L      +R     +P+    GNH+             GN  +   
Sbjct  92   AMPGSPFREQQIKDLK---DALRGTDPHIPLVFVSGNHD------------LGNAPTPDT  136

Query  344  YEAMAKAWEPWLPAEALRTLRIGGFYALSPYPGLRLISLNMNFCSRENFWLLINSTDPAG  403
             E     W              G  Y      G+  + LN  F    +    +       
Sbjct  137  VEQFCHEW--------------GDDYFSFWVGGVLCLVLNSQFFFDSSGCPELME----A  178

Query  404  QLQWLVGELQAAEDRGDK-VHIIGHIP-----PGHCLKSWSWN---YYRIVARYENT-LA  453
               WL   LQ A     + V +  HIP     P      ++        ++ R++   + 
Sbjct  179  HEVWLENRLQMAVQTPSRHVLVFQHIPLFLRTPDEEDDYFNLQRGIREHLIQRFKRAGVK  238

Query  454  AQFFGHTHVD  463
            A F GH H +
Sbjct  239  AVFSGHYHRN  248


>sp|Q5RCR9|CPPED_PONAB Serine/threonine-protein phosphatase CPPED1 
OS=Pongo abelii OX=9601 GN=CPPED1 PE=2 SV=1
Length=314

 Score = 45.9 bits (107),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 43/233 (18%), Positives = 66/233 (28%), Gaps = 52/233 (22%)

Query  250  SKCDL-------PLRTLESLLSGLGPAGPF-DMVYWTGDIPAHDVWHQTRQDQLRALTTV  301
              CD         +R  E  +  +    P        GD+         R +Q   L  V
Sbjct  52   GDCDNGGDEWEQEIRLTEQAVQAINKLNPKPKFFVLCGDLIHAMPGKPWRTEQTEDLKRV  111

Query  302  TALVRKFLGPVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALR  361
               V +    +P+    GNH+             GN  +    +   + W          
Sbjct  112  LRTVDR---AIPLVLVSGNHDI------------GNAPTAETVDEFCRTW----------  146

Query  362  TLRIGGFYALSPYPGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGDK  421
                G  Y      G+  + LN  F    +    +       Q QWL  +L  A  R  +
Sbjct  147  ----GDDYFSFWVGGVLFLVLNSQFYENPSKCPSLKQ----AQDQWLDEQLSIARQRHCQ  198

Query  422  -VHIIGHIPPG-HCLKSWSWNYYRIVARYENTLAAQFF---------GHTHVD  463
               I  HIP     +      Y+ +       LA +F          GH H +
Sbjct  199  HAIIFQHIPLFLESIDEDDDYYFNLSKSTRKKLADKFIHAGVKVVFSGHYHRN  251


>sp|Q3LIE5|ADPRM_HUMAN Manganese-dependent ADP-ribose/CDP-alcohol 
diphosphatase OS=Homo sapiens OX=9606 GN=ADPRM PE=1 SV=1
Length=342

 Score = 45.5 bits (106),  Expect = 0.001, Method: Composition-based stats.
 Identities = 50/250 (20%), Positives = 87/250 (35%), Gaps = 58/250 (23%)

Query  264  SGLGPAGPFDMVYWTGDIPAHDVWHQTRQDQLRALTTVTALVRKFLGPVPVYPAVGNHES  323
                 +     V   GDI   D ++       ++L  V  + ++    VPV+   GNHE 
Sbjct  58   DWNNESSMPCCVLQLGDII--DGYNAQYNASKKSLELVMDMFKRL--KVPVHHTWGNHEF  113

Query  324  TPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGGFYALSPYPGLRLISLN  383
               N           ++++L + +          E + +     ++ + P+P  R I L+
Sbjct  114  Y--NFSREYLTHSKLNTKFLEDQIVHH------PETMPSEDYYAYHFV-PFPKFRFILLD  164

Query  384  -------------------MNFCSRENFWLLINS----TDPA----------GQLQWLVG  410
                               M      N    +NS    ++P            QL WL  
Sbjct  165  AYDLSVLGVDQSSPKYEQCMKILREHNPNTELNSPQGLSEPQFVQFNGGFSQEQLNWLNE  224

Query  411  ELQAAEDRGDKVHIIGHIP--PGHCLKSW-SWNYYR---IVARYENTLAAQFFGHTH---  461
             L  ++   +KV I+ H+P  P        +WNY     ++  +E  +   F GHTH   
Sbjct  225  VLTFSDTNQEKVVIVSHLPIYPDASDNVCLAWNYRDALAVIWSHECVVCF-FAGHTHDGG  283

Query  462  --VDEFEVFY  469
               D F V++
Sbjct  284  YSEDPFGVYH  293


>sp|Q8BFS6|CPPED_MOUSE Serine/threonine-protein phosphatase CPPED1 
OS=Mus musculus OX=10090 GN=Cpped1 PE=1 SV=1
Length=312

 Score = 44.7 bits (104),  Expect = 0.001, Method: Composition-based stats.
 Identities = 44/232 (19%), Positives = 68/232 (29%), Gaps = 51/232 (22%)

Query  250  SKCDL-------PLRTLESLLSGLGPAGPF-DMVYWTGDIPAHDVWHQTRQDQLRALTTV  301
              CD         +R  E  +  +    P        GD+         RQ+Q R L  V
Sbjct  52   GNCDAGGDEWGQEIRLTEQAVEAINKLNPKPKFFVLCGDLVHAMPGTPWRQEQTRDLQRV  111

Query  302  TALVRKFLGPVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALR  361
               V +    +P+    GNH+             GN  +    E   + W          
Sbjct  112  LKAVDQ---DIPLVMVSGNHD------------LGNAPTAETVEEFCQTW----------  146

Query  362  TLRIGGFYALSPYPGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGDK  421
                G  Y      G+  + LN  F    +    +       Q  WL  +L  AE +  +
Sbjct  147  ----GDDYFSFWVGGVLFLVLNSQFLYDASRCPALKQ----AQDHWLDQQLNIAEQKQCQ  198

Query  422  -VHIIGHIP---PGHCLKSWSWNYYRIVAR------YENTLAAQFFGHTHVD  463
               +  HIP            +N  + V +          + A F GH H +
Sbjct  199  HAIVFQHIPLFLQSIDEDDDYFNLTKTVRKELAEKLTRAGIRAVFSGHYHRN  250


>sp|Q9BRF8|CPPED_HUMAN Serine/threonine-protein phosphatase CPPED1 
OS=Homo sapiens OX=9606 GN=CPPED1 PE=1 SV=3
Length=314

 Score = 44.0 bits (102),  Expect = 0.003, Method: Composition-based stats.
 Identities = 43/233 (18%), Positives = 66/233 (28%), Gaps = 52/233 (22%)

Query  250  SKCDL-------PLRTLESLLSGLGPAGPF-DMVYWTGDIPAHDVWHQTRQDQLRALTTV  301
              CD         +R  E  +  +    P        GD+         R +Q   L  V
Sbjct  52   GDCDNGGDEWEQEIRLTEQAVQAINKLNPKPKFFVLCGDLIHAMPGKPWRTEQTEDLKRV  111

Query  302  TALVRKFLGPVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALR  361
               V +    +P+    GNH+             GN  +    E   + W          
Sbjct  112  LRAVDR---AIPLVLVSGNHDI------------GNTPTAETVEEFCRTW----------  146

Query  362  TLRIGGFYALSPYPGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGDK  421
                G  Y      G+  + LN  F    +    +       Q QWL  +L  A  R  +
Sbjct  147  ----GDDYFSFWVGGVLFLVLNSQFYENPSKCPSLKQ----AQDQWLDEQLSIARQRHCQ  198

Query  422  -VHIIGHIPPG-HCLKSWSWNYYRIVARYENTLAAQFF---------GHTHVD  463
               +  HIP     +      Y+ +       LA +F          GH H +
Sbjct  199  HAIVFQHIPLFLESIDEDDDYYFNLSKSTRKKLADKFIHAGVKVVFSGHYHRN  251


>sp|A7YY53|ADPRM_BOVIN Manganese-dependent ADP-ribose/CDP-alcohol 
diphosphatase OS=Bos taurus OX=9913 GN=ADPRM PE=2 SV=2
Length=337

 Score = 42.4 bits (98),  Expect = 0.009, Method: Composition-based stats.
 Identities = 46/222 (21%), Positives = 78/222 (35%), Gaps = 53/222 (24%)

Query  279  GDIPAHDVWHQTRQDQLRALTTVTALVRKFLGPVPVYPAVGNHESTPVNSFPPPFIEGNH  338
            GDI   D ++   +   ++L  V    +     VPV+   GNHE    N           
Sbjct  73   GDII--DGYNAQYKASEKSLERVMNTFQML--RVPVHHTWGNHEFY--NFSRDYLTNSKL  126

Query  339  SSRWLYEAMAKAWEPWLPAEALRTLRIGGFYALSPYPGLRLISL----------------  382
            ++++L + +A         E + +     ++ + P+P  R I L                
Sbjct  127  NTKFLEDQIAHH------PETVPSEDYYAYHFV-PFPKFRFILLDAYDMSVLGVDQSSPK  179

Query  383  -------------NMNFCS----RENFWLLINSTDPAGQLQWLVGELQAAEDRGDKVHII  425
                         N    S    RE  ++  N      QL WL   L  ++   +KV I+
Sbjct  180  YQQCLKILREHNPNTELNSPQGLREPQFVQFNGGFSPEQLNWLNAVLTFSDRNQEKVVIV  239

Query  426  GHIP--PGHCLKSW-SWNYYR---IVARYENTLAAQFFGHTH  461
             H+P  P        +WNY     ++  ++  +   F GHTH
Sbjct  240  SHLPIYPEASDSVCLAWNYRDALAVIWSHKCVVCF-FAGHTH  280


>sp|Q99KS6|ADPRM_MOUSE Manganese-dependent ADP-ribose/CDP-alcohol 
diphosphatase OS=Mus musculus OX=10090 GN=Adprm PE=1 SV=1
Length=340

 Score = 42.4 bits (98),  Expect = 0.009, Method: Composition-based stats.
 Identities = 48/237 (20%), Positives = 82/237 (35%), Gaps = 53/237 (22%)

Query  264  SGLGPAGPFDMVYWTGDIPAHDVWHQTRQDQLRALTTVTALVRKFLGPVPVYPAVGNHES  323
                 +     V   GDI   D ++   +   ++L  V    +     VPV+   GNHE 
Sbjct  58   DWNKESSMPCCVLQLGDII--DGYNAQYKVSEKSLELVMNTFQML--KVPVHHTWGNHEF  113

Query  324  TPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGGFYALSPYPGLRLISLN  383
               N           +S++L + +A+        E   +     ++ + P+P  R I L+
Sbjct  114  Y--NFSRDYLASSKLNSKFLEDQIAQH------PETTPSENYYAYHFV-PFPKFRFILLD  164

Query  384  -------------------MNFCSRENFWLLINS----TDPA----------GQLQWLVG  410
                               M      N  + +NS    ++P            QL WL  
Sbjct  165  SYDLSVLGIDPSSPKYEQCMKMLREHNPNVELNSPQGLSEPQYVQFNGGFSQEQLNWLNE  224

Query  411  ELQAAEDRGDKVHIIGHIP--PGHCLKSW-SWNYYR---IVARYENTLAAQFFGHTH  461
             L  ++   +KV I+ H+P  P        +WNY     I+  ++  +     GHTH
Sbjct  225  VLTFSDTNQEKVVIVSHLPIYPEASDSVCLAWNYVDALSIIWSHKCVVCF-LAGHTH  280


>sp|Q76LX8|ATS13_HUMAN A disintegrin and metalloproteinase with 
thrombospondin motifs 13 OS=Homo sapiens OX=9606 GN=ADAMTS13 
PE=1 SV=1
Length=1427

 Score = 42.8 bits (99),  Expect = 0.012, Method: Composition-based stats.
 Identities = 22/105 (21%), Positives = 32/105 (30%), Gaps = 7/105 (7%)

Query  4    YGASLRQSCPRSGREQGQDGTAGAPGLLWMGLVLALALALALALALSDSRVLWAPAEAHP  63
            +  +    C  SG     DG A   GL W        L+L   L+   +R +W P    P
Sbjct  234  HDGAPGSGCGPSGHVMASDGAAPRAGLAWSPCSRRQLLSL---LSAGRARCVWDPPRPQP  290

Query  64   ----LSPQGHPARLHRIVPRLRDVFGWGNLTCPICKGLFTAINLG  104
                  P   P   +    + R  FG   + C   +         
Sbjct  291  GSAGHPPDAQPGLYYSANEQCRVAFGPKAVACTFAREHLDMCQAL  335


>sp|Q6NUJ1|SAPL1_HUMAN Proactivator polypeptide-like 1 OS=Homo 
sapiens OX=9606 GN=PSAPL1 PE=2 SV=2
Length=521

 Score = 41.7 bits (96),  Expect = 0.019, Method: Composition-based stats.
 Identities = 16/83 (19%), Positives = 35/83 (42%), Gaps = 2/83 (2%)

Query  82   DVFGWGNLTCPICKGLFTAINLGLKKEPNVARVGSVAIKLCNLL-KIAPPAVCQSIVHLF  140
            +     +L C +C+ +  A   GL  +   + + ++ +K C  L      A C+ +V   
Sbjct  55   NKPTAKSLPCDVCQDIAAAAGNGLNPDATESDILALVMKTCEWLPSQESSAGCKWMVDAH  114

Query  141  EDDMVEVWR-RSVLSPSEACGLL  162
               ++ + R     +P++ C  L
Sbjct  115  SSAILSMLRGAPDSAPAQVCTAL  137


 Score = 39.0 bits (89),  Expect = 0.13, Method: Composition-based stats.
 Identities = 25/153 (16%), Positives = 60/153 (39%), Gaps = 17/153 (11%)

Query  68   GHPARLHRIV------------PRLRDVFGWGN-LTCPICKGLFTAINLGLKKEPNVARV  114
            G PARL ++V            PR +        +TC +C  +   ++  L    +   +
Sbjct  258  GAPARLTQVVAMDGVPSLELGLPRKQSEMQMKAGVTCEVCMNVVQKLDHWLMSNSSELMI  317

Query  115  GSVAIKLCNLLKIAPPAVCQSIVHLFEDDMVEVWRRSVLSPSEACGLLLGSTCGHWDIFS  174
                 ++C+++  +    C  +V  +   +V++  +  ++P + C  +    CG+     
Sbjct  318  THALERVCSVMPASITKECIILVDTYSPSLVQLVAK--ITPEKVCKFI--RLCGNRRRAR  373

Query  175  SWNISLPTVPKPPPKPPSPPAPGAPVSRILFLT  207
            + + +   VP P     +  +      R+L ++
Sbjct  374  AVHDAYAIVPSPEWDAENQGSFCNGCKRLLTVS  406


>sp|Q7T0Q0|ADPRM_XENLA Manganese-dependent ADP-ribose/CDP-alcohol 
diphosphatase OS=Xenopus laevis OX=8355 GN=adprm PE=2 SV=1
Length=356

 Score = 40.9 bits (94),  Expect = 0.026, Method: Composition-based stats.
 Identities = 20/85 (24%), Positives = 36/85 (42%), Gaps = 5/85 (6%)

Query  382  LNMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGDKVHIIGHIP--PGHCLKSW-S  438
            LN      E  ++L N      QL W+   L +++ + +KV ++ H+P  P         
Sbjct  208  LNSPTGLEEEQFVLFNGGISPSQLDWIQSILTSSDKKEEKVFVVSHLPVHPDAADTMCLI  267

Query  439  WNYYRIVA--RYENTLAAQFFGHTH  461
            WNY  +++  +    +     GH H
Sbjct  268  WNYPEVLSMLQSHPCVVGYLAGHNH  292


>sp|Q5M886|ADPRM_RAT Manganese-dependent ADP-ribose/CDP-alcohol 
diphosphatase OS=Rattus norvegicus OX=10116 GN=Adprm PE=1 
SV=1
Length=337

 Score = 40.9 bits (94),  Expect = 0.031, Method: Composition-based stats.
 Identities = 47/237 (20%), Positives = 81/237 (34%), Gaps = 53/237 (22%)

Query  264  SGLGPAGPFDMVYWTGDIPAHDVWHQTRQDQLRALTTVTALVRKFLGPVPVYPAVGNHES  323
                 +     V   GDI   D ++   +   ++L  V    +     VPV+   GNHE 
Sbjct  58   DWNKESSMPCCVLQLGDII--DGYNAQYKVSEKSLELVMNTFQML--KVPVHHTWGNHEF  113

Query  324  TPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGGFYALSPYPGLRLISLN  383
               N           +S++L + + +        E   +     ++ + P+P  R I L+
Sbjct  114  Y--NFSRDYLANSKLNSKFLEDQIPQH------PETTPSENYYAYHFV-PFPKFRFILLD  164

Query  384  -------------------MNFCSRENFWLLINS----TDPA----------GQLQWLVG  410
                               M      N  + +NS    ++P            QL WL  
Sbjct  165  SYDLSVLGIDQFSPKYEQCMKILREHNPNVELNSPQGLSEPQYVQFNGGFSQEQLNWLNE  224

Query  411  ELQAAEDRGDKVHIIGHIP--PGHCLKSW-SWNYYR---IVARYENTLAAQFFGHTH  461
             L  ++   +KV I+ H+P  P        +WNY     I+  ++  +     GHTH
Sbjct  225  VLTFSDANQEKVVIVSHLPIYPEASDSVCLAWNYVDALSIIWSHQCVVCF-LAGHTH  280


>sp|Q66JJ3|ADPRM_XENTR Manganese-dependent ADP-ribose/CDP-alcohol 
diphosphatase OS=Xenopus tropicalis OX=8364 GN=adprm PE=2 
SV=1
Length=342

 Score = 40.5 bits (93),  Expect = 0.040, Method: Composition-based stats.
 Identities = 18/100 (18%), Positives = 37/100 (37%), Gaps = 17/100 (17%)

Query  401  PAGQLQWLVGELQAAEDRGDKVHIIGHIP--PGHCLKSW-SWNYYRIVA--RYENTLAAQ  455
               QL W+   L +++++ + V ++ H+P  P         WNY  +++  +    +   
Sbjct  213  SPSQLDWMERVLTSSDEKEENVFVVSHLPVHPDAADPMCLVWNYPEVLSVLQSHPCVVGY  272

Query  456  FFGHTH-----VD-------EFEVFYDEETLSRPLAVAFL  483
              GH H     +D        F    +    SR     ++
Sbjct  273  LAGHNHEGRYCMDPYGIHHLTFSGVIETPPESRAFGTMYV  312


>sp|Q58DC0|CPPED_BOVIN Serine/threonine-protein phosphatase CPPED1 
OS=Bos taurus OX=9913 GN=CPPED1 PE=2 SV=1
Length=313

 Score = 40.1 bits (92),  Expect = 0.041, Method: Composition-based stats.
 Identities = 43/257 (17%), Positives = 69/257 (27%), Gaps = 56/257 (22%)

Query  230  RRGSGLPPASRPGAGYWGEY-----SKCDL-------PLRTLESLLSGLGPAGPF-DMVY  276
            R   G     +     +G         CD         +R  E  +  +    P      
Sbjct  27   REWKGPFYFIQGADPQFGLMKAWATGDCDNGGDEWEQEIRLAEQAVQAINKLNPKPKFFV  86

Query  277  WTGDIPAHDVWHQTRQDQLRALTTVTALVRKFLGPVPVYPAVGNHESTPVNSFPPPFIEG  336
              GD+         R++Q   L  V   V      +P+    GNH+             G
Sbjct  87   LCGDLVHAMPGRPWRKEQTEDLQRVLRTVDS---DIPLVLVSGNHDV------------G  131

Query  337  NHSSRWLYEAMAKAWEPWLPAEALRTLRIGGFYALSPYPGLRLISLNMNFCSRENFWLLI  396
            N  +        + W              G  Y      G+  + LN  F    +    +
Sbjct  132  NVPTPETIAEFQRTW--------------GDDYFSFWVGGVLFLVLNSQFLYDASRCPAL  177

Query  397  NSTDPAGQLQWLVGELQAAEDRGDK-VHIIGHIPPGHCLKSWSWNYYRIVARYENTLA--  453
                      WL  +L+ A  R  +   +  HIP          +Y+ +       +A  
Sbjct  178  KQ----EHDHWLDQQLRIAGQRACRHAVVFQHIPLFLQSIGEDDDYFNLTKSVRKEMADK  233

Query  454  -------AQFFGHTHVD  463
                   A F GH H +
Sbjct  234  FVEAGVKAVFSGHYHRN  250


>sp|Q8H5F8|ADPRM_ORYSJ Manganese-dependent ADP-ribose/CDP-alcohol 
diphosphatase OS=Oryza sativa subsp. japonica OX=39947 GN=Os07g0688000 
PE=2 SV=1
Length=321

 Score = 40.1 bits (92),  Expect = 0.047, Method: Composition-based stats.
 Identities = 24/66 (36%), Positives = 30/66 (45%), Gaps = 7/66 (11%)

Query  402  AGQLQWLVGELQAAEDRGDKVHIIGHIP--PGH-CLKSWSWNYYR---IVARYENTLAAQ  455
              QL WL   LQ A  R   V +  H+P  PG     +  WNY     IV +Y+  + A 
Sbjct  201  KEQLSWLNDVLQDASARRQNVILCSHLPMDPGSASFAALMWNYDEVMAIVRQYK-CVKAC  259

Query  456  FFGHTH  461
            F GH H
Sbjct  260  FAGHDH  265


>sp|Q29075|NKL_PIG Antimicrobial peptide NK-lysin (Fragment) OS=Sus 
scrofa OX=9823 GN=NKL PE=1 SV=1
Length=129

 Score = 37.8 bits (86),  Expect = 0.072, Method: Composition-based stats.
 Identities = 25/104 (24%), Positives = 41/104 (39%), Gaps = 12/104 (12%)

Query  42   ALALALALSDSRVLWAPAEAHPLSPQGHPARLHRIVPR-----LRDVFGWGNLTCPICKG  96
             LA +    +   L   A AHP   +     L    P+      R+  G   L C  C+ 
Sbjct  2    GLAFSGLTPEHSAL---ARAHPCDGEQFCQNLAPEDPQGDQLLQREELG---LICESCRK  55

Query  97   LFTAINLGLKKEPNVARVGSVAIKLCNLLKIAPPAVCQSIVHLF  140
            +   +   +  +PN   V   A ++C+ +KI    VC+ I+  F
Sbjct  56   IIQKLEDMVGPQPNEDTVTQAASRVCDKMKILR-GVCKKIMRTF  98


>sp|P9WL81|Y2577_MYCTU Uncharacterized protein Rv2577 OS=Mycobacterium 
tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv2577 
PE=3 SV=1
Length=529

 Score = 39.7 bits (91),  Expect = 0.092, Method: Composition-based stats.
 Identities = 43/238 (18%), Positives = 71/238 (30%), Gaps = 40/238 (17%)

Query  205  FLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGEYS------KCD-----  253
             LT+L  D DY+     D   P      +            +G+ S        D     
Sbjct  130  HLTNLTPDTDYVYAAVHDGTTPELGTARTAPSGRKPLRFTSFGDQSTPALGRLADGRYVS  189

Query  254  ----LPLR-TLESLLSGLGPAGPFDMVYWTGDIPAHDVWHQTRQDQLRALTTVTALVRKF  308
                 P    +   +  + P          GD+   ++     +         T   R  
Sbjct  190  DNIGSPFAGDITIAIERIAPL----FNLINGDLCYANLAQDRIRTWSDWFDNNTRSARYR  245

Query  309  LGPVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGGF  368
                P  PA GNHE    N      I         Y+A    +   +P         G +
Sbjct  246  ----PWMPAAGNHE----NEVGNGPIG--------YDAYQTYFA--VPDSGSSPQLRGLW  287

Query  369  YALSPYPGLRLISL-NMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGDKVHII  425
            Y+ +    +R+ISL N + C ++     +       Q +WL  EL  A    +   ++
Sbjct  288  YSFTA-GSVRVISLHNDDVCYQDGGNSYVRGYSGGEQRRWLQAELANARRDSEIDWVV  344


>sp|P9WL80|Y2577_MYCTO Uncharacterized protein MT2654 OS=Mycobacterium 
tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT2654 
PE=3 SV=1
Length=529

 Score = 39.7 bits (91),  Expect = 0.092, Method: Composition-based stats.
 Identities = 43/238 (18%), Positives = 71/238 (30%), Gaps = 40/238 (17%)

Query  205  FLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGEYS------KCD-----  253
             LT+L  D DY+     D   P      +            +G+ S        D     
Sbjct  130  HLTNLTPDTDYVYAAVHDGTTPELGTARTAPSGRKPLRFTSFGDQSTPALGRLADGRYVS  189

Query  254  ----LPLR-TLESLLSGLGPAGPFDMVYWTGDIPAHDVWHQTRQDQLRALTTVTALVRKF  308
                 P    +   +  + P          GD+   ++     +         T   R  
Sbjct  190  DNIGSPFAGDITIAIERIAPL----FNLINGDLCYANLAQDRIRTWSDWFDNNTRSARYR  245

Query  309  LGPVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGGF  368
                P  PA GNHE    N      I         Y+A    +   +P         G +
Sbjct  246  ----PWMPAAGNHE----NEVGNGPIG--------YDAYQTYFA--VPDSGSSPQLRGLW  287

Query  369  YALSPYPGLRLISL-NMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGDKVHII  425
            Y+ +    +R+ISL N + C ++     +       Q +WL  EL  A    +   ++
Sbjct  288  YSFTA-GSVRVISLHNDDVCYQDGGNSYVRGYSGGEQRRWLQAELANARRDSEIDWVV  344


>sp|B2W0D9|STS1_PYRTR Tethering factor for nuclear proteasome 
sts1 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) OX=426418 
GN=sts1 PE=3 SV=1
Length=310

 Score = 38.2 bits (87),  Expect = 0.16, Method: Composition-based stats.
 Identities = 35/198 (18%), Positives = 54/198 (27%), Gaps = 36/198 (18%)

Query  177  NISLPTVPKPPPKPPSPPAPGAPVSRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLP  236
            NIS   +P P       P     + +   +   H D      T                 
Sbjct  76   NISGRPLPLPRLLETLSPDDMRNLLQ--SICQRHPDISNEIVTTAPRPSIQSTLEVLAKY  133

Query  237  PASRPGAGYWGEYSKCDLPLRTLESLLSGLGPAGPFDMVYWTGDIPAH--DVWHQTRQDQ  294
             AS   A  +G  +  D     +   L  L  +          D   H      Q     
Sbjct  134  EASFQAAFPFGGRASSDYAYNRVRQQLDELLDSLK--------DFTPHFLPPNEQQPATS  185

Query  295  LRALTTVTALVRKFLGPVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPW  354
            L  L   T ++ +          + N ++   N             +  YE MAKAW   
Sbjct  186  LTFLDGATNIIHR----------LPNWDTFQHN----------RHKQEAYEEMAKAWAMV  225

Query  355  LPAEALRT----LRIGGF  368
            +   A +     L+ GG+
Sbjct  226  IQEAAKKAGGIQLQYGGW  243


>sp|O59759|YJM5_SCHPO Uncharacterized protein C1020.05 OS=Schizosaccharomyces 
pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC1020.05 
PE=3 SV=1
Length=509

 Score = 38.6 bits (88),  Expect = 0.19, Method: Composition-based stats.
 Identities = 51/292 (17%), Positives = 89/292 (30%), Gaps = 73/292 (25%)

Query  195  APGAPVSRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGEYSKCDL  254
                   +IL L+DLH+       +D  C DP            ++  A           
Sbjct  202  DEEKKTIKILQLSDLHY-----SNSDRPCRDPYPYETAEDCMADAKTTA-----------  245

Query  255  PLRTLESLLSGLGPAGPFDMVYWTGDIPAHDVWHQTRQDQLRALTTVTALVRKFLGPVPV  314
                +  LL         D V  TGD+   D    +R  +   +  V+  V      VP 
Sbjct  246  ---FVNELLQ----LEEPDFVLLTGDLINGDT---SRDARSSLMKAVSPFVDY---NVPF  292

Query  315  YPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGGFYALSPY  374
                GNH+             G+ S   L + +++          +  +   G + L   
Sbjct  293  AVNFGNHD-----------DLGDLSREELAKILSQIPG---SMGLIGNVSGVGNFVLHSP  338

Query  375  PGLRLISLNMNFCSRENFWLLINSTDPA------GQLQWLVGELQAAEDRGDKVHIIGHI  428
                +  L+       N  L      P        QL+WL  ++   +    ++ ++ HI
Sbjct  339  RKFAIYVLDTK-GDTSNRRLC-----PGYDAITEDQLEWLSSKVADFKYEPIQMAVL-HI  391

Query  429  P----------PGHCLKSWSW-----NYYRIVARYENTLAAQFFGHTHVDEF  465
            P           G   +  S+     N  + +      +     GH HV++F
Sbjct  392  PLKEFCETEDLVGAFREPCSYSICDPNTAKALKSLR--IPLAIAGHDHVNDF  441


>sp|E3RPB1|STS1_PYRTT Tethering factor for nuclear proteasome 
sts1 OS=Pyrenophora teres f. teres (strain 0-1) OX=861557 GN=sts1 
PE=3 SV=1
Length=310

 Score = 37.4 bits (85),  Expect = 0.34, Method: Composition-based stats.
 Identities = 35/198 (18%), Positives = 54/198 (27%), Gaps = 36/198 (18%)

Query  177  NISLPTVPKPPPKPPSPPAPGAPVSRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLP  236
            NIS   +P P       P     + +   +   H D      T                 
Sbjct  76   NISGRPLPLPRLLETLSPDEMRNLLQ--SICQRHPDISNEIVTTAPRPSIQSTLEVLAKY  133

Query  237  PASRPGAGYWGEYSKCDLPLRTLESLLSGLGPAGPFDMVYWTGDIPAH--DVWHQTRQDQ  294
             AS   A  +G  +  D     +   L  L  +          D   H      Q     
Sbjct  134  EASFQAAFPFGGRASSDYAYNRVRQQLDELLDSLK--------DFTPHFLPPNEQQPATS  185

Query  295  LRALTTVTALVRKFLGPVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPW  354
            L  L   T ++ +          + N ++   N             +  YE MAKAW   
Sbjct  186  LAFLDGATDIIHR----------LPNWDTFQHN----------RHKQEAYEEMAKAWAIV  225

Query  355  LPAEALRT----LRIGGF  368
            +   A +     L+ GG+
Sbjct  226  IREAAKKAGGIQLQYGGW  243


>sp|A2RSY6|TRM1L_MOUSE TRMT1-like protein OS=Mus musculus OX=10090 
GN=Trmt1l PE=1 SV=1
Length=728

 Score = 37.4 bits (85),  Expect = 0.44, Method: Composition-based stats.
 Identities = 34/201 (17%), Positives = 61/201 (30%), Gaps = 22/201 (11%)

Query  168  GHWDIFSSWNISLPTVPKPPPKPPSPPAP---GAPVSRILFLTDLHWDHDYLEGTDPDCA  224
            G  D  SS N   P        P  P       +       L +LHW           C 
Sbjct  97   GDVDSASSLNSDNPGTENSQTCPLCPKEKFRAYSSHKLRRHLQNLHWKISVEFEGYRMCI  156

Query  225  DPLCCRRGSGLPPASRPGAGYWGEYSKCDLPLRTLESLLSGLGPAGPFDMVYWTGDIPAH  284
              L CR            +   G +  C +   T+             DM+   G +  H
Sbjct  157  CHLACRPVK-PTIVGEQISSKLGAHYHCIICSATI---------TRRTDML---GHVKRH  203

Query  285  DVWHQTRQDQLRALTTVT--ALVRKFLGPVPVYPAVGNHESTPVNSFPPPFIEGNHSSRW  342
                +T+   + A T  +   ++++    + V+P    + S P  +      +   + + 
Sbjct  204  VNKGETKSRYIAASTAKSSNEILKETDTDIQVFP----NYSIPQKTDSYFNPKMKLNRQI  259

Query  343  LYEAMAKAWEPWLPAEALRTL  363
            ++  +A   +   P E L   
Sbjct  260  IFCTLAALAKERKPLECLDAF  280


>sp|Q08I43|ERI1_SCHPO 3'-5' exonuclease eri1 OS=Schizosaccharomyces 
pombe (strain 972 / ATCC 24843) OX=284812 GN=eri1 PE=1 
SV=1
Length=313

 Score = 37.0 bits (84),  Expect = 0.50, Method: Composition-based stats.
 Identities = 24/158 (15%), Positives = 55/158 (35%), Gaps = 22/158 (14%)

Query  439  WNYYRIVARYENTLAAQFFGHTHVDEFEVFYDEETLSRPLAVAFLAPSATTYIGLNPGYR  498
               +  + ++ N L         VDE E+    +++ R     +       +   +   +
Sbjct  160  EELFIFLRKHSNILVPS------VDEIEIIEPLKSVPRTQPKNWAWACDGPWDMASFLAK  213

Query  499  VYQID--GNYSGSSHVVLDHETYILNLTQ---ANIPGAIPHWQLLYRARETYGLPNTLPT  553
             ++ D            +D  ++  ++ +    NI G + HW L +   E  G+ +    
Sbjct  214  QFKYDKMPIPDWIKGPFVDIRSFYKDVYRVPRTNINGMLEHWGLQFEGSEHRGIDDA--R  271

Query  554  AWHNLVYRMRGDMQLF--QTFWFLY-------HKGHPP  582
                +V +M  +   F    +W  Y       ++ +PP
Sbjct  272  NLSRIVKKMCSENVEFECNRWWMEYEKNGWIPNRSYPP  309


>sp|P50405|PSPB_MOUSE Pulmonary surfactant-associated protein 
B OS=Mus musculus OX=10090 GN=Sftpb PE=1 SV=1
Length=377

 Score = 37.0 bits (84),  Expect = 0.56, Method: Composition-based stats.
 Identities = 26/139 (19%), Positives = 57/139 (41%), Gaps = 8/139 (6%)

Query  69   HPARLHRIVPRLRDVFGWG--NLTCPICKGLFTAINLGLKKEPNVARVGSVAIKLCNLLK  126
            H  +   +   L++V+G    N  C  C+ +   +    K++     +     + C++L 
Sbjct  44   HAVQCRALGHCLQEVWGHAGANDLCQECEDIVHLLTKMTKEDAFQEAIRKFLEQECDILP  103

Query  127  IAPP-AVCQSIVHLFEDDMVEVWRRSVLSPSEACGLLLGSTCGHWDIFSSWNISLP-TVP  184
            +      C+ ++ ++   +++ + +S ++P   C  +    C         N  +P  VP
Sbjct  104  LKLLVPRCRQVLDVYLPLVIDYF-QSQINPKAICNHV--GLCPRGQAKPEQNPGMPDAVP  160

Query  185  KPPP-KPPSPPAPGAPVSR  202
             P   K   P  PGA ++R
Sbjct  161  NPLLDKLVLPVLPGALLAR  179


>sp|Q8H129|PPA3_ARATH Purple acid phosphatase 3 OS=Arabidopsis 
thaliana OX=3702 GN=PAP3 PE=2 SV=1
Length=366

 Score = 36.6 bits (83),  Expect = 0.56, Method: Composition-based stats.
 Identities = 15/80 (19%), Positives = 22/80 (28%), Gaps = 4/80 (5%)

Query  244  GYWGEYSKCDLPLRTLESLLSGLGPAGPFDMVYWTGDIPAHDVWHQTRQDQLRALTTVTA  303
            G WG           +   +  +G     D V  TGD    +          +   T   
Sbjct  80   GDWGRRGS--YNQSQVALQMGEIGEKLDIDFVISTGDNFYDNGLTSLHDPLFQDSFTNIY  137

Query  304  LVRKFLGPVPVYPAVGNHES  323
                     P Y  +GNH+ 
Sbjct  138  TAPSLQK--PWYSVLGNHDY  155


>sp|Q7T291|ADPRM_DANRE Manganese-dependent ADP-ribose/CDP-alcohol 
diphosphatase OS=Danio rerio OX=7955 GN=adprm PE=1 SV=1
Length=322

 Score = 35.9 bits (81),  Expect = 1.1, Method: Composition-based stats.
 Identities = 17/65 (26%), Positives = 30/65 (46%), Gaps = 7/65 (11%)

Query  403  GQLQWLVGELQAAEDRGDKVHIIGHIPPGHCLKS---WSWNY---YRIVARYENTLAAQF  456
             QLQWL   L  ++ + ++V I  H+P   C       +WN+     ++  +++ L    
Sbjct  204  QQLQWLDAVLTLSDHKQERVLIFSHLPVHPCAADPICLAWNHEAVLSVLRSHQSVLCF-I  262

Query  457  FGHTH  461
             GH H
Sbjct  263  AGHDH  267


>sp|E7QJD3|YIM1_YEASZ Protein YIM1 OS=Saccharomyces cerevisiae 
(strain Zymaflore VL3) OX=764100 GN=YIM1 PE=3 SV=1
Length=365

 Score = 35.9 bits (81),  Expect = 1.2, Method: Composition-based stats.
 Identities = 15/97 (15%), Positives = 33/97 (34%), Gaps = 9/97 (9%)

Query  288  HQTRQDQLRALTTVTALVRKFLGPVPVYPAVGNHESTPV-NSFPPPFIEGNHSSRWLYEA  346
                   +  +  +  +V +      ++ +VGNH+  PV + F  P  + +         
Sbjct  218  PYDEGSIVENVKKLKQIVLENDKFDMIFDSVGNHDFFPVIDQFLKPKAKNSFYVTIAGNN  277

Query  347  MAKA----WEPWLP----AEALRTLRIGGFYALSPYP  375
             A      W  ++      +A+   +   +    PYP
Sbjct  278  KANYKNISWRDFVSLSSILKAINPFKKYNWRFGHPYP  314


>sp|E7LYS5|YIM1_YEASV Protein YIM1 OS=Saccharomyces cerevisiae 
(strain VIN 13) OX=764099 GN=YIM1 PE=3 SV=1
Length=365

 Score = 35.9 bits (81),  Expect = 1.2, Method: Composition-based stats.
 Identities = 15/97 (15%), Positives = 33/97 (34%), Gaps = 9/97 (9%)

Query  288  HQTRQDQLRALTTVTALVRKFLGPVPVYPAVGNHESTPV-NSFPPPFIEGNHSSRWLYEA  346
                   +  +  +  +V +      ++ +VGNH+  PV + F  P  + +         
Sbjct  218  PYDEGSIVENVKKLKQIVLENDKFDMIFDSVGNHDFFPVIDQFLKPKAKNSFYVTIAGNN  277

Query  347  MAKA----WEPWLP----AEALRTLRIGGFYALSPYP  375
             A      W  ++      +A+   +   +    PYP
Sbjct  278  KANYKNISWRDFVSLSSILKAINPFKKYNWRFGHPYP  314


>sp|E7KGT3|YIM1_YEASA Protein YIM1 OS=Saccharomyces cerevisiae 
(strain AWRI796) OX=764097 GN=YIM1 PE=3 SV=1
Length=365

 Score = 35.9 bits (81),  Expect = 1.2, Method: Composition-based stats.
 Identities = 15/97 (15%), Positives = 33/97 (34%), Gaps = 9/97 (9%)

Query  288  HQTRQDQLRALTTVTALVRKFLGPVPVYPAVGNHESTPV-NSFPPPFIEGNHSSRWLYEA  346
                   +  +  +  +V +      ++ +VGNH+  PV + F  P  + +         
Sbjct  218  PYDEGSIVENVKKLKQIVLENDKFDMIFDSVGNHDFFPVIDQFLKPKAKNSFYVTIAGNN  277

Query  347  MAKA----WEPWLP----AEALRTLRIGGFYALSPYP  375
             A      W  ++      +A+   +   +    PYP
Sbjct  278  KANYKNISWRDFVSLSSILKAINPFKKYNWRFGHPYP  314


>sp|C8ZF09|YIM1_YEAS8 Protein YIM1 OS=Saccharomyces cerevisiae 
(strain Lalvin EC1118 / Prise de mousse) OX=643680 GN=YIM1 
PE=3 SV=1
Length=365

 Score = 35.9 bits (81),  Expect = 1.2, Method: Composition-based stats.
 Identities = 15/97 (15%), Positives = 33/97 (34%), Gaps = 9/97 (9%)

Query  288  HQTRQDQLRALTTVTALVRKFLGPVPVYPAVGNHESTPV-NSFPPPFIEGNHSSRWLYEA  346
                   +  +  +  +V +      ++ +VGNH+  PV + F  P  + +         
Sbjct  218  PYDEGSIVENVKKLKQIVLENDKFDMIFDSVGNHDFFPVIDQFLKPKAKNSFYVTIAGNN  277

Query  347  MAKA----WEPWLP----AEALRTLRIGGFYALSPYP  375
             A      W  ++      +A+   +   +    PYP
Sbjct  278  KANYKNISWRDFVSLSSILKAINPFKKYNWRFGHPYP  314


>sp|B5VPS4|YIM1_YEAS6 Protein YIM1 OS=Saccharomyces cerevisiae 
(strain AWRI1631) OX=545124 GN=YIM1 PE=3 SV=1
Length=365

 Score = 35.9 bits (81),  Expect = 1.2, Method: Composition-based stats.
 Identities = 15/97 (15%), Positives = 33/97 (34%), Gaps = 9/97 (9%)

Query  288  HQTRQDQLRALTTVTALVRKFLGPVPVYPAVGNHESTPV-NSFPPPFIEGNHSSRWLYEA  346
                   +  +  +  +V +      ++ +VGNH+  PV + F  P  + +         
Sbjct  218  PYDEGSIVENVKKLKQIVLENDKFDMIFDSVGNHDFFPVIDQFLKPKAKNSFYVTIAGNN  277

Query  347  MAKA----WEPWLP----AEALRTLRIGGFYALSPYP  375
             A      W  ++      +A+   +   +    PYP
Sbjct  278  KANYKNISWRDFVSLSSILKAINPFKKYNWRFGHPYP  314


>sp|C7GQ91|YIM1_YEAS2 Protein YIM1 OS=Saccharomyces cerevisiae 
(strain JAY291) OX=574961 GN=YIM1 PE=3 SV=1
Length=365

 Score = 35.9 bits (81),  Expect = 1.2, Method: Composition-based stats.
 Identities = 15/97 (15%), Positives = 33/97 (34%), Gaps = 9/97 (9%)

Query  288  HQTRQDQLRALTTVTALVRKFLGPVPVYPAVGNHESTPV-NSFPPPFIEGNHSSRWLYEA  346
                   +  +  +  +V +      ++ +VGNH+  PV + F  P  + +         
Sbjct  218  PYDEGSIVENVKKLKQIVLENDKFDMIFDSVGNHDFFPVIDQFLKPKAKNSFYVTIAGNN  277

Query  347  MAKA----WEPWLP----AEALRTLRIGGFYALSPYP  375
             A      W  ++      +A+   +   +    PYP
Sbjct  278  KANYKNISWRDFVSLSSILKAINPFKKYNWRFGHPYP  314


>sp|B3LM39|YIM1_YEAS1 Protein YIM1 OS=Saccharomyces cerevisiae 
(strain RM11-1a) OX=285006 GN=YIM1 PE=3 SV=1
Length=365

 Score = 35.9 bits (81),  Expect = 1.2, Method: Composition-based stats.
 Identities = 15/97 (15%), Positives = 33/97 (34%), Gaps = 9/97 (9%)

Query  288  HQTRQDQLRALTTVTALVRKFLGPVPVYPAVGNHESTPV-NSFPPPFIEGNHSSRWLYEA  346
                   +  +  +  +V +      ++ +VGNH+  PV + F  P  + +         
Sbjct  218  PYDEGSIVENVKKLKQIVLENDKFDMIFDSVGNHDFFPVIDQFLKPKAKNSFYVTIAGNN  277

Query  347  MAKA----WEPWLP----AEALRTLRIGGFYALSPYP  375
             A      W  ++      +A+   +   +    PYP
Sbjct  278  KANYKNISWRDFVSLSSILKAINPFKKYNWRFGHPYP  314


>sp|Q9SCX8|PPA17_ARATH Purple acid phosphatase 17 OS=Arabidopsis 
thaliana OX=3702 GN=PAP17 PE=2 SV=1
Length=338

 Score = 35.5 bits (80),  Expect = 1.5, Method: Composition-based stats.
 Identities = 20/107 (19%), Positives = 33/107 (31%), Gaps = 18/107 (17%)

Query  244  GYWGEYSKCDLPLRTLESLLSGLGPAGPFDMVYWTGDI-------PAHDVWHQTRQDQLR  296
            G WG           +   +  +G     D V  TGD          HD      +    
Sbjct  52   GDWGRRGS--FNQSLVAYQMGKIGEKIDLDFVVSTGDNFYDNGLFSEHDPN---FEQSFS  106

Query  297  ALTTVTALVRKFLGPVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWL  343
             + T  +L +++      Y  +GNH+           +     SRW+
Sbjct  107  NIYTAPSLQKQW------YSVLGNHDYRGDAEAQLSSVLREIDSRWI  147


>sp|A6ZML0|YIM1_YEAS7 Protein YIM1 OS=Saccharomyces cerevisiae 
(strain YJM789) OX=307796 GN=YIM1 PE=3 SV=1
Length=365

 Score = 35.1 bits (79),  Expect = 2.0, Method: Composition-based stats.
 Identities = 25/145 (17%), Positives = 49/145 (34%), Gaps = 12/145 (8%)

Query  290  TRQDQLRALTTVTALVRKFLGPVP---VYPAVGNHESTPV-NSFPPPFIEGNHSSRWLYE  345
               D+   +  V  L +  L       ++ +VGNH+  PV + F  P  + +        
Sbjct  217  VPYDEGSIVENVKKLKQSVLENDKFDMIFDSVGNHDFFPVIDQFLKPKAKNSFYVTIAGN  276

Query  346  AMAKA----WEPWLP----AEALRTLRIGGFYALSPYPGLRLISLNMNFCSRENFWLLIN  397
              A      W  ++      +A+   +   +    PYP    I +      +  +   I+
Sbjct  277  NKADYKNISWRDFVSLSSILKAINPFKKYNWRFGHPYPPNNFIEVGNEMIKKGTYKPPID  336

Query  398  STDPAGQLQWLVGELQAAEDRGDKV  422
            S     Q +  +  L +   +G  V
Sbjct  337  SVYEFDQYKEAIDRLISNRAKGKVV  361


>sp|P28625|YIM1_YEAST Protein YIM1 OS=Saccharomyces cerevisiae 
(strain ATCC 204508 / S288c) OX=559292 GN=YIM1 PE=1 SV=2
Length=365

 Score = 35.1 bits (79),  Expect = 2.0, Method: Composition-based stats.
 Identities = 18/98 (18%), Positives = 34/98 (35%), Gaps = 12/98 (12%)

Query  290  TRQDQLRALTTVTALVRKFLGPVP---VYPAVGNHESTPV-NSFPPPFIEGNHSSRWLYE  345
               D+   +  V  L +  L       ++ +VGNH+  PV + F  P  + +        
Sbjct  217  VPYDEGSIVENVKKLKQSVLENDKFDMIFDSVGNHDFFPVIDQFLKPKAKNSFYVTIAGN  276

Query  346  AMAKA----WEPWLP----AEALRTLRIGGFYALSPYP  375
              A      W  ++      +A+   +   +    PYP
Sbjct  277  NKADYKNISWRDFVSLSSILKAINPFKKYNWRFGHPYP  314


>sp|E7NLM5|YIM1_YEASO Protein YIM1 OS=Saccharomyces cerevisiae 
(strain FostersO) OX=764101 GN=YIM1 PE=3 SV=1
Length=365

 Score = 34.0 bits (76),  Expect = 4.7, Method: Composition-based stats.
 Identities = 15/97 (15%), Positives = 32/97 (33%), Gaps = 9/97 (9%)

Query  288  HQTRQDQLRALTTVTALVRKFLGPVPVYPAVGNHESTPV-NSFPPPFIEGNHSSRWLYEA  346
                   +  +  +  +V +      +  +VGNH+  PV + F  P  + +         
Sbjct  218  PYDEGSIVENVKKLKQIVLENDKFDMIXDSVGNHDFFPVIDQFLKPKAKNSFYVTIAGNN  277

Query  347  MAKA----WEPWLP----AEALRTLRIGGFYALSPYP  375
             A      W  ++      +A+   +   +    PYP
Sbjct  278  KANYKNISWRDFVSLSSILKAINPFKKYNWRFGHPYP  314


>sp|A5WBU9|CNPD3_PSYWF Probable cyclic nucleotide phosphodiesterase 
PsycPRwf_0181 OS=Psychrobacter sp. (strain PRwf-1) OX=349106 
GN=PsycPRwf_0181 PE=3 SV=1
Length=340

 Score = 34.0 bits (76),  Expect = 4.8, Method: Composition-based stats.
 Identities = 34/185 (18%), Positives = 52/185 (28%), Gaps = 34/185 (18%)

Query  188  PKPPSPPAPGAPVSRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWG  247
              PP+  +       IL LTDLH    +         D         +    +  +   G
Sbjct  27   YHPPTEISTDDGTVNILQLTDLHL--YFDTPKATHEQDINKDSAHQTITGICQNNSAKRG  84

Query  248  EYSKCDL----------PLRTLESLL-SGLGPAGPFDMVYWTGDIPAHDVWHQTRQDQLR  296
                 D              + E+ L   L      D++  TGD+ + ++  Q  Q   +
Sbjct  85   NPHSADAINHSVTPVIHNYASFEACLTQALSEDVRCDLIVVTGDLVS-EIHPQLYQHLYQ  143

Query  297  ALTTVTALVRKFLGPVPVYPAVGNHES---------TPVNSFPPPFIEGNHSSRWLYEAM  347
             L             +P     GNH+              SF P   +    SR  Y   
Sbjct  144  RLHQ---------SGIPFACIAGNHDVTDEIGKDLPFEQRSFEPHEPDSRLLSR--YSMK  192

Query  348  AKAWE  352
               WE
Sbjct  193  LNGWE  197


>sp|Q05904|SM34_LYTPI 34 kDa spicule matrix protein OS=Lytechinus 
pictus OX=7653 PE=2 SV=1
Length=335

 Score = 33.2 bits (74),  Expect = 7.9, Method: Composition-based stats.
 Identities = 20/90 (22%), Positives = 31/90 (34%), Gaps = 2/90 (2%)

Query  154  SPSEACGLLLGSTCGHWDIFSSWNISLPTVPKP--PPKPPSPPAPGAPVSRILFLTDLHW  211
            +P+   G       G +  + SW   +PT   P  P  P +PP   APV +   +T    
Sbjct  111  TPAYPNGFAGFHQSGSYTSWPSWRPGMPTSGWPVNPANPWTPPPGRAPVMKGQHVTPQQP  170

Query  212  DHDYLEGTDPDCADPLCCRRGSGLPPASRP  241
                  G + D  +    R       A + 
Sbjct  171  GQRPNLGPEWDLVEATAMRAFVCEVAAGQN  200



Lambda      K        H        a         alpha
   0.318    0.128    0.377    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0393    0.140     1.90     42.6     43.6 

Effective search space used: 68870589996


  Database: uniprot_sprot.fasta
    Posted date:  Apr 3, 2024  12:05 PM
  Number of letters in database: 206,678,396
  Number of sequences in database:  571,282



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40