Contact Molecules for Homologous Proteins

[Summary Bars]
[SiteTable]


Full Bars[100 %]


[Back to Search Page]
[Back to HOMCOS]

[SupCon3D]
[help] 		seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
25506 419 171 P0DTC9(NCAP_SARS2) RecName: Full=Nucleoprotein ; Short=N;AltName: Full=Nucleocapsid protein ; Short=NC ; Short=Protein N ;
QUERYSEQ 
MSDNGPQNQRNAPRITFGGPSDSTGSNQNGERSGARSKQRRPQGLPNNTASWFTALTQHGKEDLKFPRGQGVPINTNSSPDDQIGYYRRATRRIRGGDGKMKDLSPRWYFYYLGTGPEAGLPYGANKDGIIWVATEGALNTPKDHIGTRN
PANNAAIVLQLPQGTTLPKGFYAEGSRGGSQASSRSSSRSRNSSRNSTPGSSRGTSPARMAGNGGDAALALLLLDRLNQLESKMSGKGQQQQGQTVTKKSAAEASKKPRQKRTATKAYNVTQAFGRRGPEQTQGNFGDQELIRQGTDYKH
WPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYTGAIKLDDKDPNFKDQVILLNKHIDAYKTFPPTEPKKDKKKKADETQALPQRQKKQQTVTLLPAADLDDFSKQLQQSMSSADSTQA
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [P0DTC9(NCAP_SARS2)]

419
region name description
1-419 CHAIN /note="Nucleoprotein" /id="PRO_0000449656"
48-174 DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136"
247-364 DOMAIN /note="CoV N CTD"
1-51 REGION /note="Disordered"
41-186 REGION /note="RNA-binding"
63-83 REGION /note="Disordered"
168-212 REGION /note="Disordered"
176-206 REGION /note="SR region"
233-266 REGION /note="Disordered"
258-361 REGION /note="Dimerization"
260-340 REGION /note="Putative NLRP3 binding"
361-391 REGION /note="Disordered"
400-419 REGION /note="Tetramerization"
1-33 COMPBIAS /note="Polar residues"
177-208 COMPBIAS /note="Polar residues"
233-251 COMPBIAS /note="Polar residues"
362-382 COMPBIAS /note="Basic and acidic residues"
92-92 BINDING /ligand="RNA" /ligand_id="ChEBI:CHEBI:33697" ECO:0007744|PDB:7ACS, ECO:0007744|PDB:7ACT"
107-107 BINDING /ligand="RNA" /ligand_id="ChEBI:CHEBI:33697" ECO:0007744|PDB:7ACS, ECO:0007744|PDB:7ACT"
149-149 BINDING /ligand="RNA" /ligand_id="ChEBI:CHEBI:33697" ECO:0007744|PDB:7ACS, ECO:0007744|PDB:7ACT"
1-419 DISORDER predicted by DISOPRED

MONOMER
419
pdb_id a1 identity[%]2 description
8fg2 B 100.0 NCAP_SARS2 Nucleoprotein
8fg2 A 100.0 NCAP_SARS2 Nucleoprotein
8fd5 A 100.0 NCAP_SARS2 Nucleoprotein
7act A 100.0 NCAP_SARS2 Nucleoprotein
7sd4 A 100.0 NCAP_SARS2 Nucleoprotein
8x1h B 100.0 NCAP_SARS2 Nucleoprotein
7vnu A 100.0 NCAP_SARS2 Nucleoprotein
7vnu B 100.0 NCAP_SARS2 Nucleoprotein
8x1h A 100.0 NCAP_SARS2 Nucleoprotein
7cdz A 100.0 NCAP_SARS2 Nucleoprotein
8iv3 B 100.0 NCAP_SARS2 Nucleoprotein
8iqj B 100.0 NCAP_SARS2 Nucleoprotein
8j6x B 100.0 NCAP_SARS2 Nucleoprotein
8iv3 C 100.0 NCAP_SARS2 Nucleoprotein
8iqj C 100.0 NCAP_SARS2 Nucleoprotein
7n3c C 100.0 NCAP_SARS2 Nucleoprotein
7vnu C 100.0 NCAP_SARS2 Nucleoprotein
8x1h C 100.0 NCAP_SARS2 Nucleoprotein
7uw3 A 100.0 NCAP_SARS2 Nucleoprotein
7cdz D 100.0 NCAP_SARS2 Nucleoprotein
7cdz B 100.0 NCAP_SARS2 Nucleoprotein
8j6x D 100.0 NCAP_SARS2 Nucleoprotein
8iqj D 100.0 NCAP_SARS2 Nucleoprotein
8j6x C 100.0 NCAP_SARS2 Nucleoprotein
7str C 100.0 NCAP_SARS2 Nucleoprotein
7n0r A 100.0 NCAP_SARS2 Nucleoprotein
7n0r B 100.0 NCAP_SARS2 Nucleoprotein
7uw3 C 100.0 NCAP_SARS2 Nucleoprotein
7cdz C 100.0 NCAP_SARS2 Nucleoprotein
6m3m C 100.0 NCAP_SARS2 Nucleoprotein
6m3m B 100.0 NCAP_SARS2 Nucleoprotein
6m3m D 100.0 NCAP_SARS2 Nucleoprotein
8j6x A 100.0 NCAP_SARS2 Nucleoprotein
8iv3 A 100.0 NCAP_SARS2 Nucleoprotein
8iqj A 100.0 NCAP_SARS2 Nucleoprotein
8iv3 D 100.0 NCAP_SARS2 Nucleoprotein
7xx1 B 100.0 NCAP_SARS2 Nucleoprotein
7xx1 A 100.0 NCAP_SARS2 Nucleoprotein
7xx1 C 100.0 NCAP_SARS2 Nucleoprotein
7cr5 A 100.0 NCAP_SARS2 Nucleoprotein
6vyo D 100.0 NCAP_SARS2 Nucleoprotein
6vyo B 100.0 NCAP_SARS2 Nucleoprotein
6vyo C 100.0 NCAP_SARS2 Nucleoprotein
7sts D 100.0 NCAP_SARS2 Nucleoprotein
7wzo A 100.0 NCAP_SARS2 Nucleoprotein
6vyo A 100.0 NCAP_SARS2 Nucleoprotein
7vnu D 100.0 NCAP_SARS2 Nucleoprotein
7vbd A 100.0 NCAP_SARS2 Nucleoprotein
7uw3 B 100.0 NCAP_SARS2 Nucleoprotein
8x1h D 100.0 NCAP_SARS2 Nucleoprotein
7xwz B 100.0 NCAP_SARS2 Nucleoprotein
6m3m A 100.0 NCAP_SARS2 Nucleoprotein
6wkp C 100.0 NCAP_SARS2 Nucleoprotein
6yun B 100.0 NCAP_SARS2 Nucleoprotein
7o35 B 100.0 NCAP_SARS2 Nucleoprotein
6zco A 100.0 NCAP_SARS2 Nucleoprotein
6wkp B 100.0 NCAP_SARS2 Nucleoprotein
6yun A 100.0 NCAP_SARS2 Nucleoprotein
6wzq C 100.0 NCAP_SARS2 Nucleoprotein
7de1 B 100.0 NCAP_SARS2 Nucleoprotein
6wzq D 100.0 NCAP_SARS2 Nucleoprotein
7ylb B 100.0 NCAP_SARS2 Nucleoprotein
7sue L 100.0 NCAP_SARS2 Nucleoprotein
7sue F 100.0 NCAP_SARS2 Nucleoprotein
7sue E 100.0 NCAP_SARS2 Nucleoprotein
6wkp D 100.0 NCAP_SARS2 Nucleoprotein
6wzq A 100.0 NCAP_SARS2 Nucleoprotein
6wzq B 100.0 NCAP_SARS2 Nucleoprotein
7c22 B 100.0 NCAP_SARS2 Nucleoprotein
7ylb H 100.0 NCAP_SARS2 Nucleoprotein
7o36 C 100.0 NCAP_SARS2 Nucleoprotein
7r98 C 100.0 NCAP_SARS2 Nucleoprotein
7sue K 100.0 NCAP_SARS2 Nucleoprotein
7c22 C 100.0 NCAP_SARS2 Nucleoprotein
7r98 A 100.0 NCAP_SARS2 Nucleoprotein
7xx1 D 100.0 NCAP_SARS2 Nucleoprotein
7o36 A 100.0 NCAP_SARS2 Nucleoprotein
7vbd C 100.0 NCAP_SARS2 Nucleoprotein
6wzo B 100.0 NCAP_SARS2 Nucleoprotein
7ylb E 100.0 NCAP_SARS2 Nucleoprotein
7o05 D 100.0 NCAP_SARS2 Nucleoprotein
7o05 C 100.0 NCAP_SARS2 Nucleoprotein
7o35 C 100.0 NCAP_SARS2 Nucleoprotein
7o35 A 100.0 NCAP_SARS2 Nucleoprotein
7o36 D 100.0 NCAP_SARS2 Nucleoprotein
7vbf A 100.0 NCAP_SARS2 Nucleoprotein
7xwz A 100.0 NCAP_SARS2 Nucleoprotein
7vbd D 100.0 NCAP_SARS2 Nucleoprotein
7uxx F 100.0 NCAP_SARS2 Nucleoprotein
7vbf B 100.0 NCAP_SARS2 Nucleoprotein
7ce0 A 100.0 NCAP_SARS2 Nucleoprotein
7ce0 D 100.0 NCAP_SARS2 Nucleoprotein
7ce0 B 100.0 NCAP_SARS2 Nucleoprotein
7ce0 C 100.0 NCAP_SARS2 Nucleoprotein
6wzo D 100.0 NCAP_SARS2 Nucleoprotein
7ylb K 100.0 NCAP_SARS2 Nucleoprotein
7ylb D 100.0 NCAP_SARS2 Nucleoprotein
7ylb J 100.0 NCAP_SARS2 Nucleoprotein
7uxx A 100.0 NCAP_SARS2 Nucleoprotein
7uxx D 100.0 NCAP_SARS2 Nucleoprotein
7uxz D 100.0 NCAP_SARS2 Nucleoprotein
7uxz A 100.0 NCAP_SARS2 Nucleoprotein
7uxx E 100.0 NCAP_SARS2 Nucleoprotein
7uxx C 100.0 NCAP_SARS2 Nucleoprotein
7uxx B 100.0 NCAP_SARS2 Nucleoprotein
7uxz F 100.0 NCAP_SARS2 Nucleoprotein
7uxz E 100.0 NCAP_SARS2 Nucleoprotein
7uxz C 100.0 NCAP_SARS2 Nucleoprotein
7uxz B 100.0 NCAP_SARS2 Nucleoprotein
7c22 A 100.0 NCAP_SARS2 Nucleoprotein
7xxk E 100.0 NCAP_SARS2 Nucleoprotein
7xxk D 100.0 NCAP_SARS2 Nucleoprotein
7xxk A 100.0 NCAP_SARS2 Nucleoprotein
7sts C 100.0 NCAP_SARS2 Nucleoprotein
7ylb G 100.0 NCAP_SARS2 Nucleoprotein
7o05 A 100.0 NCAP_SARS2 Nucleoprotein
7o36 B 100.0 NCAP_SARS2 Nucleoprotein
7o35 D 100.0 NCAP_SARS2 Nucleoprotein
7o05 B 100.0 NCAP_SARS2 Nucleoprotein
7vbe A 100.0 NCAP_SARS2 Nucleoprotein
7de1 A 100.0 NCAP_SARS2 Nucleoprotein
7c22 D 100.0 NCAP_SARS2 Nucleoprotein
6wji A 100.0 NCAP_SARS2 Nucleoprotein
6wzo C 100.0 NCAP_SARS2 Nucleoprotein
6wzo A 100.0 NCAP_SARS2 Nucleoprotein
6wji F 100.0 NCAP_SARS2 Nucleoprotein
6wji E 100.0 NCAP_SARS2 Nucleoprotein
6wji D 100.0 NCAP_SARS2 Nucleoprotein
6wji C 100.0 NCAP_SARS2 Nucleoprotein
6wji B 100.0 NCAP_SARS2 Nucleoprotein
7r98 B 100.0 NCAP_SARS2 Nucleoprotein
7ylb A 100.0 NCAP_SARS2 Nucleoprotein
7n3d C 100.0 NCAP_SARS2 Nucleoprotein
7vbd B 100.0 NCAP_SARS2 Nucleoprotein
7xxk B 100.0 NCAP_SARS2 Nucleoprotein
7vbe B 100.0 NCAP_SARS2 Nucleoprotein
7uw3 D 100.0 NCAP_SARS2 Nucleoprotein
7xxk C 100.0 NCAP_SARS2 Nucleoprotein
7xxk F 100.0 NCAP_SARS2 Nucleoprotein
7f2e G 100.0 NCAP_SARS2 Nucleoprotein
7f2e D 100.0 NCAP_SARS2 Nucleoprotein
7f2e C 100.0 NCAP_SARS2 Nucleoprotein
7f2e I 100.0 NCAP_SARS2 Nucleoprotein
7f2b B 100.0 NCAP_SARS2 Nucleoprotein
7f2b A 100.0 NCAP_SARS2 Nucleoprotein
7f2e A 100.0 NCAP_SARS2 Nucleoprotein
7f2e J 100.0 NCAP_SARS2 Nucleoprotein
7f2e H 100.0 NCAP_SARS2 Nucleoprotein
7f2e B 100.0 NCAP_SARS2 Nucleoprotein
7xwx A 100.0 NCAP_SARS2 Nucleoprotein
6wkp A 100.0 NCAP_SARS2 Nucleoprotein
7xwx B 100.0 NCAP_SARS2 Nucleoprotein
7xwx G 100.0 NCAP_SARS2 Nucleoprotein
7xwx C 100.0 NCAP_SARS2 Nucleoprotein
7n0i A 100.0 NCAP_SARS2 Nucleoprotein
7n0i B 100.0 NCAP_SARS2 Nucleoprotein
7n0i L 100.0 NCAP_SARS2 Nucleoprotein
7n0i G 100.0 NCAP_SARS2 Nucleoprotein
7n0i F 100.0 NCAP_SARS2 Nucleoprotein
7n0i E 100.0 NCAP_SARS2 Nucleoprotein
7n0i D 100.0 NCAP_SARS2 Nucleoprotein
7n0i C 100.0 NCAP_SARS2 Nucleoprotein
7xwx F 100.0 NCAP_SARS2 Nucleoprotein
7xwx D 100.0 NCAP_SARS2 Nucleoprotein
7f2e E 100.0 NCAP_SARS2 Nucleoprotein
7f2e K 100.0 NCAP_SARS2 Nucleoprotein
7f2e F 100.0 NCAP_SARS2 Nucleoprotein
7xwx E 100.0 NCAP_SARS2 Nucleoprotein
7xwx H 100.0 NCAP_SARS2 Nucleoprotein
7f2e L 100.0 NCAP_SARS2 Nucleoprotein
7pku B 100.0 A0A6G9KDV1_SARS2 Nucleoprotein 
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HETERO
419 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
7cr5 B monoclonal antibody chain H[216 aa] A 100.0
/100.0		 7
/7		 NCAP_SARS2 Nucleoprotein
7cr5 C monoclonal antibody chain L[213 aa] A 100.0
/100.0		 15
/15		 NCAP_SARS2 Nucleoprotein
7n0i H Single-domain antibody E2[136 aa] A 100.0
/100.0		 10
/10		 NCAP_SARS2 Nucleoprotein
7n0i H Single-domain antibody E2[136 aa] B 100.0
/100.0		 5
/5		 NCAP_SARS2 Nucleoprotein
7n0i I Single-domain antibody E2[135 aa] C 100.0
/100.0		 10
/10		 NCAP_SARS2 Nucleoprotein
7n0i I Single-domain antibody E2[135 aa] D 100.0
/100.0		 5
/5		 NCAP_SARS2 Nucleoprotein
7n0i J Single-domain antibody E2[130 aa] E 100.0
/100.0		 10
/10		 NCAP_SARS2 Nucleoprotein
7n0i J Single-domain antibody E2[130 aa] F 100.0
/100.0		 4
/4		 NCAP_SARS2 Nucleoprotein
7n0i K Single-domain antibody E2[131 aa] G 100.0
/100.0		 5
/5		 NCAP_SARS2 Nucleoprotein
7n0i K Single-domain antibody E2[131 aa] L 100.0
/100.0		 12
/12		 NCAP_SARS2 Nucleoprotein
7n0r C Single-domain antibody C2[123 aa] A 100.0
/100.0		 17
/17		 NCAP_SARS2 Nucleoprotein
7n0r D Single-domain antibody C2[123 aa] B 100.0
/100.0		 18
/18		 NCAP_SARS2 Nucleoprotein
7n3c A S24-202 Fab heavy chain[226 aa] C 100.0
/100.0		 11
/11		 NCAP_SARS2 Nucleoprotein
7n3c B S24-202 Fab light chain[214 aa] C 100.0
/100.0		 5
/5		 NCAP_SARS2 Nucleoprotein
7str A Fab S24-1063, Light chain[214 aa] C 100.0
/100.0		 7
/7		 NCAP_SARS2 Nucleoprotein
7n3d A S24-1564 Fab heavy chain[223 aa] C 100.0
/100.0		 12
/12		 NCAP_SARS2 Nucleoprotein
7n3d B S24-1564 Fab light chain[213 aa] C 100.0
/100.0		 8
/8		 NCAP_SARS2 Nucleoprotein
7pku A A0A6M4N019_SARS2 3C-like proteinase[96 aa] B 100.0
/100.0		 18
/18		 A0A6G9KDV1_SARS2 Nucleoprotein
7wzo B R1A_SARS2 nsp3[112 aa] A 100.0
/100.0		 11
/11		 NCAP_SARS2 Nucleoprotein
7wzo C R1A_SARS2 nsp3[110 aa] A 100.0
/100.0		 10
/10		 NCAP_SARS2 Nucleoprotein
7r98 D Nanobody B6[129 aa] A 100.0
/100.0		 14
/14		 NCAP_SARS2 Nucleoprotein
7r98 E Nanobody B6[130 aa] B 100.0
/100.0		 14
/14		 NCAP_SARS2 Nucleoprotein
7r98 F Nanobody B6[130 aa] C 100.0
/100.0		 14
/14		 NCAP_SARS2 Nucleoprotein
7str B Fab S24-1063, Heavy chain[222 aa] C 100.0
/100.0		 11
/11		 NCAP_SARS2 Nucleoprotein
7sts E Fab S24-1379, heavy chain[210 aa] C 100.0
/100.0		 6
/6		 NCAP_SARS2 Nucleoprotein
7sts A Fab S24-1379, heavy chain[204 aa] D 100.0
/100.0		 5
/5		 NCAP_SARS2 Nucleoprotein
7sts F Fab S24-1379, light chain[212 aa] C 100.0
/100.0		 6
/6		 NCAP_SARS2 Nucleoprotein
7sts B Fab S24-1379, light chain[212 aa] D 100.0
/100.0		 5
/5		 NCAP_SARS2 Nucleoprotein
7sue A S24-188 Fab Light chain[212 aa] E 100.0
/100.0		 5
/5		 NCAP_SARS2 Nucleoprotein
7sue C S24-188 Fab Light chain[212 aa] F 100.0
/100.0		 4
/4		 NCAP_SARS2 Nucleoprotein
7sue B S24-188 Fab Heavy chain[227 aa] E 100.0
/100.0		 8
/8		 NCAP_SARS2 Nucleoprotein
7sue D S24-188 Fab Heavy chain[227 aa] F 100.0
/100.0		 8
/8		 NCAP_SARS2 Nucleoprotein
7sue G S24-188 Fab Light chain[109 aa] K 100.0
/100.0		 5
/5		 NCAP_SARS2 Nucleoprotein
7sue I S24-188 Fab Light chain[109 aa] L 100.0
/100.0		 5
/5		 NCAP_SARS2 Nucleoprotein
7sue H S24-188 Fab Heavy chain[129 aa] K 100.0
/100.0		 7
/7		 NCAP_SARS2 Nucleoprotein
7sue J S24-188 Fab Heavy chain[128 aa] L 100.0
/100.0		 6
/6		 NCAP_SARS2 Nucleoprotein
7ylb C NC2[84 aa] A 100.0
/100.0		 13
/13		 NCAP_SARS2 Nucleoprotein
7ylb C NC2[84 aa] B 100.0
/100.0		 8
/8		 NCAP_SARS2 Nucleoprotein
7ylb F NC2[84 aa] D 100.0
/100.0		 13
/13		 NCAP_SARS2 Nucleoprotein
7ylb F NC2[84 aa] E 100.0
/100.0		 9
/9		 NCAP_SARS2 Nucleoprotein
7ylb I NC2[84 aa] G 100.0
/100.0		 13
/13		 NCAP_SARS2 Nucleoprotein
7ylb I NC2[84 aa] H 100.0
/100.0		 9
/9		 NCAP_SARS2 Nucleoprotein
7ylb L NC2[84 aa] J 100.0
/100.0		 14
/14		 NCAP_SARS2 Nucleoprotein
7ylb L NC2[84 aa] K 100.0
/100.0		 10
/10		 NCAP_SARS2 Nucleoprotein
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
NUCLEOTIDE
419 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
7act B ssRNA A 100.0
/100.0		 28
/28		 NCAP_SARS2 Nucleoprotein
7xwz C RNA (5'-R(*CP*AP*CP*UP*GP*AP*C)-3') A 100.0
/100.0		 2
/2		 NCAP_SARS2 Nucleoprotein
7xwz D RNA (5'-R(P*GP*UP*CP*AP*GP*UP*G)-3') A 100.0
/100.0		 8
/8		 NCAP_SARS2 Nucleoprotein
7xwz F RNA (5'-R(P*GP*UP*CP*AP*GP*UP*G)-3') B 100.0
/100.0		 5
/5		 NCAP_SARS2 Nucleoprotein
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
COMPOUND
419 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
7o35 E GTP
GUANOSINE-5'-TRIPHOSPHATE[32 atoms] 		C 100.0
/100.0		 4
/4		 NCAP_SARS2 Nucleoprotein
7o35 E GTP
GUANOSINE-5'-TRIPHOSPHATE[32 atoms] 		D 100.0
/100.0		 4
/4		 NCAP_SARS2 Nucleoprotein
7o36 E GTP
GUANOSINE-5'-TRIPHOSPHATE[32 atoms] 		A 100.0
/100.0		 5
/5		 NCAP_SARS2 Nucleoprotein
7o36 E GTP
GUANOSINE-5'-TRIPHOSPHATE[32 atoms] 		B 100.0
/100.0		 4
/4		 NCAP_SARS2 Nucleoprotein
7o36 G GTP
GUANOSINE-5'-TRIPHOSPHATE[32 atoms] 		C 100.0
/100.0		 4
/4		 NCAP_SARS2 Nucleoprotein
7o36 G GTP
GUANOSINE-5'-TRIPHOSPHATE[32 atoms] 		D 100.0
/100.0		 4
/4		 NCAP_SARS2 Nucleoprotein
7uxz G GKP
(2R,3R)-2,3-bis{[(2E)-3-(3,4-dihydroxyphenyl)prop-.. 		A 100.0
/100.0		 8
/8		 NCAP_SARS2 Nucleoprotein
7xxk H 5GP
GUANOSINE-5'-MONOPHOSPHATE[24 atoms] 		A 100.0
/100.0		 3
/3		 NCAP_SARS2 Nucleoprotein
7xxk I 5GP
GUANOSINE-5'-MONOPHOSPHATE[24 atoms] 		A 100.0
/100.0		 3
/3		 NCAP_SARS2 Nucleoprotein
7xxk H 5GP
GUANOSINE-5'-MONOPHOSPHATE[24 atoms] 		B 100.0
/100.0		 2
/2		 NCAP_SARS2 Nucleoprotein
7xxk I 5GP
GUANOSINE-5'-MONOPHOSPHATE[24 atoms] 		B 100.0
/100.0		 3
/3		 NCAP_SARS2 Nucleoprotein
7xxk S 5GP
GUANOSINE-5'-MONOPHOSPHATE[24 atoms] 		C 100.0
/100.0		 4
/4		 NCAP_SARS2 Nucleoprotein
7xxk S 5GP
GUANOSINE-5'-MONOPHOSPHATE[24 atoms] 		D 100.0
/100.0		 3
/3		 NCAP_SARS2 Nucleoprotein
7xxk R GUN
GUANINE[11 atoms] 		C 100.0
/100.0		 3
/3		 NCAP_SARS2 Nucleoprotein
7xxk R GUN
GUANINE[11 atoms] 		D 100.0
/100.0		 2
/2		 NCAP_SARS2 Nucleoprotein
7xxk FA GMP
GUANOSINE[20 atoms] 		E 100.0
/100.0		 3
/3		 NCAP_SARS2 Nucleoprotein
7xxk FA GMP
GUANOSINE[20 atoms] 		F 100.0
/100.0		 3
/3		 NCAP_SARS2 Nucleoprotein
8iv3 E DJU
N,N-dimethyl-1-(5-phenylmethoxy-1H-indol-3-yl)meth.. 		A 100.0
/100.0		 3
/3		 NCAP_SARS2 Nucleoprotein
8iv3 E DJU
N,N-dimethyl-1-(5-phenylmethoxy-1H-indol-3-yl)meth.. 		B 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
8iv3 E DJU
N,N-dimethyl-1-(5-phenylmethoxy-1H-indol-3-yl)meth.. 		D 100.0
/100.0		 4
/4		 NCAP_SARS2 Nucleoprotein
8j6x E U2H
~{N}-methyl-~{N}-[(5-phenylmethoxy-1~{H}-indol-3-y.. 		A 100.0
/100.0		 2
/2		 NCAP_SARS2 Nucleoprotein
8j6x E U2H
~{N}-methyl-~{N}-[(5-phenylmethoxy-1~{H}-indol-3-y.. 		B 100.0
/100.0		 2
/2		 NCAP_SARS2 Nucleoprotein
8j6x E U2H
~{N}-methyl-~{N}-[(5-phenylmethoxy-1~{H}-indol-3-y.. 		D 100.0
/100.0		 4
/4		 NCAP_SARS2 Nucleoprotein
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
METAL
419 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6vyo F CL
CHLORIDE ION[1 atoms] 		A 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
6vyo I CL
CHLORIDE ION[1 atoms] 		A 100.0
/100.0		 3
/3		 NCAP_SARS2 Nucleoprotein
6vyo F CL
CHLORIDE ION[1 atoms] 		B 100.0
/100.0		 5
/5		 NCAP_SARS2 Nucleoprotein
6vyo N CL
CHLORIDE ION[1 atoms] 		B 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
6vyo N CL
CHLORIDE ION[1 atoms] 		C 100.0
/100.0		 3
/3		 NCAP_SARS2 Nucleoprotein
6vyo O CL
CHLORIDE ION[1 atoms] 		C 100.0
/100.0		 2
/2		 NCAP_SARS2 Nucleoprotein
6vyo I CL
CHLORIDE ION[1 atoms] 		D 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
6vyo O CL
CHLORIDE ION[1 atoms] 		D 100.0
/100.0		 5
/5		 NCAP_SARS2 Nucleoprotein
6wji G CL
CHLORIDE ION[1 atoms] 		A 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
6wji H CL
CHLORIDE ION[1 atoms] 		A 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
6wji G CL
CHLORIDE ION[1 atoms] 		B 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
6wji H CL
CHLORIDE ION[1 atoms] 		B 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
6wji I CL
CHLORIDE ION[1 atoms] 		C 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
6wji I CL
CHLORIDE ION[1 atoms] 		D 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
6wji J CL
CHLORIDE ION[1 atoms] 		D 100.0
/100.0		 2
/2		 NCAP_SARS2 Nucleoprotein
6wji K CL
CHLORIDE ION[1 atoms] 		D 100.0
/100.0		 2
/2		 NCAP_SARS2 Nucleoprotein
6wji L CL
CHLORIDE ION[1 atoms] 		E 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
6wji M CL
CHLORIDE ION[1 atoms] 		E 100.0
/100.0		 2
/2		 NCAP_SARS2 Nucleoprotein
6wji N CL
CHLORIDE ION[1 atoms] 		E 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
6wji N CL
CHLORIDE ION[1 atoms] 		F 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
6wji O CL
CHLORIDE ION[1 atoms] 		F 100.0
/100.0		 2
/2		 NCAP_SARS2 Nucleoprotein
7f2b E CL
CHLORIDE ION[1 atoms] 		B 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
7n3d O CL
CHLORIDE ION[1 atoms] 		C 100.0
/100.0		 2
/2		 NCAP_SARS2 Nucleoprotein
7n3d P CL
CHLORIDE ION[1 atoms] 		C 100.0
/100.0		 2
/2		 NCAP_SARS2 Nucleoprotein
7uxz L CL
CHLORIDE ION[1 atoms] 		E 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
7xxk O CL
CHLORIDE ION[1 atoms] 		B 100.0
/100.0		 3
/3		 NCAP_SARS2 Nucleoprotein
7xxk P CL
CHLORIDE ION[1 atoms] 		B 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
7xxk Q CL
CHLORIDE ION[1 atoms] 		B 100.0
/100.0		 3
/3		 NCAP_SARS2 Nucleoprotein
7xxk U CL
CHLORIDE ION[1 atoms] 		C 100.0
/100.0		 4
/4		 NCAP_SARS2 Nucleoprotein
7xxk V CL
CHLORIDE ION[1 atoms] 		C 100.0
/100.0		 2
/2		 NCAP_SARS2 Nucleoprotein
7xxk W CL
CHLORIDE ION[1 atoms] 		C 100.0
/100.0		 2
/2		 NCAP_SARS2 Nucleoprotein
7xxk X CL
CHLORIDE ION[1 atoms] 		C 100.0
/100.0		 2
/2		 NCAP_SARS2 Nucleoprotein
7xxk Y CL
CHLORIDE ION[1 atoms] 		C 100.0
/100.0		 2
/2		 NCAP_SARS2 Nucleoprotein
7xxk CA CL
CHLORIDE ION[1 atoms] 		D 100.0
/100.0		 3
/3		 NCAP_SARS2 Nucleoprotein
7xxk DA CL
CHLORIDE ION[1 atoms] 		E 100.0
/100.0		 3
/3		 NCAP_SARS2 Nucleoprotein
7xxk EA CL
CHLORIDE ION[1 atoms] 		E 100.0
/100.0		 3
/3		 NCAP_SARS2 Nucleoprotein
7xxk IA CL
CHLORIDE ION[1 atoms] 		E 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
7xxk HA CL
CHLORIDE ION[1 atoms] 		F 100.0
/100.0		 2
/2		 NCAP_SARS2 Nucleoprotein
7xxk IA CL
CHLORIDE ION[1 atoms] 		F 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
6vyo H ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 3
/3		 NCAP_SARS2 Nucleoprotein
6vyo J ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
6vyo J ZN
ZINC ION[1 atoms] 		B 100.0
/100.0		 3
/3		 NCAP_SARS2 Nucleoprotein
6vyo M ZN
ZINC ION[1 atoms] 		B 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
6vyo M ZN
ZINC ION[1 atoms] 		C 100.0
/100.0		 3
/3		 NCAP_SARS2 Nucleoprotein
6vyo R ZN
ZINC ION[1 atoms] 		C 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
6vyo H ZN
ZINC ION[1 atoms] 		D 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
6vyo R ZN
ZINC ION[1 atoms] 		D 100.0
/100.0		 3
/3		 NCAP_SARS2 Nucleoprotein
6wkp E ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 3
/3		 NCAP_SARS2 Nucleoprotein
6wkp G ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
6wkp G ZN
ZINC ION[1 atoms] 		B 100.0
/100.0		 3
/3		 NCAP_SARS2 Nucleoprotein
6wkp H ZN
ZINC ION[1 atoms] 		B 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
6wkp H ZN
ZINC ION[1 atoms] 		C 100.0
/100.0		 3
/3		 NCAP_SARS2 Nucleoprotein
6wkp J ZN
ZINC ION[1 atoms] 		C 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
6wkp E ZN
ZINC ION[1 atoms] 		D 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
6wkp J ZN
ZINC ION[1 atoms] 		D 100.0
/100.0		 3
/3		 NCAP_SARS2 Nucleoprotein
7cr5 D ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
7xx1 E ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 3
/3		 NCAP_SARS2 Nucleoprotein
7xx1 J ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
7xx1 E ZN
ZINC ION[1 atoms] 		B 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
7xx1 F ZN
ZINC ION[1 atoms] 		B 100.0
/100.0		 3
/3		 NCAP_SARS2 Nucleoprotein
7xx1 F ZN
ZINC ION[1 atoms] 		C 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
7xx1 I ZN
ZINC ION[1 atoms] 		C 100.0
/100.0		 3
/3		 NCAP_SARS2 Nucleoprotein
7xx1 I ZN
ZINC ION[1 atoms] 		D 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
7xx1 J ZN
ZINC ION[1 atoms] 		D 100.0
/100.0		 3
/3		 NCAP_SARS2 Nucleoprotein
7n0i N MG
MAGNESIUM ION[1 atoms] 		D 100.0
/100.0		 3
/3		 NCAP_SARS2 Nucleoprotein
7n3c T IOD
IODIDE ION[1 atoms] 		C 100.0
/100.0		 3
/3		 NCAP_SARS2 Nucleoprotein
7n3c U IOD
IODIDE ION[1 atoms] 		C 100.0
/100.0		 2
/2		 NCAP_SARS2 Nucleoprotein
7n3c V IOD
IODIDE ION[1 atoms] 		C 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
7n3c W IOD
IODIDE ION[1 atoms] 		C 100.0
/100.0		 4
/4		 NCAP_SARS2 Nucleoprotein
7n3c X IOD
IODIDE ION[1 atoms] 		C 100.0
/100.0		 2
/2		 NCAP_SARS2 Nucleoprotein
7uxz J NA
SODIUM ION[1 atoms] 		A 100.0
/100.0		 2
/2		 NCAP_SARS2 Nucleoprotein
7xxk Z NA
SODIUM ION[1 atoms] 		C 100.0
/100.0		 2
/2		 NCAP_SARS2 Nucleoprotein
7xxk JA NA
SODIUM ION[1 atoms] 		F 100.0
/100.0		 3
/3		 NCAP_SARS2 Nucleoprotein
7xxk J K
POTASSIUM ION[1 atoms] 		A 100.0
/100.0		 3
/3		 NCAP_SARS2 Nucleoprotein
7xxk K K
POTASSIUM ION[1 atoms] 		A 100.0
/100.0		 3
/3		 NCAP_SARS2 Nucleoprotein
7xxk L K
POTASSIUM ION[1 atoms] 		A 100.0
/100.0		 3
/3		 NCAP_SARS2 Nucleoprotein
7xxk M K
POTASSIUM ION[1 atoms] 		A 100.0
/100.0		 2
/2		 NCAP_SARS2 Nucleoprotein
7xxk N K
POTASSIUM ION[1 atoms] 		A 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
7xxk J K
POTASSIUM ION[1 atoms] 		B 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
7xxk N K
POTASSIUM ION[1 atoms] 		B 100.0
/100.0		 3
/3		 NCAP_SARS2 Nucleoprotein
7xxk AA K
POTASSIUM ION[1 atoms] 		C 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
7xxk T K
POTASSIUM ION[1 atoms] 		C 100.0
/100.0		 3
/3		 NCAP_SARS2 Nucleoprotein
7xxk AA K
POTASSIUM ION[1 atoms] 		D 100.0
/100.0		 3
/3		 NCAP_SARS2 Nucleoprotein
7xxk BA K
POTASSIUM ION[1 atoms] 		D 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
7xxk T K
POTASSIUM ION[1 atoms] 		D 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
7xxk GA K
POTASSIUM ION[1 atoms] 		E 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
7xxk GA K
POTASSIUM ION[1 atoms] 		F 100.0
/100.0		 3
/3		 NCAP_SARS2 Nucleoprotein
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
HOMO
419 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6vyo B NCAP_SARS2 Nucleoprotein[125 aa] A 100.0
/100.0		 12
/12		 NCAP_SARS2 Nucleoprotein
6vyo D NCAP_SARS2 Nucleoprotein[125 aa] A 100.0
/100.0		 9
/9		 NCAP_SARS2 Nucleoprotein
6vyo A NCAP_SARS2 Nucleoprotein[124 aa] B 100.0
/100.0		 12
/12		 NCAP_SARS2 Nucleoprotein
6vyo C NCAP_SARS2 Nucleoprotein[125 aa] B 100.0
/100.0		 7
/7		 NCAP_SARS2 Nucleoprotein
6vyo B NCAP_SARS2 Nucleoprotein[125 aa] C 100.0
/100.0		 8
/8		 NCAP_SARS2 Nucleoprotein
6vyo D NCAP_SARS2 Nucleoprotein[125 aa] C 100.0
/100.0		 15
/15		 NCAP_SARS2 Nucleoprotein
6vyo A NCAP_SARS2 Nucleoprotein[124 aa] D 100.0
/100.0		 8
/8		 NCAP_SARS2 Nucleoprotein
6vyo C NCAP_SARS2 Nucleoprotein[125 aa] D 100.0
/100.0		 12
/12		 NCAP_SARS2 Nucleoprotein
6wkp B NCAP_SARS2 Nucleoprotein[117 aa] A 100.0
/100.0		 8
/8		 NCAP_SARS2 Nucleoprotein
6wkp D NCAP_SARS2 Nucleoprotein[115 aa] A 100.0
/100.0		 6
/6		 NCAP_SARS2 Nucleoprotein
6wkp C NCAP_SARS2 Nucleoprotein[120 aa] B 100.0
/100.0		 5
/5		 NCAP_SARS2 Nucleoprotein
6wkp B NCAP_SARS2 Nucleoprotein[117 aa] C 100.0
/100.0		 6
/6		 NCAP_SARS2 Nucleoprotein
6wkp D NCAP_SARS2 Nucleoprotein[115 aa] C 100.0
/100.0		 14
/14		 NCAP_SARS2 Nucleoprotein
6wkp C NCAP_SARS2 Nucleoprotein[120 aa] D 100.0
/100.0		 12
/12		 NCAP_SARS2 Nucleoprotein
7xx1 B NCAP_SARS2 Nucleoprotein[125 aa] A 100.0
/100.0		 12
/12		 NCAP_SARS2 Nucleoprotein
7xx1 D NCAP_SARS2 Nucleoprotein[119 aa] A 100.0
/100.0		 8
/8		 NCAP_SARS2 Nucleoprotein
7xx1 A NCAP_SARS2 Nucleoprotein[125 aa] B 100.0
/100.0		 16
/16		 NCAP_SARS2 Nucleoprotein
7xx1 C NCAP_SARS2 Nucleoprotein[125 aa] B 100.0
/100.0		 8
/8		 NCAP_SARS2 Nucleoprotein
7xx1 B NCAP_SARS2 Nucleoprotein[125 aa] C 100.0
/100.0		 8
/8		 NCAP_SARS2 Nucleoprotein
7xx1 D NCAP_SARS2 Nucleoprotein[119 aa] C 100.0
/100.0		 12
/12		 NCAP_SARS2 Nucleoprotein
7xx1 A NCAP_SARS2 Nucleoprotein[125 aa] D 100.0
/100.0		 9
/9		 NCAP_SARS2 Nucleoprotein
7xx1 C NCAP_SARS2 Nucleoprotein[125 aa] D 100.0
/100.0		 15
/15		 NCAP_SARS2 Nucleoprotein
8iv3 B NCAP_SARS2 Nucleoprotein[128 aa] A 100.0
/100.0		 6
/6		 NCAP_SARS2 Nucleoprotein
8iv3 C NCAP_SARS2 Nucleoprotein[128 aa] A 100.0
/100.0		 10
/10		 NCAP_SARS2 Nucleoprotein
8iv3 D NCAP_SARS2 Nucleoprotein[126 aa] A 100.0
/100.0		 11
/11		 NCAP_SARS2 Nucleoprotein
8iv3 A NCAP_SARS2 Nucleoprotein[126 aa] B 100.0
/100.0		 10
/10		 NCAP_SARS2 Nucleoprotein
8iv3 C NCAP_SARS2 Nucleoprotein[128 aa] B 100.0
/100.0		 6
/6		 NCAP_SARS2 Nucleoprotein
8iv3 D NCAP_SARS2 Nucleoprotein[126 aa] B 100.0
/100.0		 4
/4		 NCAP_SARS2 Nucleoprotein
8iv3 A NCAP_SARS2 Nucleoprotein[126 aa] C 100.0
/100.0		 8
/8		 NCAP_SARS2 Nucleoprotein
8iv3 B NCAP_SARS2 Nucleoprotein[128 aa] C 100.0
/100.0		 10
/10		 NCAP_SARS2 Nucleoprotein
8iv3 A NCAP_SARS2 Nucleoprotein[126 aa] D 100.0
/100.0		 10
/10		 NCAP_SARS2 Nucleoprotein
8iv3 B NCAP_SARS2 Nucleoprotein[128 aa] D 100.0
/100.0		 5
/5		 NCAP_SARS2 Nucleoprotein
8j6x B NCAP_SARS2 Nucleoprotein[128 aa] A 100.0
/100.0		 6
/6		 NCAP_SARS2 Nucleoprotein
8j6x C NCAP_SARS2 Nucleoprotein[127 aa] A 100.0
/100.0		 10
/10		 NCAP_SARS2 Nucleoprotein
8j6x D NCAP_SARS2 Nucleoprotein[127 aa] A 100.0
/100.0		 10
/10		 NCAP_SARS2 Nucleoprotein
8j6x A NCAP_SARS2 Nucleoprotein[126 aa] B 100.0
/100.0		 10
/10		 NCAP_SARS2 Nucleoprotein
8j6x C NCAP_SARS2 Nucleoprotein[127 aa] B 100.0
/100.0		 6
/6		 NCAP_SARS2 Nucleoprotein
8j6x D NCAP_SARS2 Nucleoprotein[127 aa] B 100.0
/100.0		 3
/3		 NCAP_SARS2 Nucleoprotein
8j6x A NCAP_SARS2 Nucleoprotein[126 aa] C 100.0
/100.0		 7
/7		 NCAP_SARS2 Nucleoprotein
8j6x B NCAP_SARS2 Nucleoprotein[128 aa] C 100.0
/100.0		 8
/8		 NCAP_SARS2 Nucleoprotein
8j6x A NCAP_SARS2 Nucleoprotein[126 aa] D 100.0
/100.0		 10
/10		 NCAP_SARS2 Nucleoprotein
8j6x B NCAP_SARS2 Nucleoprotein[128 aa] D 100.0
/100.0		 5
/5		 NCAP_SARS2 Nucleoprotein
8x1h A NCAP_SARS2 Nucleoprotein[128 aa] A 100.0
/100.0		 128
/128		 NCAP_SARS2 Nucleoprotein
8x1h A NCAP_SARS2 Nucleoprotein[128 aa] A 100.0
/100.0		 128
/128		 NCAP_SARS2 Nucleoprotein
8x1h A NCAP_SARS2 Nucleoprotein[128 aa] A 100.0
/100.0		 128
/128		 NCAP_SARS2 Nucleoprotein
8x1h A NCAP_SARS2 Nucleoprotein[128 aa] A 100.0
/100.0		 128
/128		 NCAP_SARS2 Nucleoprotein
8x1h A NCAP_SARS2 Nucleoprotein[128 aa] A 100.0
/100.0		 128
/128		 NCAP_SARS2 Nucleoprotein
8x1h A NCAP_SARS2 Nucleoprotein[128 aa] A 100.0
/100.0		 128
/128		 NCAP_SARS2 Nucleoprotein
8x1h A NCAP_SARS2 Nucleoprotein[128 aa] A 100.0
/100.0		 128
/128		 NCAP_SARS2 Nucleoprotein
8x1h A NCAP_SARS2 Nucleoprotein[128 aa] A 100.0
/100.0		 128
/128		 NCAP_SARS2 Nucleoprotein
8x1h A NCAP_SARS2 Nucleoprotein[128 aa] A 100.0
/100.0		 128
/128		 NCAP_SARS2 Nucleoprotein
8x1h A NCAP_SARS2 Nucleoprotein[128 aa] A 100.0
/100.0		 128
/128		 NCAP_SARS2 Nucleoprotein
8x1h A NCAP_SARS2 Nucleoprotein[128 aa] A 100.0
/100.0		 128
/128		 NCAP_SARS2 Nucleoprotein
8x1h A NCAP_SARS2 Nucleoprotein[128 aa] A 100.0
/100.0		 128
/128		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] A 100.0
/100.0		 15
/15		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] A 100.0
/100.0		 15
/15		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] A 100.0
/100.0		 15
/15		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] A 100.0
/100.0		 15
/15		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] A 100.0
/100.0		 15
/15		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] A 100.0
/100.0		 15
/15		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] A 100.0
/100.0		 15
/15		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] A 100.0
/100.0		 15
/15		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] A 100.0
/100.0		 15
/15		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] A 100.0
/100.0		 15
/15		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] A 100.0
/100.0		 15
/15		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] A 100.0
/100.0		 15
/15		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] A 100.0
/100.0		 15
/15		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] A 100.0
/100.0		 15
/15		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] A 100.0
/100.0		 15
/15		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] A 100.0
/100.0		 15
/15		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] A 100.0
/100.0		 8
/8		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] A 100.0
/100.0		 8
/8		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] A 100.0
/100.0		 8
/8		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] A 100.0
/100.0		 8
/8		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] A 100.0
/100.0		 8
/8		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] A 100.0
/100.0		 8
/8		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] A 100.0
/100.0		 8
/8		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] A 100.0
/100.0		 8
/8		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] A 100.0
/100.0		 8
/8		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] A 100.0
/100.0		 8
/8		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] A 100.0
/100.0		 8
/8		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] A 100.0
/100.0		 8
/8		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] A 100.0
/100.0		 8
/8		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] A 100.0
/100.0		 8
/8		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] A 100.0
/100.0		 8
/8		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] A 100.0
/100.0		 8
/8		 NCAP_SARS2 Nucleoprotein
8x1h A NCAP_SARS2 Nucleoprotein[128 aa] B 100.0
/100.0		 13
/13		 NCAP_SARS2 Nucleoprotein
8x1h A NCAP_SARS2 Nucleoprotein[128 aa] B 100.0
/100.0		 13
/13		 NCAP_SARS2 Nucleoprotein
8x1h A NCAP_SARS2 Nucleoprotein[128 aa] B 100.0
/100.0		 13
/13		 NCAP_SARS2 Nucleoprotein
8x1h A NCAP_SARS2 Nucleoprotein[128 aa] B 100.0
/100.0		 13
/13		 NCAP_SARS2 Nucleoprotein
8x1h A NCAP_SARS2 Nucleoprotein[128 aa] B 100.0
/100.0		 13
/13		 NCAP_SARS2 Nucleoprotein
8x1h A NCAP_SARS2 Nucleoprotein[128 aa] B 100.0
/100.0		 13
/13		 NCAP_SARS2 Nucleoprotein
8x1h A NCAP_SARS2 Nucleoprotein[128 aa] B 100.0
/100.0		 13
/13		 NCAP_SARS2 Nucleoprotein
8x1h A NCAP_SARS2 Nucleoprotein[128 aa] B 100.0
/100.0		 13
/13		 NCAP_SARS2 Nucleoprotein
8x1h A NCAP_SARS2 Nucleoprotein[128 aa] B 100.0
/100.0		 13
/13		 NCAP_SARS2 Nucleoprotein
8x1h A NCAP_SARS2 Nucleoprotein[128 aa] B 100.0
/100.0		 13
/13		 NCAP_SARS2 Nucleoprotein
8x1h A NCAP_SARS2 Nucleoprotein[128 aa] B 100.0
/100.0		 13
/13		 NCAP_SARS2 Nucleoprotein
8x1h A NCAP_SARS2 Nucleoprotein[128 aa] B 100.0
/100.0		 13
/13		 NCAP_SARS2 Nucleoprotein
8x1h A NCAP_SARS2 Nucleoprotein[128 aa] B 100.0
/100.0		 13
/13		 NCAP_SARS2 Nucleoprotein
8x1h A NCAP_SARS2 Nucleoprotein[128 aa] B 100.0
/100.0		 13
/13		 NCAP_SARS2 Nucleoprotein
8x1h A NCAP_SARS2 Nucleoprotein[128 aa] B 100.0
/100.0		 13
/13		 NCAP_SARS2 Nucleoprotein
8x1h A NCAP_SARS2 Nucleoprotein[128 aa] B 100.0
/100.0		 13
/13		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] B 100.0
/100.0		 130
/130		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] B 100.0
/100.0		 130
/130		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] B 100.0
/100.0		 130
/130		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] B 100.0
/100.0		 130
/130		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] B 100.0
/100.0		 130
/130		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] B 100.0
/100.0		 130
/130		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] B 100.0
/100.0		 130
/130		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] B 100.0
/100.0		 130
/130		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] B 100.0
/100.0		 130
/130		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] B 100.0
/100.0		 130
/130		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] B 100.0
/100.0		 130
/130		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] B 100.0
/100.0		 130
/130		 NCAP_SARS2 Nucleoprotein
8x1h C NCAP_SARS2 Nucleoprotein[127 aa] B 100.0
/100.0		 13
/13		 NCAP_SARS2 Nucleoprotein
8x1h C NCAP_SARS2 Nucleoprotein[127 aa] B 100.0
/100.0		 13
/13		 NCAP_SARS2 Nucleoprotein
8x1h C NCAP_SARS2 Nucleoprotein[127 aa] B 100.0
/100.0		 13
/13		 NCAP_SARS2 Nucleoprotein
8x1h C NCAP_SARS2 Nucleoprotein[127 aa] B 100.0
/100.0		 13
/13		 NCAP_SARS2 Nucleoprotein
8x1h C NCAP_SARS2 Nucleoprotein[127 aa] B 100.0
/100.0		 13
/13		 NCAP_SARS2 Nucleoprotein
8x1h C NCAP_SARS2 Nucleoprotein[127 aa] B 100.0
/100.0		 13
/13		 NCAP_SARS2 Nucleoprotein
8x1h C NCAP_SARS2 Nucleoprotein[127 aa] B 100.0
/100.0		 13
/13		 NCAP_SARS2 Nucleoprotein
8x1h C NCAP_SARS2 Nucleoprotein[127 aa] B 100.0
/100.0		 13
/13		 NCAP_SARS2 Nucleoprotein
8x1h C NCAP_SARS2 Nucleoprotein[127 aa] B 100.0
/100.0		 13
/13		 NCAP_SARS2 Nucleoprotein
8x1h C NCAP_SARS2 Nucleoprotein[127 aa] B 100.0
/100.0		 13
/13		 NCAP_SARS2 Nucleoprotein
8x1h C NCAP_SARS2 Nucleoprotein[127 aa] B 100.0
/100.0		 13
/13		 NCAP_SARS2 Nucleoprotein
8x1h C NCAP_SARS2 Nucleoprotein[127 aa] B 100.0
/100.0		 13
/13		 NCAP_SARS2 Nucleoprotein
8x1h C NCAP_SARS2 Nucleoprotein[127 aa] B 100.0
/100.0		 13
/13		 NCAP_SARS2 Nucleoprotein
8x1h C NCAP_SARS2 Nucleoprotein[127 aa] B 100.0
/100.0		 13
/13		 NCAP_SARS2 Nucleoprotein
8x1h C NCAP_SARS2 Nucleoprotein[127 aa] B 100.0
/100.0		 13
/13		 NCAP_SARS2 Nucleoprotein
8x1h C NCAP_SARS2 Nucleoprotein[127 aa] B 100.0
/100.0		 13
/13		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] B 100.0
/100.0		 8
/8		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] B 100.0
/100.0		 8
/8		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] B 100.0
/100.0		 8
/8		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] B 100.0
/100.0		 8
/8		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] B 100.0
/100.0		 8
/8		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] B 100.0
/100.0		 8
/8		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] B 100.0
/100.0		 8
/8		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] B 100.0
/100.0		 8
/8		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] B 100.0
/100.0		 8
/8		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] B 100.0
/100.0		 8
/8		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] B 100.0
/100.0		 8
/8		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] B 100.0
/100.0		 8
/8		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] B 100.0
/100.0		 8
/8		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] B 100.0
/100.0		 8
/8		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] B 100.0
/100.0		 8
/8		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] B 100.0
/100.0		 8
/8		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] C 100.0
/100.0		 13
/13		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] C 100.0
/100.0		 13
/13		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] C 100.0
/100.0		 13
/13		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] C 100.0
/100.0		 13
/13		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] C 100.0
/100.0		 13
/13		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] C 100.0
/100.0		 13
/13		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] C 100.0
/100.0		 13
/13		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] C 100.0
/100.0		 13
/13		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] C 100.0
/100.0		 13
/13		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] C 100.0
/100.0		 13
/13		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] C 100.0
/100.0		 13
/13		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] C 100.0
/100.0		 13
/13		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] C 100.0
/100.0		 13
/13		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] C 100.0
/100.0		 13
/13		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] C 100.0
/100.0		 13
/13		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] C 100.0
/100.0		 13
/13		 NCAP_SARS2 Nucleoprotein
8x1h C NCAP_SARS2 Nucleoprotein[127 aa] C 100.0
/100.0		 127
/127		 NCAP_SARS2 Nucleoprotein
8x1h C NCAP_SARS2 Nucleoprotein[127 aa] C 100.0
/100.0		 127
/127		 NCAP_SARS2 Nucleoprotein
8x1h C NCAP_SARS2 Nucleoprotein[127 aa] C 100.0
/100.0		 127
/127		 NCAP_SARS2 Nucleoprotein
8x1h C NCAP_SARS2 Nucleoprotein[127 aa] C 100.0
/100.0		 127
/127		 NCAP_SARS2 Nucleoprotein
8x1h C NCAP_SARS2 Nucleoprotein[127 aa] C 100.0
/100.0		 127
/127		 NCAP_SARS2 Nucleoprotein
8x1h C NCAP_SARS2 Nucleoprotein[127 aa] C 100.0
/100.0		 127
/127		 NCAP_SARS2 Nucleoprotein
8x1h C NCAP_SARS2 Nucleoprotein[127 aa] C 100.0
/100.0		 127
/127		 NCAP_SARS2 Nucleoprotein
8x1h C NCAP_SARS2 Nucleoprotein[127 aa] C 100.0
/100.0		 127
/127		 NCAP_SARS2 Nucleoprotein
8x1h C NCAP_SARS2 Nucleoprotein[127 aa] C 100.0
/100.0		 127
/127		 NCAP_SARS2 Nucleoprotein
8x1h C NCAP_SARS2 Nucleoprotein[127 aa] C 100.0
/100.0		 127
/127		 NCAP_SARS2 Nucleoprotein
8x1h C NCAP_SARS2 Nucleoprotein[127 aa] C 100.0
/100.0		 127
/127		 NCAP_SARS2 Nucleoprotein
8x1h C NCAP_SARS2 Nucleoprotein[127 aa] C 100.0
/100.0		 127
/127		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] C 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] C 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] C 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] C 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] C 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] C 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] C 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] C 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] C 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] C 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] C 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] C 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] C 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] C 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] C 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] C 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
8x1h A NCAP_SARS2 Nucleoprotein[128 aa] D 100.0
/100.0		 6
/6		 NCAP_SARS2 Nucleoprotein
8x1h A NCAP_SARS2 Nucleoprotein[128 aa] D 100.0
/100.0		 6
/6		 NCAP_SARS2 Nucleoprotein
8x1h A NCAP_SARS2 Nucleoprotein[128 aa] D 100.0
/100.0		 6
/6		 NCAP_SARS2 Nucleoprotein
8x1h A NCAP_SARS2 Nucleoprotein[128 aa] D 100.0
/100.0		 6
/6		 NCAP_SARS2 Nucleoprotein
8x1h A NCAP_SARS2 Nucleoprotein[128 aa] D 100.0
/100.0		 6
/6		 NCAP_SARS2 Nucleoprotein
8x1h A NCAP_SARS2 Nucleoprotein[128 aa] D 100.0
/100.0		 6
/6		 NCAP_SARS2 Nucleoprotein
8x1h A NCAP_SARS2 Nucleoprotein[128 aa] D 100.0
/100.0		 6
/6		 NCAP_SARS2 Nucleoprotein
8x1h A NCAP_SARS2 Nucleoprotein[128 aa] D 100.0
/100.0		 6
/6		 NCAP_SARS2 Nucleoprotein
8x1h A NCAP_SARS2 Nucleoprotein[128 aa] D 100.0
/100.0		 6
/6		 NCAP_SARS2 Nucleoprotein
8x1h A NCAP_SARS2 Nucleoprotein[128 aa] D 100.0
/100.0		 6
/6		 NCAP_SARS2 Nucleoprotein
8x1h A NCAP_SARS2 Nucleoprotein[128 aa] D 100.0
/100.0		 6
/6		 NCAP_SARS2 Nucleoprotein
8x1h A NCAP_SARS2 Nucleoprotein[128 aa] D 100.0
/100.0		 6
/6		 NCAP_SARS2 Nucleoprotein
8x1h A NCAP_SARS2 Nucleoprotein[128 aa] D 100.0
/100.0		 6
/6		 NCAP_SARS2 Nucleoprotein
8x1h A NCAP_SARS2 Nucleoprotein[128 aa] D 100.0
/100.0		 6
/6		 NCAP_SARS2 Nucleoprotein
8x1h A NCAP_SARS2 Nucleoprotein[128 aa] D 100.0
/100.0		 6
/6		 NCAP_SARS2 Nucleoprotein
8x1h A NCAP_SARS2 Nucleoprotein[128 aa] D 100.0
/100.0		 6
/6		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] D 100.0
/100.0		 5
/5		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] D 100.0
/100.0		 5
/5		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] D 100.0
/100.0		 5
/5		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] D 100.0
/100.0		 5
/5		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] D 100.0
/100.0		 5
/5		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] D 100.0
/100.0		 5
/5		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] D 100.0
/100.0		 5
/5		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] D 100.0
/100.0		 5
/5		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] D 100.0
/100.0		 5
/5		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] D 100.0
/100.0		 5
/5		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] D 100.0
/100.0		 5
/5		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] D 100.0
/100.0		 5
/5		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] D 100.0
/100.0		 5
/5		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] D 100.0
/100.0		 5
/5		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] D 100.0
/100.0		 5
/5		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] D 100.0
/100.0		 5
/5		 NCAP_SARS2 Nucleoprotein
8x1h C NCAP_SARS2 Nucleoprotein[127 aa] D 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
8x1h C NCAP_SARS2 Nucleoprotein[127 aa] D 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
8x1h C NCAP_SARS2 Nucleoprotein[127 aa] D 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
8x1h C NCAP_SARS2 Nucleoprotein[127 aa] D 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
8x1h C NCAP_SARS2 Nucleoprotein[127 aa] D 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
8x1h C NCAP_SARS2 Nucleoprotein[127 aa] D 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
8x1h C NCAP_SARS2 Nucleoprotein[127 aa] D 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
8x1h C NCAP_SARS2 Nucleoprotein[127 aa] D 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
8x1h C NCAP_SARS2 Nucleoprotein[127 aa] D 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
8x1h C NCAP_SARS2 Nucleoprotein[127 aa] D 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
8x1h C NCAP_SARS2 Nucleoprotein[127 aa] D 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
8x1h C NCAP_SARS2 Nucleoprotein[127 aa] D 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
8x1h C NCAP_SARS2 Nucleoprotein[127 aa] D 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
8x1h C NCAP_SARS2 Nucleoprotein[127 aa] D 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
8x1h C NCAP_SARS2 Nucleoprotein[127 aa] D 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
8x1h C NCAP_SARS2 Nucleoprotein[127 aa] D 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] D 100.0
/100.0		 122
/122		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] D 100.0
/100.0		 122
/122		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] D 100.0
/100.0		 122
/122		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] D 100.0
/100.0		 122
/122		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] D 100.0
/100.0		 122
/122		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] D 100.0
/100.0		 122
/122		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] D 100.0
/100.0		 122
/122		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] D 100.0
/100.0		 122
/122		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] D 100.0
/100.0		 122
/122		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] D 100.0
/100.0		 122
/122		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] D 100.0
/100.0		 122
/122		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] D 100.0
/100.0		 122
/122		 NCAP_SARS2 Nucleoprotein
6wji B NCAP_SARS2 Nucleoprotein[108 aa] A 100.0
/100.0		 54
/54		 NCAP_SARS2 Nucleoprotein
6wji A NCAP_SARS2 Nucleoprotein[108 aa] B 100.0
/100.0		 53
/53		 NCAP_SARS2 Nucleoprotein
6wji D NCAP_SARS2 Nucleoprotein[108 aa] C 100.0
/100.0		 54
/54		 NCAP_SARS2 Nucleoprotein
6wji C NCAP_SARS2 Nucleoprotein[108 aa] D 100.0
/100.0		 54
/54		 NCAP_SARS2 Nucleoprotein
6wji F NCAP_SARS2 Nucleoprotein[108 aa] E 100.0
/100.0		 53
/53		 NCAP_SARS2 Nucleoprotein
6wji E NCAP_SARS2 Nucleoprotein[108 aa] F 100.0
/100.0		 52
/52		 NCAP_SARS2 Nucleoprotein
6wzo B NCAP_SARS2 Nucleoprotein[111 aa] A 100.0
/100.0		 54
/54		 NCAP_SARS2 Nucleoprotein
6wzo A NCAP_SARS2 Nucleoprotein[108 aa] B 100.0
/100.0		 53
/53		 NCAP_SARS2 Nucleoprotein
6wzo D NCAP_SARS2 Nucleoprotein[110 aa] C 100.0
/100.0		 53
/53		 NCAP_SARS2 Nucleoprotein
6wzo C NCAP_SARS2 Nucleoprotein[108 aa] D 100.0
/100.0		 54
/54		 NCAP_SARS2 Nucleoprotein
6wzq B NCAP_SARS2 Nucleoprotein[114 aa] A 100.0
/100.0		 52
/52		 NCAP_SARS2 Nucleoprotein
6wzq A NCAP_SARS2 Nucleoprotein[114 aa] B 100.0
/100.0		 54
/54		 NCAP_SARS2 Nucleoprotein
6wzq D NCAP_SARS2 Nucleoprotein[115 aa] C 100.0
/100.0		 54
/54		 NCAP_SARS2 Nucleoprotein
6wzq C NCAP_SARS2 Nucleoprotein[116 aa] D 100.0
/100.0		 52
/52		 NCAP_SARS2 Nucleoprotein
6yun B NCAP_SARS2 Nucleoprotein[135 aa] A 100.0
/100.0		 55
/55		 NCAP_SARS2 Nucleoprotein
6yun A NCAP_SARS2 Nucleoprotein[116 aa] B 100.0
/100.0		 52
/52		 NCAP_SARS2 Nucleoprotein
6zco A NCAP_SARS2 Nucleoprotein[118 aa] A 100.0
/100.0		 52
/52		 NCAP_SARS2 Nucleoprotein
6zco A NCAP_SARS2 Nucleoprotein[118 aa] A 100.0
/100.0		 52
/52		 NCAP_SARS2 Nucleoprotein
7c22 B NCAP_SARS2 Nucleoprotein[113 aa] A 100.0
/100.0		 51
/51		 NCAP_SARS2 Nucleoprotein
7c22 A NCAP_SARS2 Nucleoprotein[109 aa] B 100.0
/100.0		 52
/52		 NCAP_SARS2 Nucleoprotein
7c22 D NCAP_SARS2 Nucleoprotein[108 aa] C 100.0
/100.0		 54
/54		 NCAP_SARS2 Nucleoprotein
7c22 C NCAP_SARS2 Nucleoprotein[112 aa] D 100.0
/100.0		 55
/55		 NCAP_SARS2 Nucleoprotein
7ce0 D NCAP_SARS2 Nucleoprotein[110 aa] A 100.0
/100.0		 53
/53		 NCAP_SARS2 Nucleoprotein
7ce0 C NCAP_SARS2 Nucleoprotein[110 aa] B 100.0
/100.0		 52
/52		 NCAP_SARS2 Nucleoprotein
7ce0 B NCAP_SARS2 Nucleoprotein[110 aa] C 100.0
/100.0		 53
/53		 NCAP_SARS2 Nucleoprotein
7ce0 A NCAP_SARS2 Nucleoprotein[110 aa] D 100.0
/100.0		 54
/54		 NCAP_SARS2 Nucleoprotein
7de1 B NCAP_SARS2 Nucleoprotein[115 aa] A 100.0
/100.0		 53
/53		 NCAP_SARS2 Nucleoprotein
7de1 A NCAP_SARS2 Nucleoprotein[108 aa] B 100.0
/100.0		 54
/54		 NCAP_SARS2 Nucleoprotein
7f2b B NCAP_SARS2 Nucleoprotein[106 aa] A 100.0
/100.0		 52
/52		 NCAP_SARS2 Nucleoprotein
7f2b A NCAP_SARS2 Nucleoprotein[106 aa] B 100.0
/100.0		 53
/53		 NCAP_SARS2 Nucleoprotein
7f2e B NCAP_SARS2 Nucleoprotein[106 aa] A 100.0
/100.0		 53
/53		 NCAP_SARS2 Nucleoprotein
7f2e A NCAP_SARS2 Nucleoprotein[106 aa] B 100.0
/100.0		 53
/53		 NCAP_SARS2 Nucleoprotein
7f2e D NCAP_SARS2 Nucleoprotein[107 aa] C 100.0
/100.0		 48
/48		 NCAP_SARS2 Nucleoprotein
7f2e C NCAP_SARS2 Nucleoprotein[107 aa] D 100.0
/100.0		 49
/49		 NCAP_SARS2 Nucleoprotein
7f2e E NCAP_SARS2 Nucleoprotein[96 aa] F 100.0
/100.0		 43
/43		 NCAP_SARS2 Nucleoprotein
7f2e H NCAP_SARS2 Nucleoprotein[106 aa] G 100.0
/100.0		 54
/54		 NCAP_SARS2 Nucleoprotein
7f2e G NCAP_SARS2 Nucleoprotein[107 aa] H 100.0
/100.0		 51
/51		 NCAP_SARS2 Nucleoprotein
7f2e J NCAP_SARS2 Nucleoprotein[106 aa] I 100.0
/100.0		 51
/51		 NCAP_SARS2 Nucleoprotein
7f2e I NCAP_SARS2 Nucleoprotein[107 aa] J 100.0
/100.0		 50
/50		 NCAP_SARS2 Nucleoprotein
7f2e K NCAP_SARS2 Nucleoprotein[96 aa] L 100.0
/100.0		 39
/39		 NCAP_SARS2 Nucleoprotein
7n0i B NCAP_SARS2 Nucleoprotein[96 aa] A 100.0
/100.0		 43
/43		 NCAP_SARS2 Nucleoprotein
7n0i A NCAP_SARS2 Nucleoprotein[96 aa] B 100.0
/100.0		 44
/44		 NCAP_SARS2 Nucleoprotein
7n0i D NCAP_SARS2 Nucleoprotein[96 aa] C 100.0
/100.0		 44
/44		 NCAP_SARS2 Nucleoprotein
7n0i C NCAP_SARS2 Nucleoprotein[96 aa] D 100.0
/100.0		 44
/44		 NCAP_SARS2 Nucleoprotein
7n0i F NCAP_SARS2 Nucleoprotein[96 aa] E 100.0
/100.0		 43
/43		 NCAP_SARS2 Nucleoprotein
7n0i E NCAP_SARS2 Nucleoprotein[96 aa] F 100.0
/100.0		 38
/38		 NCAP_SARS2 Nucleoprotein
7n0i L NCAP_SARS2 Nucleoprotein[96 aa] G 100.0
/100.0		 42
/42		 NCAP_SARS2 Nucleoprotein
7n0i G NCAP_SARS2 Nucleoprotein[96 aa] L 100.0
/100.0		 39
/39		 NCAP_SARS2 Nucleoprotein
7o05 C NCAP_SARS2 Nucleoprotein[111 aa] A 100.0
/100.0		 53
/53		 NCAP_SARS2 Nucleoprotein
7o05 D NCAP_SARS2 Nucleoprotein[111 aa] B 100.0
/100.0		 50
/50		 NCAP_SARS2 Nucleoprotein
7o05 A NCAP_SARS2 Nucleoprotein[109 aa] C 100.0
/100.0		 53
/53		 NCAP_SARS2 Nucleoprotein
7o05 B NCAP_SARS2 Nucleoprotein[109 aa] D 100.0
/100.0		 52
/52		 NCAP_SARS2 Nucleoprotein
7o35 B NCAP_SARS2 Nucleoprotein[123 aa] A 100.0
/100.0		 52
/52		 NCAP_SARS2 Nucleoprotein
7o35 A NCAP_SARS2 Nucleoprotein[111 aa] B 100.0
/100.0		 52
/52		 NCAP_SARS2 Nucleoprotein
7o35 D NCAP_SARS2 Nucleoprotein[109 aa] C 100.0
/100.0		 52
/52		 NCAP_SARS2 Nucleoprotein
7o35 C NCAP_SARS2 Nucleoprotein[111 aa] D 100.0
/100.0		 52
/52		 NCAP_SARS2 Nucleoprotein
7o36 B NCAP_SARS2 Nucleoprotein[109 aa] A 100.0
/100.0		 55
/55		 NCAP_SARS2 Nucleoprotein
7o36 A NCAP_SARS2 Nucleoprotein[112 aa] B 100.0
/100.0		 51
/51		 NCAP_SARS2 Nucleoprotein
7o36 D NCAP_SARS2 Nucleoprotein[111 aa] C 100.0
/100.0		 54
/54		 NCAP_SARS2 Nucleoprotein
7o36 C NCAP_SARS2 Nucleoprotein[113 aa] D 100.0
/100.0		 54
/54		 NCAP_SARS2 Nucleoprotein
7uxx C NCAP_SARS2 Nucleoprotein[109 aa] A 100.0
/100.0		 54
/54		 NCAP_SARS2 Nucleoprotein
7uxx D NCAP_SARS2 Nucleoprotein[109 aa] B 100.0
/100.0		 53
/53		 NCAP_SARS2 Nucleoprotein
7uxx A NCAP_SARS2 Nucleoprotein[109 aa] C 100.0
/100.0		 53
/53		 NCAP_SARS2 Nucleoprotein
7uxx B NCAP_SARS2 Nucleoprotein[109 aa] D 100.0
/100.0		 52
/52		 NCAP_SARS2 Nucleoprotein
7uxx F NCAP_SARS2 Nucleoprotein[110 aa] E 100.0
/100.0		 54
/54		 NCAP_SARS2 Nucleoprotein
7uxx E NCAP_SARS2 Nucleoprotein[109 aa] F 100.0
/100.0		 54
/54		 NCAP_SARS2 Nucleoprotein
7uxz B NCAP_SARS2 Nucleoprotein[109 aa] A 100.0
/100.0		 53
/53		 NCAP_SARS2 Nucleoprotein
7uxz A NCAP_SARS2 Nucleoprotein[109 aa] B 100.0
/100.0		 55
/55		 NCAP_SARS2 Nucleoprotein
7uxz D NCAP_SARS2 Nucleoprotein[109 aa] C 100.0
/100.0		 53
/53		 NCAP_SARS2 Nucleoprotein
7uxz C NCAP_SARS2 Nucleoprotein[109 aa] D 100.0
/100.0		 54
/54		 NCAP_SARS2 Nucleoprotein
7uxz F NCAP_SARS2 Nucleoprotein[109 aa] E 100.0
/100.0		 53
/53		 NCAP_SARS2 Nucleoprotein
7uxz E NCAP_SARS2 Nucleoprotein[109 aa] F 100.0
/100.0		 53
/53		 NCAP_SARS2 Nucleoprotein
7vbe B NCAP_SARS2 Nucleoprotein[107 aa] A 100.0
/100.0		 52
/52		 NCAP_SARS2 Nucleoprotein
7vbe A NCAP_SARS2 Nucleoprotein[108 aa] B 100.0
/100.0		 53
/53		 NCAP_SARS2 Nucleoprotein
7vbf B NCAP_SARS2 Nucleoprotein[110 aa] A 100.0
/100.0		 54
/54		 NCAP_SARS2 Nucleoprotein
7vbf A NCAP_SARS2 Nucleoprotein[116 aa] B 100.0
/100.0		 53
/53		 NCAP_SARS2 Nucleoprotein
7xwx E NCAP_SARS2 Nucleoprotein[92 aa] A 100.0
/100.0		 43
/43		 NCAP_SARS2 Nucleoprotein
7xwx F NCAP_SARS2 Nucleoprotein[96 aa] B 100.0
/100.0		 44
/44		 NCAP_SARS2 Nucleoprotein
7xwx D NCAP_SARS2 Nucleoprotein[96 aa] C 100.0
/100.0		 44
/44		 NCAP_SARS2 Nucleoprotein
7xwx C NCAP_SARS2 Nucleoprotein[99 aa] D 100.0
/100.0		 45
/45		 NCAP_SARS2 Nucleoprotein
7xwx A NCAP_SARS2 Nucleoprotein[99 aa] E 100.0
/100.0		 46
/46		 NCAP_SARS2 Nucleoprotein
7xwx B NCAP_SARS2 Nucleoprotein[99 aa] F 100.0
/100.0		 45
/45		 NCAP_SARS2 Nucleoprotein
7xwx H NCAP_SARS2 Nucleoprotein[90 aa] G 100.0
/100.0		 43
/43		 NCAP_SARS2 Nucleoprotein
7xwx G NCAP_SARS2 Nucleoprotein[99 aa] H 100.0
/100.0		 46
/46		 NCAP_SARS2 Nucleoprotein
7xxk B NCAP_SARS2 Nucleoprotein[107 aa] A 100.0
/100.0		 55
/55		 NCAP_SARS2 Nucleoprotein
7xxk A NCAP_SARS2 Nucleoprotein[109 aa] B 100.0
/100.0		 54
/54		 NCAP_SARS2 Nucleoprotein
7xxk D NCAP_SARS2 Nucleoprotein[109 aa] C 100.0
/100.0		 53
/53		 NCAP_SARS2 Nucleoprotein
7xxk C NCAP_SARS2 Nucleoprotein[107 aa] D 100.0
/100.0		 54
/54		 NCAP_SARS2 Nucleoprotein
7xxk F NCAP_SARS2 Nucleoprotein[107 aa] E 100.0
/100.0		 54
/54		 NCAP_SARS2 Nucleoprotein
7xxk E NCAP_SARS2 Nucleoprotein[109 aa] F 100.0
/100.0		 51
/51		 NCAP_SARS2 Nucleoprotein
7ylb B NCAP_SARS2 Nucleoprotein[114 aa] A 100.0
/100.0		 49
/49		 NCAP_SARS2 Nucleoprotein
7ylb A NCAP_SARS2 Nucleoprotein[108 aa] B 100.0
/100.0		 52
/52		 NCAP_SARS2 Nucleoprotein
7ylb E NCAP_SARS2 Nucleoprotein[111 aa] D 100.0
/100.0		 52
/52		 NCAP_SARS2 Nucleoprotein
7ylb D NCAP_SARS2 Nucleoprotein[110 aa] E 100.0
/100.0		 52
/52		 NCAP_SARS2 Nucleoprotein
7ylb H NCAP_SARS2 Nucleoprotein[113 aa] G 100.0
/100.0		 52
/52		 NCAP_SARS2 Nucleoprotein
7ylb G NCAP_SARS2 Nucleoprotein[109 aa] H 100.0
/100.0		 51
/51		 NCAP_SARS2 Nucleoprotein
7ylb K NCAP_SARS2 Nucleoprotein[110 aa] J 100.0
/100.0		 52
/52		 NCAP_SARS2 Nucleoprotein
7ylb J NCAP_SARS2 Nucleoprotein[110 aa] K 100.0
/100.0		 52
/52		 NCAP_SARS2 Nucleoprotein
6wkp A NCAP_SARS2 Nucleoprotein[103 aa] B 100.0
/100.0		 8
/8		 NCAP_SARS2 Nucleoprotein
6wkp A NCAP_SARS2 Nucleoprotein[103 aa] D 100.0
/100.0		 6
/6		 NCAP_SARS2 Nucleoprotein
7f2e F NCAP_SARS2 Nucleoprotein[97 aa] E 100.0
/100.0		 43
/43		 NCAP_SARS2 Nucleoprotein
7f2e L NCAP_SARS2 Nucleoprotein[92 aa] K 100.0
/100.0		 41
/41		 NCAP_SARS2 Nucleoprotein
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
419 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6vyo E MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms] 		A 100.0
/100.0		 5
/5		 NCAP_SARS2 Nucleoprotein
6vyo G MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms] 		A 100.0
/100.0		 3
/3		 NCAP_SARS2 Nucleoprotein
6vyo G MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms] 		B 100.0
/100.0		 4
/4		 NCAP_SARS2 Nucleoprotein
6vyo L MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms] 		B 100.0
/100.0		 2
/2		 NCAP_SARS2 Nucleoprotein
6vyo L MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms] 		C 100.0
/100.0		 6
/6		 NCAP_SARS2 Nucleoprotein
6vyo Q MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms] 		C 100.0
/100.0		 3
/3		 NCAP_SARS2 Nucleoprotein
6vyo E MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms] 		D 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
6vyo Q MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms] 		D 100.0
/100.0		 3
/3		 NCAP_SARS2 Nucleoprotein
6wkp F MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms] 		A 100.0
/100.0		 5
/5		 NCAP_SARS2 Nucleoprotein
6wkp F MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms] 		B 100.0
/100.0		 4
/4		 NCAP_SARS2 Nucleoprotein
6wkp I MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms] 		C 100.0
/100.0		 4
/4		 NCAP_SARS2 Nucleoprotein
6wkp I MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms] 		D 100.0
/100.0		 4
/4		 NCAP_SARS2 Nucleoprotein
7xx1 G MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms] 		A 100.0
/100.0		 4
/4		 NCAP_SARS2 Nucleoprotein
7xx1 L MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms] 		A 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
7xx1 G MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms] 		B 100.0
/100.0		 4
/4		 NCAP_SARS2 Nucleoprotein
7xx1 H MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms] 		B 100.0
/100.0		 5
/5		 NCAP_SARS2 Nucleoprotein
7xx1 H MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms] 		C 100.0
/100.0		 2
/2		 NCAP_SARS2 Nucleoprotein
7xx1 K MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms] 		C 100.0
/100.0		 4
/4		 NCAP_SARS2 Nucleoprotein
7xx1 K MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms] 		D 100.0
/100.0		 4
/4		 NCAP_SARS2 Nucleoprotein
7xx1 L MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms] 		D 100.0
/100.0		 5
/5		 NCAP_SARS2 Nucleoprotein
6vyo K GOL
GLYCEROL[6 atoms] 		B 100.0
/100.0		 3
/3		 NCAP_SARS2 Nucleoprotein
6vyo P GOL
GLYCEROL[6 atoms] 		C 100.0
/100.0		 6
/6		 NCAP_SARS2 Nucleoprotein
6vyo S GOL
GLYCEROL[6 atoms] 		D 100.0
/100.0		 3
/3		 NCAP_SARS2 Nucleoprotein
6vyo T GOL
GLYCEROL[6 atoms] 		D 100.0
/100.0		 7
/7		 NCAP_SARS2 Nucleoprotein
7o36 F GOL
GLYCEROL[6 atoms] 		A 100.0
/100.0		 3
/3		 NCAP_SARS2 Nucleoprotein
7o36 F GOL
GLYCEROL[6 atoms] 		B 100.0
/100.0		 9
/9		 NCAP_SARS2 Nucleoprotein
7uxx G GOL
GLYCEROL[6 atoms] 		A 100.0
/100.0		 4
/4		 NCAP_SARS2 Nucleoprotein
7uxx H GOL
GLYCEROL[6 atoms] 		B 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
7uxx G GOL
GLYCEROL[6 atoms] 		C 100.0
/100.0		 2
/2		 NCAP_SARS2 Nucleoprotein
7uxx H GOL
GLYCEROL[6 atoms] 		D 100.0
/100.0		 3
/3		 NCAP_SARS2 Nucleoprotein
7uxx J GOL
GLYCEROL[6 atoms] 		F 100.0
/100.0		 4
/4		 NCAP_SARS2 Nucleoprotein
7uxz I GOL
GLYCEROL[6 atoms] 		A 100.0
/100.0		 2
/2		 NCAP_SARS2 Nucleoprotein
7uxz I GOL
GLYCEROL[6 atoms] 		B 100.0
/100.0		 3
/3		 NCAP_SARS2 Nucleoprotein
7uxz K GOL
GLYCEROL[6 atoms] 		D 100.0
/100.0		 4
/4		 NCAP_SARS2 Nucleoprotein
7uxz N GOL
GLYCEROL[6 atoms] 		F 100.0
/100.0		 5
/5		 NCAP_SARS2 Nucleoprotein
7xwz I GOL
GLYCEROL[6 atoms] 		B 100.0
/100.0		 6
/6		 NCAP_SARS2 Nucleoprotein
8x1h E GOL
GLYCEROL[6 atoms] 		A 100.0
/100.0		 6
/6		 NCAP_SARS2 Nucleoprotein
8x1h E GOL
GLYCEROL[6 atoms] 		A 100.0
/100.0		 6
/6		 NCAP_SARS2 Nucleoprotein
8x1h E GOL
GLYCEROL[6 atoms] 		A 100.0
/100.0		 6
/6		 NCAP_SARS2 Nucleoprotein
8x1h E GOL
GLYCEROL[6 atoms] 		A 100.0
/100.0		 6
/6		 NCAP_SARS2 Nucleoprotein
8x1h E GOL
GLYCEROL[6 atoms] 		A 100.0
/100.0		 6
/6		 NCAP_SARS2 Nucleoprotein
8x1h E GOL
GLYCEROL[6 atoms] 		A 100.0
/100.0		 6
/6		 NCAP_SARS2 Nucleoprotein
8x1h E GOL
GLYCEROL[6 atoms] 		A 100.0
/100.0		 6
/6		 NCAP_SARS2 Nucleoprotein
8x1h E GOL
GLYCEROL[6 atoms] 		A 100.0
/100.0		 6
/6		 NCAP_SARS2 Nucleoprotein
8x1h E GOL
GLYCEROL[6 atoms] 		A 100.0
/100.0		 6
/6		 NCAP_SARS2 Nucleoprotein
8x1h E GOL
GLYCEROL[6 atoms] 		A 100.0
/100.0		 6
/6		 NCAP_SARS2 Nucleoprotein
8x1h E GOL
GLYCEROL[6 atoms] 		A 100.0
/100.0		 6
/6		 NCAP_SARS2 Nucleoprotein
8x1h E GOL
GLYCEROL[6 atoms] 		A 100.0
/100.0		 6
/6		 NCAP_SARS2 Nucleoprotein
8x1h E GOL
GLYCEROL[6 atoms] 		A 100.0
/100.0		 6
/6		 NCAP_SARS2 Nucleoprotein
8x1h E GOL
GLYCEROL[6 atoms] 		A 100.0
/100.0		 6
/6		 NCAP_SARS2 Nucleoprotein
8x1h E GOL
GLYCEROL[6 atoms] 		A 100.0
/100.0		 6
/6		 NCAP_SARS2 Nucleoprotein
8x1h E GOL
GLYCEROL[6 atoms] 		A 100.0
/100.0		 6
/6		 NCAP_SARS2 Nucleoprotein
6wzq E SO4
SULFATE ION[5 atoms] 		A 100.0
/100.0		 2
/2		 NCAP_SARS2 Nucleoprotein
6wzq F SO4
SULFATE ION[5 atoms] 		A 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
6wzq G SO4
SULFATE ION[5 atoms] 		B 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
6wzq H SO4
SULFATE ION[5 atoms] 		C 100.0
/100.0		 2
/2		 NCAP_SARS2 Nucleoprotein
6wzq I SO4
SULFATE ION[5 atoms] 		C 100.0
/100.0		 3
/3		 NCAP_SARS2 Nucleoprotein
6wzq J SO4
SULFATE ION[5 atoms] 		D 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
7n0r F SO4
SULFATE ION[5 atoms] 		B 100.0
/100.0		 2
/2		 NCAP_SARS2 Nucleoprotein
7n0r G SO4
SULFATE ION[5 atoms] 		B 100.0
/100.0		 4
/4		 NCAP_SARS2 Nucleoprotein
7ylb M SO4
SULFATE ION[5 atoms] 		B 100.0
/100.0		 5
/5		 NCAP_SARS2 Nucleoprotein
7ylb N SO4
SULFATE ION[5 atoms] 		E 100.0
/100.0		 5
/5		 NCAP_SARS2 Nucleoprotein
7ylb O SO4
SULFATE ION[5 atoms] 		H 100.0
/100.0		 5
/5		 NCAP_SARS2 Nucleoprotein
7ylb P SO4
SULFATE ION[5 atoms] 		K 100.0
/100.0		 4
/4		 NCAP_SARS2 Nucleoprotein
7c22 E ACT
ACETATE ION[4 atoms] 		A 100.0
/100.0		 2
/2		 NCAP_SARS2 Nucleoprotein
7c22 E ACT
ACETATE ION[4 atoms] 		B 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
7c22 G ACT
ACETATE ION[4 atoms] 		C 100.0
/100.0		 3
/3		 NCAP_SARS2 Nucleoprotein
7c22 G ACT
ACETATE ION[4 atoms] 		D 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
7n0i M ACT
ACETATE ION[4 atoms] 		C 100.0
/100.0		 3
/3		 NCAP_SARS2 Nucleoprotein
7n0i M ACT
ACETATE ION[4 atoms] 		D 100.0
/100.0		 2
/2		 NCAP_SARS2 Nucleoprotein
7n0i O ACT
ACETATE ION[4 atoms] 		L 100.0
/100.0		 2
/2		 NCAP_SARS2 Nucleoprotein
7uxx I ACT
ACETATE ION[4 atoms] 		B 100.0
/100.0		 3
/3		 NCAP_SARS2 Nucleoprotein
7uxx I ACT
ACETATE ION[4 atoms] 		D 100.0
/100.0		 2
/2		 NCAP_SARS2 Nucleoprotein
7vnu E ACT
ACETATE ION[4 atoms] 		C 100.0
/100.0		 3
/3		 NCAP_SARS2 Nucleoprotein
7c22 F PEG
DI(HYDROXYETHYL)ETHER[7 atoms] 		A 100.0
/100.0		 3
/3		 NCAP_SARS2 Nucleoprotein
7de1 C PEG
DI(HYDROXYETHYL)ETHER[7 atoms] 		B 100.0
/100.0		 5
/5		 NCAP_SARS2 Nucleoprotein
7de1 D PEG
DI(HYDROXYETHYL)ETHER[7 atoms] 		B 100.0
/100.0		 2
/2		 NCAP_SARS2 Nucleoprotein
7de1 E PEG
DI(HYDROXYETHYL)ETHER[7 atoms] 		B 100.0
/100.0		 4
/4		 NCAP_SARS2 Nucleoprotein
7uxz H PEG
DI(HYDROXYETHYL)ETHER[7 atoms] 		A 100.0
/100.0		 4
/4		 NCAP_SARS2 Nucleoprotein
7uxz H PEG
DI(HYDROXYETHYL)ETHER[7 atoms] 		B 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
7uxz M PEG
DI(HYDROXYETHYL)ETHER[7 atoms] 		F 100.0
/100.0		 3
/3		 NCAP_SARS2 Nucleoprotein
7f2b C PO4
PHOSPHATE ION[5 atoms] 		A 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
7f2b D PO4
PHOSPHATE ION[5 atoms] 		A 100.0
/100.0		 2
/2		 NCAP_SARS2 Nucleoprotein
7f2b F PO4
PHOSPHATE ION[5 atoms] 		B 100.0
/100.0		 5
/5		 NCAP_SARS2 Nucleoprotein
7f2b G PO4
PHOSPHATE ION[5 atoms] 		B 100.0
/100.0		 2
/2		 NCAP_SARS2 Nucleoprotein
7f2b H PO4
PHOSPHATE ION[5 atoms] 		B 100.0
/100.0		 3
/3		 NCAP_SARS2 Nucleoprotein
7f2b I PO4
PHOSPHATE ION[5 atoms] 		B 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
7f2e M PO4
PHOSPHATE ION[5 atoms] 		G 100.0
/100.0		 3
/3		 NCAP_SARS2 Nucleoprotein
7f2e N PO4
PHOSPHATE ION[5 atoms] 		G 100.0
/100.0		 3
/3		 NCAP_SARS2 Nucleoprotein
7f2e M PO4
PHOSPHATE ION[5 atoms] 		H 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
7f2e N PO4
PHOSPHATE ION[5 atoms] 		H 100.0
/100.0		 2
/2		 NCAP_SARS2 Nucleoprotein
7f2e O PO4
PHOSPHATE ION[5 atoms] 		I 100.0
/100.0		 2
/2		 NCAP_SARS2 Nucleoprotein
7f2e P PO4
PHOSPHATE ION[5 atoms] 		I 100.0
/100.0		 2
/2		 NCAP_SARS2 Nucleoprotein
7f2e O PO4
PHOSPHATE ION[5 atoms] 		J 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
7f2e P PO4
PHOSPHATE ION[5 atoms] 		J 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
7n3c Y PO4
PHOSPHATE ION[5 atoms] 		C 100.0
/100.0		 4
/4		 NCAP_SARS2 Nucleoprotein
7xwx I PO4
PHOSPHATE ION[5 atoms] 		A 100.0
/100.0		 2
/2		 NCAP_SARS2 Nucleoprotein
7xwx J PO4
PHOSPHATE ION[5 atoms] 		B 100.0
/100.0		 2
/2		 NCAP_SARS2 Nucleoprotein
7xwx K PO4
PHOSPHATE ION[5 atoms] 		C 100.0
/100.0		 2
/2		 NCAP_SARS2 Nucleoprotein
7n3c M EDO
1,2-ETHANEDIOL[4 atoms] 		C 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
7n3c R EDO
1,2-ETHANEDIOL[4 atoms] 		C 100.0
/100.0		 3
/3		 NCAP_SARS2 Nucleoprotein
7n3c S EDO
1,2-ETHANEDIOL[4 atoms] 		C 100.0
/100.0		 5
/5		 NCAP_SARS2 Nucleoprotein
7n3d K EDO
1,2-ETHANEDIOL[4 atoms] 		C 100.0
/100.0		 2
/2		 NCAP_SARS2 Nucleoprotein
7n3d L EDO
1,2-ETHANEDIOL[4 atoms] 		C 100.0
/100.0		 5
/5		 NCAP_SARS2 Nucleoprotein
7n3d M EDO
1,2-ETHANEDIOL[4 atoms] 		C 100.0
/100.0		 5
/5		 NCAP_SARS2 Nucleoprotein
7n3d N EDO
1,2-ETHANEDIOL[4 atoms] 		C 100.0
/100.0		 3
/3		 NCAP_SARS2 Nucleoprotein
7str D EDO
1,2-ETHANEDIOL[4 atoms] 		C 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
7str F EDO
1,2-ETHANEDIOL[4 atoms] 		C 100.0
/100.0		 5
/5		 NCAP_SARS2 Nucleoprotein
7str G EDO
1,2-ETHANEDIOL[4 atoms] 		C 100.0
/100.0		 5
/5		 NCAP_SARS2 Nucleoprotein
7xwz G EDO
1,2-ETHANEDIOL[4 atoms] 		A 100.0
/100.0		 3
/3		 NCAP_SARS2 Nucleoprotein
7xwz H EDO
1,2-ETHANEDIOL[4 atoms] 		B 100.0
/100.0		 3
/3		 NCAP_SARS2 Nucleoprotein
7xxk G SCN
THIOCYANATE ION[3 atoms] 		A 100.0
/100.0		 5
/5		 NCAP_SARS2 Nucleoprotein
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.