Contact Molecules for Homologous Proteins | ||||
[Summary Bars] |
[Full Bars] |
|
[Back to Search Page] |
[Back to HOMCOS] |
[Sites by Variants] |
[SupCon3D] |
[help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
25506 | 419 | 175 | P0DTC9(NCAP_SARS2) | RecName: Full=Nucleoprotein ; Short=N;AltName: Full=Nucleocapsid protein ; Short=NC ; Short=Protein N ; |
QUERYSEQ |
MSDNGPQNQRNAPRITFGGPSDSTGSNQNGERSGARSKQRRPQGLPNNTASWFTALTQHGKEDLKFPRGQGVPINTNSSPDDQIGYYRRATRRIRGGDGKMKDLSPRWYFYYLGTGPEAGLPYGANKDGIIWVATEGALNTPKDHIGTRN PANNAAIVLQLPQGTTLPKGFYAEGSRGGSQASSRSSSRSRNSSRNSTPGSSRGTSPARMAGNGGDAALALLLLDRLNQLESKMSGKGQQQQGQTVTKKSAAEASKKPRQKRTATKAYNVTQAFGRRGPEQTQGNFGDQELIRQGTDYKH WPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYTGAIKLDDKDPNFKDQVILLNKHIDAYKTFPPTEPKKDKKKKADETQALPQRQKKQQTVTLLPAADLDDFSKQLQQSMSSADSTQA |
[n]:site number of query sequence. [a]:amino acid of query sequence. [s]:predicted secondary structure. [e]:predicted exposed/buried. [acc]:predicted relative accesssibility(%). [pdb]:PDB code of homologous structure. [contact_mols]:predicted binding molecules [observed aa]:Observed amino acids among homologous sequences. [feature table]:UniProt Feature Table [variant]:UniProt Human Variant.
n | a | s | e | acc | pdb | contact_mols | observed aa | feature table | variant |
1 | M | e | 89.4 | 8fd5_A | M |
COMPBIAS /note="Polar residues" REGION /note="Disordered" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
2 | S | e | 52.3 | 8fd5_A | S |
COMPBIAS /note="Polar residues" REGION /note="Disordered" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
3 | D | S | e | 38.9 | 8fd5_A | D |
COMPBIAS /note="Polar residues" REGION /note="Disordered" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
4 | N | S | e | 21.8 | 8fd5_A | N |
COMPBIAS /note="Polar residues" REGION /note="Disordered" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
5 | G | b | 11.9 | 8fd5_A | G |
COMPBIAS /note="Polar residues" REGION /note="Disordered" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
6 | P | T | e | 30.2 | 8fd5_A | P |
COMPBIAS /note="Polar residues" REGION /note="Disordered" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
7 | Q | T | e | 35.7 | 8fd5_A | Q |
COMPBIAS /note="Polar residues" REGION /note="Disordered" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
8 | N | b | 12.7 | 8fd5_A | N |
COMPBIAS /note="Polar residues" REGION /note="Disordered" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
9 | Q | T | e | 26.5 | 8fd5_A | Q |
COMPBIAS /note="Polar residues" REGION /note="Disordered" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
10 | R | T | b | 6.3 | 8fd5_A | R |
COMPBIAS /note="Polar residues" REGION /note="Disordered" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
11 | N | T | b | 10.3 | 8fd5_A | NS |
COMPBIAS /note="Polar residues" REGION /note="Disordered" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
12 | A | S | e | 24.1 | 8fd5_A | AS |
COMPBIAS /note="Polar residues" REGION /note="Disordered" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
13 | P | e | 34.9 | 8fd5_A | P |
COMPBIAS /note="Polar residues" REGION /note="Disordered" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
14 | R | T | e | 36.8 | 8fd5_A | RVK |
COMPBIAS /note="Polar residues" REGION /note="Disordered" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
15 | I | T | b | 12.9 | 8fd5_A | IV |
COMPBIAS /note="Polar residues" REGION /note="Disordered" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
16 | T | S | e | 22.7 | 8fd5_A | TKS |
COMPBIAS /note="Polar residues" REGION /note="Disordered" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
17 | F | S | e | 68.4 | 8fd5_A | FL |
COMPBIAS /note="Polar residues" REGION /note="Disordered" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
18 | G | S | e | 83.3 | 8fd5_A | GKA |
COMPBIAS /note="Polar residues" REGION /note="Disordered" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
19 | G | e | 52.4 | 8fd5_A | GQD |
COMPBIAS /note="Polar residues" REGION /note="Disordered" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
20 | P | e | 25.6 | 8fd5_A | PEN |
COMPBIAS /note="Polar residues" REGION /note="Disordered" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
21 | S | S | e | 63.3 | 8fd5_A | SANTGLDEFHIKMPQRVY |
COMPBIAS /note="Polar residues" REGION /note="Disordered" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
22 | D | S | e | 35.2 | 8fd5_A | DAGLSEFHIKMNPQRTVY |
COMPBIAS /note="Polar residues" REGION /note="Disordered" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
23 | S | S | e | 99.2 | 8fd5_A | SQGIALDEFHKMNPRTVY |
COMPBIAS /note="Polar residues" REGION /note="Disordered" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
24 | T | e | 27.3 | 8fd5_A | TSAGLDEFHIKMNPQRVY |
COMPBIAS /note="Polar residues" REGION /note="Disordered" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
25 | G | S | e | 44.0 | 8fd5_A | DENGALSFHIKMPQRTVY |
COMPBIAS /note="Polar residues" REGION /note="Disordered" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
26 | S | e | 37.5 | 8fd5_A | SRTNAGLDEFHIKMPQVY |
COMPBIAS /note="Polar residues" REGION /note="Disordered" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
27 | N | e | 70.3 | 8fd5_A | NGEALSDFHIKMPQRTVY |
COMPBIAS /note="Polar residues" REGION /note="Disordered" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
28 | Q | T | e | 61.2 | 8fd5_A | QRLAGSVDEFIKNPTCHMWY |
COMPBIAS /note="Polar residues" REGION /note="Disordered" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
29 | N | T | e | 24.8 | 8fd5_A | NDALEGIKPRSTVCFHMQY |
COMPBIAS /note="Polar residues" REGION /note="Disordered" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
30 | G | T | e | 59.5 | 8fd5_A | GNSALDEIKPRTVCFHMQY |
COMPBIAS /note="Polar residues" REGION /note="Disordered" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
31 | E | T | e | 92.0 | 8fd5_A | GNQEALDIKPRSTVCFHMY |
COMPBIAS /note="Polar residues" REGION /note="Disordered" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
32 | R | e | 56.9 | 8fd5_A | RNLAGSDEFIKPQTVY |
COMPBIAS /note="Polar residues" REGION /note="Disordered" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
33 | S | e | 84.4 | 8fd5_A | SRNAGLDEFIKPQTVY |
COMPBIAS /note="Polar residues" REGION /note="Disordered" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
34 | G | e | 81.0 | 8fd5_A | GRALSDEFIKNPQTVY |
REGION /note="Disordered" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
35 | A | e | 79.5 | 8fd5_A | ARGLSDEFIKNPQTVY |
REGION /note="Disordered" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
36 | R | e | 62.1 | 8fd5_A | RPAGLDEFIKNQSTVY |
REGION /note="Disordered" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
37 | S | e | 102.3 | 8fd5_A | PGNRSALDEFIKQTVY |
REGION /note="Disordered" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
38 | K | e | 66.0 | 8fd5_A | KRQTAGLDEFINPSVY |
REGION /note="Disordered" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
39 | Q | e | 33.7 | 8fd5_A | NQPKAGLDEFIRSTVY |
REGION /note="Disordered" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
40 | R | S | e | 53.0 | 8fd5_A | RPKE |
REGION /note="Disordered" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
41 | R | S | e | 32.0 | 8fd5_A | KQRP |
REGION /note="Disordered" REGION /note="RNA-binding" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="RNA-binding" | ||
42 | P | e | 54.3 | 8fd5_A | PT |
REGION /note="Disordered" REGION /note="RNA-binding" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="RNA-binding" | |||
43 | Q | T | e | 57.7 | 8fd5_A | QKAR |
REGION /note="Disordered" REGION /note="RNA-binding" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="RNA-binding" | ||
44 | G | T | e | 58.3 | 8fd5_A | GAVTPELS |
REGION /note="Disordered" REGION /note="RNA-binding" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="RNA-binding" | ||
45 | L | e | 45.5 | 8fd5_A | AGNLTESV |
REGION /note="Disordered" REGION /note="RNA-binding" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="RNA-binding" | |||
46 | P | e | 65.1 | 8fd5_A | homo | PSQT |
REGION /note="Disordered" REGION /note="RNA-binding" REGION /note="Disordered" REGION /note="RNA-binding" | ||
47 | N | e | 22.4 | 8fd5_A | homo | NPSI |
REGION /note="Disordered" REGION /note="RNA-binding" REGION /note="Disordered" REGION /note="RNA-binding" | ||
48 | N | b | 12.1 | 8fd5_A | compound DJU U2H homo | NGPQT |
REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
49 | T | e | 61.0 | 8fd5_A | nucleotide homo precipitant | TNHS |
REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
50 | A | e | 56.2 | 8fd5_A | nucleotide homo precipitant | AVYG |
REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
51 | S | b | 18.8 | 8fd5_A | homo precipitant | S |
REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
52 | W | e | 47.0 | 8fd5_A | hetero compound DJU U2H metal IOD homo precipitant | W |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
53 | F | b | 16.3 | 8fd5_A | homo | FY |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
54 | T | b | 1.3 | 8fd5_A | homo precipitant | QSTA |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
55 | A | b | 18.8 | 8fd5_A | homo precipitant | GASP |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
56 | L | E | b | 0.6 | 8fd5_A | hetero homo precipitant | IL |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
57 | T | E | b | 7.8 | 8fd5_A | hetero R1A_SARS2 nucleotide metal CL homo precipitant | TKV |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
58 | Q | b | 5.1 | 8fd5_A | hetero R1A_SARS2 homo | QAKE |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
59 | H | S | b | 12.6 | 8fd5_A | hetero R1A_SARS2 metal ZN CL homo precipitant | FHLTKNADEGIPQRSV |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
60 | G | S | e | 31.0 | 8fd5_A | homo precipitant | QGNALSDEFIKMPRTVY |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
61 | K | e | 93.4 | 8fd5_A | nucleotide homo precipitant | KSAGLV |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
62 | E | e | 57.8 | 8fd5_A | homo precipitant | KPAELRNQVH |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
63 | D | e | 58.6 | 8fd5_A | nucleotide homo | EPDKNQR |
REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
64 | L | b | 5.1 | 8fd5_A | homo | LFPTIV |
REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
65 | K | e | 62.3 | 8fd5_A | hetero nucleotide metal IOD homo precipitant | KQRAENPGT |
REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
66 | F | b | 18.2 | 8fd5_A | hetero metal IOD homo precipitant | FSPTQ |
REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
67 | P | e | 69.0 | 8fd5_A | hetero metal IOD homo precipitant | PASVDEFGIKLNQRT |
REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
68 | R | S | e | 73.1 | 8fd5_A | hetero compound U2H homo precipitant | ERPQDKG |
MUTAGEN /note="R->E: No effect on RNA-binding." REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" MUTAGEN /note="R->E: No effect on RNA-binding." REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
69 | G | S | e | 51.2 | 8fd5_A | hetero homo | G |
REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
70 | Q | S | e | 28.1 | 8fd5_A | hetero homo | QSE |
REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
71 | G | b | 2.4 | 8fd5_A | homo | G |
REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
72 | V | S | b | 6.0 | 8fd5_A | homo precipitant | V |
REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
73 | P | b | 2.3 | 8fd5_A | homo precipitant | P |
REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
74 | I | e | 35.1 | 8fd5_A | hetero homo precipitant | IDLTV |
REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
75 | N | b | 6.1 | 8fd5_A | hetero compound DJU U2H homo precipitant | NAKS |
REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
76 | T | T | e | 31.2 | 8fd5_A | hetero homo precipitant | EKNAPIQSTFY |
REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
77 | N | T | b | 15.8 | 8fd5_A | hetero compound DJU U2H metal CL homo precipitant | GNK |
REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
78 | S | T | b | 0.8 | 8fd5_A | hetero metal CL homo precipitant | IVLSNDF |
REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
79 | S | b | 13.3 | 8fd5_A | hetero metal ZN CL homo precipitant | KPTDGS |
REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
80 | P | S | e | 41.1 | 8fd5_A | hetero homo precipitant | PATSKLGDEFINQRVY |
REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
81 | D | S | e | 96.9 | 8fd5_A | hetero homo | SDTANQG |
REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
82 | D | b | 5.6 | 8fd5_A | hetero metal ZN CL homo | QEYDFK |
REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
83 | Q | b | 1.5 | 8fd5_A | homo precipitant | QANEL |
REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
84 | I | b | 8.8 | 8fd5_A | hetero homo precipitant | IHKA |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
85 | G | E | b | 1.2 | 8fd5_A | homo | G |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
86 | Y | E | b | 2.2 | 8fd5_A | homo | Y |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
87 | Y | E | b | 1.3 | 8fd5_A | homo | WY |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
88 | R | E | b | 6.7 | 8fd5_A | hetero R1A_SARS2 nucleotide metal IOD homo precipitant | RNYLKVF |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
89 | R | E | e | 48.2 | 8fd5_A | nucleotide homo | REKAGLSV |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
90 | A | b | 2.7 | 8fd5_A | hetero R1A_SARS2 nucleotide homo | QHVTA |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
91 | T | e | 55.8 | 8fd5_A | hetero R1A_SARS2 nucleotide homo | QANTDISL |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
92 | R | S | e | 69.6 | 8fd5_A | hetero R1A_SARS2 nucleotide homo precipitant | REHKT |
BINDING /ligand="RNA" /ligand_id="ChEBI:CHEBI:33697" ECO:0007744|PDB:7ACS, ECO:0007744|PDB:7ACT" MUTAGEN /note="R->E: Complete loss of RNA-binding." DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" BINDING /ligand="RNA" /ligand_id="ChEBI:CHEBI:33697" ECO:0007744|PDB:7ACS, ECO:0007744|PDB:7ACT" MUTAGEN /note="R->E: Complete loss of RNA-binding." DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
93 | R | e | 50.2 | 8fd5_A | nucleotide homo | RKSFYLADEGPTVCHIMNQ |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
94 | I | e | 53.8 | 8fd5_A | hetero R1A_SARS2 nucleotide homo | FYIMVWK |
MUTAGEN /note="I->A: Partial loss of RNA-binding." DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" MUTAGEN /note="I->A: Partial loss of RNA-binding." DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
95 | R | e | 59.3 | 8fd5_A | hetero R1A_SARS2 nucleotide metal IOD homo | KRNQP |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
96 | G | S | e | 35.7 | 8fd5_A | hetero R1A_SARS2 homo precipitant | TPMGRKSI |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
97 | G | e | 25.0 | 8fd5_A | hetero R1A_SARS2 nucleotide homo precipitant | GVPARSK |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
98 | D | e | 29.0 | 8fd5_A | nucleotide homo precipitant | KDRNESAGL |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
99 | G | S | e | 83.3 | 8fd5_A | nucleotide homo | GKAELSV |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
100 | K | S | e | 87.3 | 8fd5_A | nucleotide homo | QGKRNPADEILSTV |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
101 | M | G | e | 60.4 | 8fd5_A | homo | RQIVMTH |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
102 | K | G | e | 96.2 | 8fd5_A | nucleotide homo precipitant | KVREP |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
103 | D | G | e | 66.7 | 8fd5_A | homo | QPDELNS |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
104 | L | S | b | 1.7 | 8fd5_A | hetero R1A_SARS2 nucleotide homo | LVAP |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
105 | S | b | 9.4 | 8fd5_A | hetero R1A_SARS2 homo | PLASN |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
106 | P | e | 21.7 | 8fd5_A | hetero R1A_SARS2 homo | PDESAGLV |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
107 | R | E | b | 19.0 | 8fd5_A | hetero R1A_SARS2 nucleotide homo precipitant | RAKN |
BINDING /ligand="RNA" /ligand_id="ChEBI:CHEBI:33697" ECO:0007744|PDB:7ACS, ECO:0007744|PDB:7ACT" MUTAGEN /note="R->E: Complete loss of RNA-binding." DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" BINDING /ligand="RNA" /ligand_id="ChEBI:CHEBI:33697" ECO:0007744|PDB:7ACS, ECO:0007744|PDB:7ACT" MUTAGEN /note="R->E: Complete loss of RNA-binding." DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
108 | W | E | b | 1.6 | 8fd5_A | homo | WLV |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
109 | Y | E | e | 30.9 | 8fd5_A | hetero R1A_SARS2 nucleotide homo precipitant | YFH |
MUTAGEN /note="Y->A: Significant decrease of RNA binding capacity." DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" MUTAGEN /note="Y->A: Significant decrease of RNA binding capacity." DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
110 | F | E | b | 4.3 | 8fd5_A | homo | F |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
111 | Y | E | b | 2.6 | 8fd5_A | nucleotide metal IOD homo precipitant | Y |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
112 | Y | E | b | 4.8 | 8fd5_A | homo | YF |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
113 | L | T | b | 2.8 | 8fd5_A | hetero homo | LT |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
114 | G | T | b | 0.0 | 8fd5_A | hetero homo | G |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
115 | T | b | 11.0 | 8fd5_A | homo | T |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
116 | G | S | b | 2.4 | 8fd5_A | homo precipitant | G |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
117 | P | S | e | 24.0 | 8fd5_A | hetero nucleotide homo precipitant | PR |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
118 | E | T | e | 62.8 | 8fd5_A | homo | HAEFY |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
119 | A | T | e | 75.9 | 8fd5_A | hetero homo | AGKS |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
120 | G | b | 15.5 | 8fd5_A | hetero homo | DGNKSA |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
121 | L | e | 35.4 | 8fd5_A | hetero homo | LADSH |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
122 | P | S | e | 33.3 | 8fd5_A | hetero homo precipitant | KNPRQEST |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
123 | Y | S | e | 40.0 | 8fd5_A | hetero homo precipitant | FYW |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
124 | G | S | b | 1.2 | 8fd5_A | hetero compound DJU U2H homo | GRK |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
125 | A | e | 23.2 | 8fd5_A | hetero metal CL homo | DTEQASKY |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
126 | N | S | e | 84.2 | 8fd5_A | hetero metal CL homo precipitant | SKRDNVAT |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
127 | K | S | e | 76.9 | 8fd5_A | homo precipitant | QIKLNTVSH |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
128 | D | S | e | 22.2 | 8fd5_A | nucleotide homo precipitant | DEPA |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
129 | G | E | e | 39.3 | 8fd5_A | homo | GD |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
130 | I | E | b | 11.1 | 8fd5_A | homo | VI |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
131 | I | e | 26.9 | 8fd5_A | homo precipitant | VFIC |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
132 | W | e | 49.0 | 8fd5_A | homo precipitant | W |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
133 | V | e | 22.0 | 8fd5_A | homo | V |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
134 | A | b | 17.0 | 8fd5_A | hetero homo | AGHKYS |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
135 | T | e | 26.0 | 8fd5_A | hetero homo precipitant | AKSNEQRTIVG |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
136 | E | T | e | 55.8 | 8fd5_A | hetero homo | KEDNQHGS |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
137 | G | T | e | 79.8 | 8fd5_A | hetero homo | GQD |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
138 | A | b | 6.2 | 8fd5_A | hetero homo | AS |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
139 | L | e | 38.2 | 8fd5_A | hetero homo precipitant | DMKTVLNIE |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
140 | N | b | 7.9 | 8fd5_A | hetero homo precipitant | TNVDIS |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
141 | T | b | 19.5 | 8fd5_A | hetero homo precipitant | KTEANSQR |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
142 | P | e | 35.7 | 8fd5_A | hetero homo | PSTRFKI |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
143 | K | e | 41.5 | 8fd5_A | homo | TRSAKLIP |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
144 | D | S | e | 23.5 | 8fd5_A | hetero metal CL homo | STDGANELV |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
145 | H | T | e | 33.5 | 8fd5_A | hetero metal ZN CL homo | NDVHGYTLAEIKPRSCFMQ |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
146 | I | T | b | 8.8 | 8fd5_A | hetero compound DJU U2H metal ZN CL homo precipitant | LIQFVMY |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
147 | G | T | b | 14.3 | 8fd5_A | homo | GVSLA |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
148 | T | S | b | 9.7 | 8fd5_A | homo | TVESDNA |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
149 | R | e | 41.5 | 8fd5_A | hetero homo | R |
BINDING /ligand="RNA" /ligand_id="ChEBI:CHEBI:33697" ECO:0007744|PDB:7ACS, ECO:0007744|PDB:7ACT" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" BINDING /ligand="RNA" /ligand_id="ChEBI:CHEBI:33697" ECO:0007744|PDB:7ACS, ECO:0007744|PDB:7ACT" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
150 | N | e | 35.2 | 8fd5_A | hetero compound DJU U2H metal IOD homo | DGNKR |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
151 | P | T | e | 104.7 | 8fd5_A | hetero nucleotide homo precipitant | PSAKLDEFGINQRTVY |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
152 | A | T | e | 60.7 | 8fd5_A | hetero nucleotide compound DJU homo precipitant | SDATN |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
153 | N | S | e | 26.1 | 8fd5_A | hetero metal IOD homo precipitant | NKSEIT |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
154 | N | e | 49.1 | 8fd5_A | hetero metal IOD homo precipitant | NFDHEKQ |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
155 | A | S | e | 35.7 | 8fd5_A | hetero homo precipitant | EDPAGVS |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
156 | A | b | 1.8 | 8fd5_A | homo | AQSEI |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
157 | I | b | 1.2 | 8fd5_A | hetero homo precipitant | IYKA |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
158 | V | b | 4.0 | 8fd5_A | homo | PVA |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
159 | L | b | 0.0 | 8fd5_A | hetero homo | LTVHEC |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
160 | Q | b | 1.0 | 8fd5_A | hetero homo | RKQEP |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
161 | L | b | 3.4 | 8fd5_A | hetero homo | FLIT |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
162 | P | b | 12.4 | 8fd5_A | hetero homo precipitant | APSVTGLDEIKNRCFHMQY |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
163 | Q | S | b | 2.0 | 8fd5_A | hetero homo | PEDNGQALIKRSTVCFHMY |
MUTAGEN /note="Q->A: Partial loss of RNA-binding." DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" MUTAGEN /note="Q->A: Partial loss of RNA-binding." DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
164 | G | S | b | 3.6 | 8fd5_A | hetero homo | GDPAEFIKLNQRSTVY |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
165 | T | S | e | 23.4 | 8fd5_A | hetero homo | TGVNALDEFIKPQRSY |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
166 | T | e | 22.1 | 8fd5_A | hetero homo | KTVPILFAEGSCDHMNQRY |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
167 | L | b | 8.4 | 8fd5_A | hetero homo | LVINPDAGSEFKQRTY |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
168 | P | e | 42.6 | 8fd5_A | hetero metal IOD homo | PNGALSDEFIKQRTVY |
REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
169 | K | T | e | 67.0 | 8fd5_A | hetero nucleotide metal IOD homo precipitant | QKSGADPNLEFIRTVY |
REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
170 | G | T | e | 40.5 | 8fd5_A | hetero homo | GENSRQFALDIKPTVY |
REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
171 | F | b | 4.8 | 8fd5_A | hetero nucleotide homo | FYRNVADEGIKLPQST |
REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
172 | Y | B | b | 2.2 | 8fd5_A | hetero R1A_SARS2 nucleotide homo precipitant | YQHAENFWDGIKLPRSTV |
MUTAGEN /note="Y->A: Partial loss of RNA-binding." REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" MUTAGEN /note="Y->A: Partial loss of RNA-binding." REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
173 | A | b | 8.0 | 8fd5_A | hetero R1A_SARS2 nucleotide homo | LIVAERNSDFGKPQTY |
REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
174 | E | b | 1.5 | 8fd5_A | homo | EPRSWFADGIKLNQTVY |
MUTAGEN /note="E->R: Significant increase of RNA-binding." REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" MUTAGEN /note="E->R: Significant increase of RNA-binding." REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
175 | G | b | 7.1 | 8fd5_A | nucleotide homo | GDVRSIALEFKNPQTY |
REGION /note="Disordered" REGION /note="RNA-binding" REGION /note="Disordered" REGION /note="RNA-binding" | ||
176 | S | b | 14.8 | 8fd5_A | nucleotide | SNRTPFAEGKLV |
MOD_RES /note="Phosphoserine; by host" REGION /note="SR region" REGION /note="Disordered" REGION /note="RNA-binding" MOD_RES /note="Phosphoserine; by host" REGION /note="SR region" REGION /note="Disordered" REGION /note="RNA-binding" | ||
177 | R | e | 24.5 | 8fd5_A | nucleotide | GRDSQILAEFKNPTVY |
REGION /note="SR region" COMPBIAS /note="Polar residues" REGION /note="Disordered" REGION /note="RNA-binding" REGION /note="SR region" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="RNA-binding" | ||
178 | G | T | e | 84.5 | 8fd5_A | GRSALNDEFIKPQTVY |
REGION /note="SR region" COMPBIAS /note="Polar residues" REGION /note="Disordered" REGION /note="RNA-binding" REGION /note="SR region" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="RNA-binding" | ||
179 | G | T | e | 98.8 | 8fd5_A | GRNSQLTVADEIKP |
REGION /note="SR region" COMPBIAS /note="Polar residues" REGION /note="Disordered" REGION /note="RNA-binding" REGION /note="SR region" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="RNA-binding" | ||
180 | S | T | e | 28.9 | 8fd5_A | SGPANFDREKLTV |
REGION /note="SR region" COMPBIAS /note="Polar residues" REGION /note="Disordered" REGION /note="RNA-binding" REGION /note="SR region" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="RNA-binding" | ||
181 | Q | b | 6.6 | 8fd5_A | QRNDAPSL |
REGION /note="SR region" COMPBIAS /note="Polar residues" REGION /note="Disordered" REGION /note="RNA-binding" REGION /note="SR region" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="RNA-binding" | |||
182 | A | e | 70.5 | 8fd5_A | SGAVWNPR |
REGION /note="SR region" COMPBIAS /note="Polar residues" REGION /note="Disordered" REGION /note="RNA-binding" REGION /note="SR region" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="RNA-binding" | |||
183 | S | S | e | 46.9 | 8fd5_A | NSRQDGPA |
REGION /note="SR region" COMPBIAS /note="Polar residues" REGION /note="Disordered" REGION /note="RNA-binding" REGION /note="SR region" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="RNA-binding" | ||
184 | S | S | b | 14.1 | 8fd5_A | SFRNQD |
REGION /note="SR region" COMPBIAS /note="Polar residues" REGION /note="Disordered" REGION /note="RNA-binding" REGION /note="SR region" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="RNA-binding" | ||
185 | R | e | 57.3 | 8fd5_A | RSIN |
REGION /note="SR region" COMPBIAS /note="Polar residues" REGION /note="Disordered" REGION /note="RNA-binding" REGION /note="SR region" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="RNA-binding" | |||
186 | S | e | 26.6 | 8fd5_A | SGARWPNT |
REGION /note="SR region" COMPBIAS /note="Polar residues" REGION /note="Disordered" REGION /note="RNA-binding" REGION /note="SR region" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="RNA-binding" | |||
187 | S | b | 8.6 | 8fd5_A | SDRGQLNAT |
REGION /note="SR region" COMPBIAS /note="Polar residues" REGION /note="Disordered" REGION /note="SR region" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
188 | S | T | b | 9.4 | 8fd5_A | SNFRGAT |
MUTAGEN /note="S->A: No effect on phosphorylation." REGION /note="SR region" COMPBIAS /note="Polar residues" REGION /note="Disordered" MUTAGEN /note="S->A: No effect on phosphorylation." REGION /note="SR region" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
189 | R | T | e | 41.9 | 8fd5_A | RSIEKPQTNV |
REGION /note="SR region" COMPBIAS /note="Polar residues" REGION /note="Disordered" REGION /note="SR region" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
190 | S | S | e | 39.1 | 8fd5_A | SPRQGA |
REGION /note="SR region" COMPBIAS /note="Polar residues" REGION /note="Disordered" REGION /note="SR region" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
191 | R | e | 36.8 | 8fd5_A | RSQLAKNIP |
REGION /note="SR region" COMPBIAS /note="Polar residues" REGION /note="Disordered" REGION /note="SR region" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
192 | N | e | 24.8 | 8fd5_A | NSRAPEGQH |
REGION /note="SR region" COMPBIAS /note="Polar residues" REGION /note="Disordered" REGION /note="SR region" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
193 | S | S | e | 82.8 | 8fd5_A | RSQGNV |
REGION /note="SR region" COMPBIAS /note="Polar residues" REGION /note="Disordered" REGION /note="SR region" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
194 | S | e | 42.2 | 8fd5_A | SGPQRNK |
REGION /note="SR region" COMPBIAS /note="Polar residues" REGION /note="Disordered" REGION /note="SR region" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
195 | R | S | e | 83.4 | 8fd5_A | RNSPAGQ |
REGION /note="SR region" COMPBIAS /note="Polar residues" REGION /note="Disordered" REGION /note="SR region" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
196 | N | S | b | 9.7 | 8fd5_A | NSRAGTP |
REGION /note="SR region" COMPBIAS /note="Polar residues" REGION /note="Disordered" REGION /note="SR region" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
197 | S | b | 14.1 | 8fd5_A | RSGNQPAKL |
REGION /note="SR region" COMPBIAS /note="Polar residues" REGION /note="Disordered" REGION /note="SR region" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
198 | T | b | 1.3 | 8fd5_A | SRATKNL |
REGION /note="SR region" COMPBIAS /note="Polar residues" REGION /note="Disordered" REGION /note="SR region" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
199 | P | b | 2.3 | 8fd5_A | RSPGQADELV |
REGION /note="SR region" COMPBIAS /note="Polar residues" REGION /note="Disordered" REGION /note="SR region" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
200 | G | b | 4.8 | 8fd5_A | SGTRDAE |
REGION /note="SR region" COMPBIAS /note="Polar residues" REGION /note="Disordered" REGION /note="SR region" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
201 | S | b | 10.9 | 8fd5_A | SNAQLRVG |
REGION /note="SR region" COMPBIAS /note="Polar residues" REGION /note="Disordered" REGION /note="SR region" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
202 | S | S | e | 64.8 | 8fd5_A | SADRNTVGL |
REGION /note="SR region" COMPBIAS /note="Polar residues" REGION /note="Disordered" REGION /note="SR region" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
203 | R | S | e | 53.8 | 8fd5_A | RSN |
MUTAGEN /note="R->M: No effect on virus replication ex vivo." MUTAGEN /note="RG->KR: Partial increase of pathogenesis and fitness in vivo. No effect on virus replication ex vivo." REGION /note="SR region" COMPBIAS /note="Polar residues" REGION /note="Disordered" MUTAGEN /note="R->M: No effect on virus replication ex vivo." MUTAGEN /note="RG->KR: Partial increase of pathogenesis and fitness in vivo. No effect on virus replication ex vivo." REGION /note="SR region" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
204 | G | b | 9.5 | 8fd5_A | GSQNAT |
MUTAGEN /note="RG->KR: Partial increase of pathogenesis and fitness in vivo. No effect on virus replication ex vivo." REGION /note="SR region" COMPBIAS /note="Polar residues" REGION /note="Disordered" MUTAGEN /note="RG->KR: Partial increase of pathogenesis and fitness in vivo. No effect on virus replication ex vivo." REGION /note="SR region" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
205 | T | e | 65.6 | 8fd5_A | RNASTHVL |
REGION /note="SR region" COMPBIAS /note="Polar residues" REGION /note="Disordered" REGION /note="SR region" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
206 | S | b | 11.7 | 8fd5_A | SAQNRHETDGIKLPV |
MOD_RES /note="Phosphoserine; by host GSK3-alpha and GSK3-beta" MUTAGEN /note="S->A: Partial loss of phosphorylation." REGION /note="SR region" COMPBIAS /note="Polar residues" REGION /note="Disordered" MOD_RES /note="Phosphoserine; by host GSK3-alpha and GSK3-beta" MUTAGEN /note="S->A: Partial loss of phosphorylation." REGION /note="SR region" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
207 | P | S | e | 72.9 | 8fd5_A | PSGNQRHADEIKLTV |
COMPBIAS /note="Polar residues" REGION /note="Disordered" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
208 | A | e | 49.1 | 8fd5_A | SAGNQRFVTDEIKLP |
COMPBIAS /note="Polar residues" REGION /note="Disordered" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
209 | R | S | e | 54.5 | 8fd5_A | RSQDNGKV |
REGION /note="Disordered" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
210 | M | S | e | 21.7 | 8fd5_A | TAPQHMDGEIRNVKL |
REGION /note="Disordered" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
211 | A | S | b | 8.0 | 8fd5_A | ASPVGDIQFL |
REGION /note="Disordered" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
212 | G | S | b | 2.4 | 8fd5_A | SNKDGAMTPVEILQR |
REGION /note="Disordered" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
213 | N | S | e | 49.7 | 8fd5_A | NRPDSQKGVHAL |
DISORDER predicted by DISOPRED | ||
214 | G | S | b | 15.5 | 8fd5_A | GDEKSALPNVT |
DISORDER predicted by DISOPRED | ||
215 | G | T | e | 26.2 | 8fd5_A | GVKMRSIAEDPLT |
DISORDER predicted by DISOPRED | ||
216 | D | T | e | 48.1 | 8fd5_A | hetero A0A6M4N019_SARS2 | DASETVRQ |
DISORDER predicted by DISOPRED | |
217 | A | T | b | 2.7 | 8fd5_A | ADRESTMLP |
DISORDER predicted by DISOPRED | ||
218 | A | T | b | 2.7 | 8fd5_A | AGSLEIPRTVD |
|||
219 | L | T | b | 14.0 | 8fd5_A | IVLRAWSTYM |
|||
220 | A | H | b | 0.0 | 8fd5_A | hetero A0A6M4N019_SARS2 | AKERLDM |
||
221 | L | H | b | 6.7 | 8fd5_A | SADQLKPIVR |
|||
222 | L | H | b | 6.2 | 8fd5_A | hetero A0A6M4N019_SARS2 | LADGIVYPQ |
||
223 | L | H | b | 11.2 | 8fd5_A | hetero A0A6M4N019_SARS2 | VLAGMISK |
||
224 | L | H | b | 0.0 | 8fd5_A | hetero A0A6M4N019_SARS2 | LAEQVFIKG |
||
225 | D | H | b | 17.3 | 8fd5_A | DAEQKLS |
|||
226 | R | H | b | 5.5 | 8fd5_A | hetero A0A6M4N019_SARS2 | KDRALVEGTS |
||
227 | L | H | b | 1.1 | 8fd5_A | hetero A0A6M4N019_SARS2 | LPKVAIEQGS |
||
228 | N | H | b | 11.5 | 8fd5_A | hetero A0A6M4N019_SARS2 | GKAIDNQELFPRSTVY |
||
229 | Q | H | e | 24.5 | 8fd5_A | hetero A0A6M4N019_SARS2 | KARVQEDSTNLFGIPY |
DISORDER predicted by DISOPRED | |
230 | L | H | b | 1.1 | 8fd5_A | LRKDGITEQAFNPSVY |
DISORDER predicted by DISOPRED | ||
231 | E | H | b | 2.0 | 8fd5_A | AEDKQILGPRSTVCFHMNY |
DISORDER predicted by DISOPRED | ||
232 | S | H | b | 11.7 | 8fd5_A | ASGKTQDRELVCFHIMNPY |
DISORDER predicted by DISOPRED | ||
233 | K | H | e | 42.0 | 8fd5_A | KQLVGSADEFINPRTY |
COMPBIAS /note="Polar residues" REGION /note="Disordered" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
234 | M | b | 11.1 | 8fd5_A | RDIVPESGLMAFHKNQTY |
COMPBIAS /note="Polar residues" REGION /note="Disordered" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
235 | S | b | 14.1 | 8fd5_A | ASIDLEGKPRTVCFHMNQY |
COMPBIAS /note="Polar residues" REGION /note="Disordered" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
236 | G | e | 20.2 | 8fd5_A | GKRTDLAESVFINPQCHMWY |
COMPBIAS /note="Polar residues" REGION /note="Disordered" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
237 | K | T | e | 99.1 | 8fd5_A | QKSELTVRADFGINPY |
COMPBIAS /note="Polar residues" REGION /note="Disordered" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
238 | G | T | e | 90.5 | 8fd5_A | GDPKNSVAEFILQRT |
COMPBIAS /note="Polar residues" REGION /note="Disordered" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
239 | Q | b | 14.8 | 8fd5_A | QKSPATNL |
COMPBIAS /note="Polar residues" REGION /note="Disordered" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
240 | Q | S | e | 104.1 | 8fd5_A | QKDTERSPL |
COMPBIAS /note="Polar residues" REGION /note="Disordered" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
241 | Q | e | 60.7 | 8fd5_A | KQESRTADFGILNPVY |
COMPBIAS /note="Polar residues" REGION /note="Disordered" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
242 | Q | b | 11.2 | 8fd5_A | hetero A0A6M4N019_SARS2 | KRQSNHPADEFGILTVY |
COMPBIAS /note="Polar residues" REGION /note="Disordered" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
243 | G | b | 13.1 | 8fd5_A | hetero A0A6M4N019_SARS2 | GPSAQLDEFIKNRTVY |
COMPBIAS /note="Polar residues" REGION /note="Disordered" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
244 | Q | b | 12.2 | 8fd5_A | hetero A0A6M4N019_SARS2 | SKQNVDAREGILPT |
COMPBIAS /note="Polar residues" REGION /note="Disordered" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
245 | T | e | 83.1 | 8fd5_A | RSQNVTADEGIKLP |
COMPBIAS /note="Polar residues" REGION /note="Disordered" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
246 | V | b | 15.3 | 8fd5_A | hetero A0A6M4N019_SARS2 | VIKTLAS |
COMPBIAS /note="Polar residues" REGION /note="Disordered" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
247 | T | e | 40.9 | 8fd5_A | hetero A0A6M4N019_SARS2 | TPSACR |
COMPBIAS /note="Polar residues" REGION /note="Disordered" DOMAIN /note="CoV N CTD" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" DOMAIN /note="CoV N CTD" | ||
248 | K | S | e | 71.2 | 8fd5_A | KRS |
COMPBIAS /note="Polar residues" REGION /note="Disordered" DOMAIN /note="CoV N CTD" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" DOMAIN /note="CoV N CTD" | ||
249 | K | e | 82.1 | 8fd5_A | QKADNSEV |
COMPBIAS /note="Polar residues" REGION /note="Disordered" DOMAIN /note="CoV N CTD" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" DOMAIN /note="CoV N CTD" | |||
250 | S | e | 33.6 | 8fd5_A | hetero A0A6M4N019_SARS2 | KSTNDQER |
COMPBIAS /note="Polar residues" REGION /note="Disordered" DOMAIN /note="CoV N CTD" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" DOMAIN /note="CoV N CTD" | ||
251 | A | S | e | 100.0 | 8fd5_A | hetero A0A6M4N019_SARS2 | ASTK |
COMPBIAS /note="Polar residues" REGION /note="Disordered" DOMAIN /note="CoV N CTD" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" DOMAIN /note="CoV N CTD" | |
252 | A | S | e | 35.7 | 8fd5_A | KADPSNEQ |
REGION /note="Disordered" DOMAIN /note="CoV N CTD" DISORDER predicted by DISOPRED REGION /note="Disordered" DOMAIN /note="CoV N CTD" | ||
253 | E | G | e | 59.3 | 8fd5_A | EAKRS |
REGION /note="Disordered" DOMAIN /note="CoV N CTD" DISORDER predicted by DISOPRED REGION /note="Disordered" DOMAIN /note="CoV N CTD" | ||
254 | A | G | b | 12.5 | 8fd5_A | hetero A0A6M4N019_SARS2 | AMNVITSK |
REGION /note="Disordered" DOMAIN /note="CoV N CTD" DISORDER predicted by DISOPRED REGION /note="Disordered" DOMAIN /note="CoV N CTD" | |
255 | S | G | b | 10.9 | 8fd5_A | hetero A0A6M4N019_SARS2 compound GTP | ARKETNS |
REGION /note="Disordered" DOMAIN /note="CoV N CTD" DISORDER predicted by DISOPRED REGION /note="Disordered" DOMAIN /note="CoV N CTD" | |
256 | K | G | e | 29.2 | 8fd5_A | metal CL precipitant | HQNESKDR |
MOTIF /note="Nuclear localization signal" REGION /note="Disordered" DOMAIN /note="CoV N CTD" MOTIF /note="Nuclear localization signal" DISORDER predicted by DISOPRED REGION /note="Disordered" DOMAIN /note="CoV N CTD" | |
257 | K | S | e | 32.1 | 8fd5_A | metal CL precipitant | KR |
MOTIF /note="Nuclear localization signal" REGION /note="Disordered" DOMAIN /note="CoV N CTD" MOTIF /note="Nuclear localization signal" DISORDER predicted by DISOPRED REGION /note="Disordered" DOMAIN /note="CoV N CTD" | |
258 | P | b | 6.2 | 8fd5_A | homo precipitant | PRHMLTK |
MOTIF /note="Nuclear localization signal" REGION /note="Disordered" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" MOTIF /note="Nuclear localization signal" REGION /note="Disordered" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | ||
259 | R | G | b | 5.1 | 8fd5_A | compound GTP 5GP GUN GMP metal CL homo precipitant | RYTE |
MOTIF /note="Nuclear localization signal" REGION /note="Disordered" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" MOTIF /note="Nuclear localization signal" REGION /note="Disordered" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
260 | Q | G | e | 28.6 | 8fd5_A | homo precipitant | WQCHD |
MOTIF /note="Nuclear localization signal" REGION /note="Disordered" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" MOTIF /note="Nuclear localization signal" REGION /note="Disordered" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
261 | K | G | e | 59.4 | 8fd5_A | homo precipitant | KR |
MOTIF /note="Nuclear localization signal" REGION /note="Disordered" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" MOTIF /note="Nuclear localization signal" REGION /note="Disordered" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
262 | R | b | 6.3 | 8fd5_A | compound GTP metal CL homo precipitant | RK |
MOTIF /note="Nuclear localization signal" REGION /note="Disordered" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" MOTIF /note="Nuclear localization signal" REGION /note="Disordered" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | ||
263 | T | e | 59.1 | 8fd5_A | metal CL K homo precipitant | TSQVIA |
MOTIF /note="Nuclear localization signal" REGION /note="Disordered" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" MOTIF /note="Nuclear localization signal" REGION /note="Disordered" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | ||
264 | A | b | 6.2 | 8fd5_A | homo precipitant | PAISV |
MOTIF /note="Nuclear localization signal" REGION /note="Disordered" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" MOTIF /note="Nuclear localization signal" REGION /note="Disordered" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | ||
265 | T | B | e | 40.3 | 8fd5_A | NPGTHKSA |
REGION /note="Disordered" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Disordered" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | ||
266 | K | T | e | 70.3 | 8fd5_A | metal CL precipitant | KPGD |
REGION /note="Disordered" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Disordered" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
267 | A | T | e | 80.4 | 8fd5_A | GQDENSAFH |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | ||
268 | Y | B | b | 1.7 | 8fd5_A | metal CL precipitant | YCFVENSKLADGIPQRT |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
269 | N | e | 29.7 | 8fd5_A | compound GKP metal CL | NDKPSTRG |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | ||
270 | V | H | b | 2.7 | 8fd5_A | homo precipitant | VIM |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
271 | T | H | b | 18.2 | 8fd5_A | compound GKP metal K | TDQEVA |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
272 | Q | H | b | 19.4 | 8fd5_A | metal CL | QVKRAET |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
273 | A | H | b | 1.8 | 8fd5_A | CVFAN |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | ||
274 | F | S | e | 21.1 | 8fd5_A | homo precipitant | FY |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
275 | G | b | 14.3 | 8fd5_A | metal CL precipitant | GL |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | ||
276 | R | S | b | 17.4 | 8fd5_A | compound GKP metal K CL precipitant | PKARLQM |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
277 | R | b | 9.5 | 8fd5_A | compound GKP metal K homo precipitant | RL |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | ||
278 | G | S | e | 25.0 | 8fd5_A | homo | GSTR |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
279 | P | S | e | 92.2 | 8fd5_A | hetero homo | PGKTALSDEINQRVCFHMY |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
280 | E | e | 26.6 | 8fd5_A | hetero homo | KGNREFTLSADIPQVY |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | ||
281 | Q | S | e | 43.9 | 8fd5_A | hetero homo precipitant | QGDPKRCLAEFINSTVY |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
282 | T | S | b | 3.2 | 8fd5_A | hetero compound GTP 5GP GUN GMP homo precipitant | LKSATDEGIPRVCFHMNQY |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
283 | Q | S | b | 3.1 | 8fd5_A | homo | ESQDPALGIKRTVCFHMNY |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
284 | G | b | 9.5 | 8fd5_A | homo | GAHSLDEIKNPQRTVCFMY |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | ||
285 | N | S | e | 38.2 | 8fd5_A | homo | N |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
286 | F | B | b | 12.0 | 8fd5_A | homo precipitant | F |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
287 | G | b | 1.2 | 8fd5_A | G |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |||
288 | D | b | 3.7 | 8fd5_A | precipitant | DGSN |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | ||
289 | Q | H | b | 2.0 | 8fd5_A | compound GKP precipitant | SDAGMQRPLT |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
290 | E | H | b | 10.1 | 8fd5_A | precipitant | EKDGQN |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
291 | L | H | b | 1.7 | 8fd5_A | precipitant | MLFVY |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
292 | I | H | b | 15.8 | 8fd5_A | compound GKP | VNLI |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
293 | R | H | b | 18.2 | 8fd5_A | metal CL precipitant | KAER |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
294 | Q | H | e | 25.5 | 8fd5_A | metal CL precipitant | LNEKQF |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
295 | G | e | 22.6 | 8fd5_A | precipitant | G |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | ||
296 | T | T | b | 4.5 | 8fd5_A | metal CL homo precipitant | TIVNS |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
297 | D | T | e | 39.5 | 8fd5_A | precipitant | KSDNEGAT |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
298 | Y | b | 0.4 | 8fd5_A | precipitant | DAY |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | ||
299 | K | T | e | 52.8 | 8fd5_A | metal CL precipitant | PKGS |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
300 | H | T | b | 11.5 | 8fd5_A | metal CL precipitant | RQHGC |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
301 | W | H | b | 13.5 | 8fd5_A | metal CL homo precipitant | YFVWL |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
302 | P | H | e | 65.9 | 8fd5_A | metal NA | PTA |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
303 | Q | H | e | 24.5 | 8fd5_A | metal K NA CL precipitant | QAI |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
304 | I | H | b | 0.6 | 8fd5_A | homo | LMIAFT |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
305 | A | T | e | 22.3 | 8fd5_A | metal MG homo | AL |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
306 | Q | T | e | 55.1 | 8fd5_A | metal MG homo precipitant | ENSQ |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
307 | F | S | b | 0.5 | 8fd5_A | homo precipitant | LCFM |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
308 | A | S | e | 46.4 | 8fd5_A | metal MG homo precipitant | VAI |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
309 | P | e | 20.9 | 8fd5_A | homo precipitant | P |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | ||
310 | S | e | 58.6 | 8fd5_A | metal K CL homo precipitant | STNG |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | ||
311 | A | H | e | 36.6 | 8fd5_A | metal CL K homo precipitant | AVSPT |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
312 | S | H | e | 89.1 | 8fd5_A | metal K homo precipitant | SHGA |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
313 | A | H | e | 39.3 | 8fd5_A | homo | AS |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
314 | F | H | b | 6.2 | 8fd5_A | homo | FCILM |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
315 | F | T | e | 77.0 | 8fd5_A | homo precipitant | LFMI |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
316 | G | T | e | 58.3 | 8fd5_A | homo precipitant | FGSL |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
317 | M | T | e | 30.0 | 8fd5_A | compound GTP 5GP GUN GMP homo | GMDTA |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
318 | S | S | b | 11.7 | 8fd5_A | homo | SG |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
319 | R | e | 66.8 | 8fd5_A | hetero homo | RHKQNYM |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | ||
320 | I | e | 44.4 | 8fd5_A | hetero homo | VLWIF |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | ||
321 | G | E | e | 40.5 | 8fd5_A | hetero homo precipitant | TEAKSVGD |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
322 | M | E | e | 44.0 | 8fd5_A | hetero homo precipitant | LPASTVM |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
323 | E | E | e | 46.2 | 8fd5_A | hetero metal K precipitant | KERTVA |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
324 | V | e | 83.3 | 8fd5_A | metal K precipitant | ELPDKHVN |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | ||
325 | T | e | 21.4 | 8fd5_A | hetero precipitant | QDTSELMAGKRV |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | ||
326 | P | T | e | 41.9 | 8fd5_A | hetero | PGKADNESQL |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
327 | S | T | b | 6.2 | 8fd5_A | hetero homo | DSNP |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
328 | G | S | e | 44.0 | 8fd5_A | homo | GQVDTASE |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
329 | T | S | e | 33.8 | 8fd5_A | homo | YLIVTAN |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
330 | W | E | b | 7.2 | 8fd5_A | hetero compound GTP 5GP GUN GMP metal CL homo precipitant | EHFWVK |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
331 | L | E | b | 7.3 | 8fd5_A | homo | LVI |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
332 | T | E | b | 17.5 | 8fd5_A | hetero homo precipitant | TRKQHSL |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
333 | Y | b | 16.5 | 8fd5_A | hetero homo | YFLI |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | ||
334 | T | e | 47.4 | 8fd5_A | hetero homo | TSENKH |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | ||
335 | G | e | 50.0 | 8fd5_A | hetero homo precipitant | GFHYT |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | ||
336 | A | e | 32.1 | 8fd5_A | hetero compound GTP 5GP homo precipitant | AKTRSE |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | ||
337 | I | e | 22.2 | 8fd5_A | compound GTP 5GP GMP homo | ITYVM |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | ||
338 | K | e | 67.5 | 8fd5_A | compound GTP 5GP GUN GMP homo | VRKHTLY |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | ||
339 | L | e | 34.3 | 8fd5_A | homo | VLF |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | ||
340 | D | e | 56.8 | 8fd5_A | precipitant | PDSK |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | ||
341 | D | T | e | 69.1 | 8fd5_A | homo | KRSPDAC |
REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
342 | K | T | e | 83.5 | 8fd5_A | precipitant | DTKSEN |
REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
343 | D | S | e | 36.4 | 8fd5_A | precipitant | DLNHT |
REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
344 | P | T | e | 85.3 | 8fd5_A | PSK |
REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | ||
345 | N | T | e | 53.9 | 8fd5_A | precipitant | QNGHAEKLSTV |
REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
346 | F | H | b | 15.3 | 8fd5_A | homo | FYLADEGIKNPQRSTV |
REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
347 | K | H | e | 56.6 | 8fd5_A | EDKNLAGIPSTV |
REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | ||
348 | D | H | e | 21.0 | 8fd5_A | metal K NA precipitant | TNKDEQAFGILPRSV |
REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
349 | Q | H | b | 4.6 | 8fd5_A | metal K NA precipitant | YIWQEKNADGLPRSTV |
REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
350 | V | H | b | 14.7 | 8fd5_A | metal NA homo | VMTLQSADEGIKPR |
REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
351 | I | H | b | 17.0 | 8fd5_A | KEFIGSTADLPRV |
REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | ||
352 | L | H | b | 1.7 | 8fd5_A | precipitant | ILVQ |
REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
353 | L | H | e | 21.3 | 8fd5_A | homo | LCFADEGIKNPRSTV |
REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
354 | N | H | e | 24.2 | 8fd5_A | metal NA homo precipitant | DNELVAKRTGIPS |
REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
355 | K | H | e | 23.6 | 8fd5_A | metal CL precipitant | QEASK |
REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
356 | H | H | b | 3.1 | 8fd5_A | NCQH |
REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | ||
357 | I | B | e | 39.2 | 8fd5_A | homo precipitant | VIL |
REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
358 | D | T | e | 34.6 | 8fd5_A | homo precipitant | DN |
REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
359 | A | G | b | 4.5 | 8fd5_A | precipitant | AG |
REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
360 | Y | G | b | 3.5 | 8fd5_A | homo | YVFI |
REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
361 | K | G | e | 42.9 | 8fd5_A | KGQAV |
REGION /note="Disordered" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Disordered" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | ||
362 | T | G | b | 9.1 | 8fd5_A | precipitant | TRLDNSCIAEFGKPQV |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" DOMAIN /note="CoV N CTD" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" DOMAIN /note="CoV N CTD" | |
363 | F | S | b | 6.2 | 8fd5_A | compound GKP | RFGALSDEIKNPQTVCHMWY |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" DOMAIN /note="CoV N CTD" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" DOMAIN /note="CoV N CTD" | |
364 | P | T | e | 45.0 | 8fd5_A | compound GKP | PDAGLEKSTVFINQRYCHMW |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" DOMAIN /note="CoV N CTD" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" DOMAIN /note="CoV N CTD" | |
365 | P | T | e | 49.6 | 8fd5_A | PKAGLSDEINQRTVCFHMY |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" | ||
366 | T | T | e | 26.0 | 8fd5_A | STDKLAEGIPRVCFHMNQY |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" | ||
367 | E | S | e | 24.6 | 8fd5_A | EDPRLAGIKSTVCFHMNQY |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" | ||
368 | P | S | e | 108.5 | 8fd5_A | PVEQAGLDFIKNRSTY |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" COMPBIAS /note="Basic and acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
369 | K | e | 65.6 | 8fd5_A | KARPTGLSDEFIMNQVY |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" COMPBIAS /note="Basic and acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
370 | K | e | 76.4 | 8fd5_A | KPQSDAEGLTV |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" COMPBIAS /note="Basic and acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
371 | D | e | 35.8 | 8fd5_A | EDNPVRAGKLST |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" COMPBIAS /note="Basic and acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
372 | K | e | 59.0 | 8fd5_A | QKRSE |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" COMPBIAS /note="Basic and acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
373 | K | b | 9.4 | 8fd5_A | RKSDNPQA |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" COMPBIAS /note="Basic and acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
374 | K | T | e | 82.5 | 8fd5_A | KQGRSAPTD |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" COMPBIAS /note="Basic and acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
375 | K | T | e | 88.2 | 8fd5_A | RKGDAP |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" COMPBIAS /note="Basic and acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
376 | A | e | 38.4 | 8fd5_A | KASGTR |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" COMPBIAS /note="Basic and acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
377 | D | e | 98.1 | 8fd5_A | DSTK |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" COMPBIAS /note="Basic and acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
378 | E | e | 56.3 | 8fd5_A | RDEVSN |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" COMPBIAS /note="Basic and acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
379 | T | e | 49.4 | 8fd5_A | SVARDLMT |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" COMPBIAS /note="Basic and acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
380 | Q | e | 86.2 | 8fd5_A | SKQNAG |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" COMPBIAS /note="Basic and acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
381 | A | e | 45.5 | 8fd5_A | SPAT |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" COMPBIAS /note="Basic and acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
382 | L | S | e | 75.8 | 8fd5_A | AKLRVEGS |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" COMPBIAS /note="Basic and acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
383 | P | S | e | 25.6 | 8fd5_A | PEAL |
REGION /note="Disordered" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
384 | Q | e | 66.3 | 8fd5_A | QARDGL |
REGION /note="Disordered" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
385 | R | e | 32.8 | 8fd5_A | RTSKAGL |
REGION /note="Disordered" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
386 | Q | S | e | 32.1 | 8fd5_A | KQEPS |
REGION /note="Disordered" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
387 | K | e | 32.1 | 8fd5_A | RKQPG |
REGION /note="Disordered" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
388 | K | S | e | 94.3 | 8fd5_A | EGQKMRS |
REGION /note="Disordered" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
389 | Q | e | 64.3 | 8fd5_A | QERADFGIKLNPSTV |
REGION /note="Disordered" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
390 | Q | b | 17.9 | 8fd5_A | QRDLPAEFGIKNSTV |
REGION /note="Disordered" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
391 | T | e | 55.2 | 8fd5_A | TQVSDLAEFGIKNPRY |
REGION /note="Disordered" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
392 | V | S | e | 43.3 | 8fd5_A | VPLADEFGIKNQRSTY |
DISORDER predicted by DISOPRED | ||
393 | T | T | e | 37.0 | 8fd5_A | TAELDGKPSVCFHIMNQRY |
|||
394 | L | T | e | 92.1 | 8fd5_A | LVQADEGIKPRST |
|||
395 | L | b | 9.6 | 8fd5_A | VLKP |
||||
396 | P | e | 46.5 | 8fd5_A | PKE |
||||
397 | A | T | b | 9.8 | 8fd5_A | ADN |
|||
398 | A | T | b | 4.5 | 8fd5_A | ADS |
|||
399 | D | H | b | 16.7 | 8fd5_A | LDE |
SITE /note="Cleavage (by host CASP6)" SITE /note="Cleavage (by host CASP6)" | ||
400 | L | H | b | 1.1 | 8fd5_A | IVLM |
SITE /note="Cleavage (by host CASP6)" REGION /note="Tetramerization" SITE /note="Cleavage (by host CASP6)" REGION /note="Tetramerization" | ||
401 | D | H | b | 2.5 | 8fd5_A | DE |
SITE /note="Cleavage (by host CASP6)" REGION /note="Tetramerization" SITE /note="Cleavage (by host CASP6)" REGION /note="Tetramerization" | ||
402 | D | H | b | 17.3 | 8fd5_A | ND |
SITE /note="Cleavage (by host CASP6)" REGION /note="Tetramerization" SITE /note="Cleavage (by host CASP6)" REGION /note="Tetramerization" | ||
403 | F | H | e | 24.9 | 8fd5_A | YFV |
REGION /note="Tetramerization" REGION /note="Tetramerization" | ||
404 | S | H | b | 13.3 | 8fd5_A | ST |
REGION /note="Tetramerization" REGION /note="Tetramerization" | ||
405 | K | H | b | 6.1 | 8fd5_A | KR |
REGION /note="Tetramerization" REGION /note="Tetramerization" | ||
406 | Q | H | b | 19.4 | 8fd5_A | Q |
REGION /note="Tetramerization" REGION /note="Tetramerization" | ||
407 | L | H | e | 42.1 | 8fd5_A | L |
REGION /note="Tetramerization" REGION /note="Tetramerization" | ||
408 | Q | H | e | 40.8 | 8fd5_A | Q |
REGION /note="Tetramerization" REGION /note="Tetramerization" | ||
409 | Q | H | e | 24.5 | 8fd5_A | NQ |
REGION /note="Tetramerization" DISORDER predicted by DISOPRED REGION /note="Tetramerization" | ||
410 | S | H | e | 46.9 | 8fd5_A | S |
REGION /note="Tetramerization" DISORDER predicted by DISOPRED REGION /note="Tetramerization" | ||
411 | M | H | e | 52.7 | 8fd5_A | M |
REGION /note="Tetramerization" DISORDER predicted by DISOPRED REGION /note="Tetramerization" | ||
412 | S | H | b | 17.2 | 8fd5_A | S |
REGION /note="Tetramerization" DISORDER predicted by DISOPRED REGION /note="Tetramerization" | ||
413 | S | H | e | 36.7 | 8fd5_A | S |
REGION /note="Tetramerization" DISORDER predicted by DISOPRED REGION /note="Tetramerization" | ||
414 | A | H | e | 74.1 | 8fd5_A | A |
REGION /note="Tetramerization" DISORDER predicted by DISOPRED REGION /note="Tetramerization" | ||
415 | D | H | e | 85.8 | 8fd5_A | D |
REGION /note="Tetramerization" DISORDER predicted by DISOPRED REGION /note="Tetramerization" | ||
416 | S | S | e | 47.7 | 8fd5_A | S |
REGION /note="Tetramerization" DISORDER predicted by DISOPRED REGION /note="Tetramerization" | ||
417 | T | S | e | 83.8 | 8fd5_A | T |
REGION /note="Tetramerization" DISORDER predicted by DISOPRED REGION /note="Tetramerization" | ||
418 | Q | e | 61.7 | 8fd5_A | Q |
REGION /note="Tetramerization" DISORDER predicted by DISOPRED REGION /note="Tetramerization" | |||
419 | A | b | 13.4 | 8fd5_A | A |
REGION /note="Tetramerization" DISORDER predicted by DISOPRED REGION /note="Tetramerization" |