Contact Molecules for Homologous Proteins | ||||
[Full Bars] |
[SiteTable] |
|
[Back to Search Page] |
[Back to HOMCOS] |
[SupCon3D] |
[help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
2900190 | 1817 | 149 | P52948(NUP98_HUMAN) | RecName: Full=Nuclear pore complex protein Nup98-Nup96 ; EC=3.4.21.- ;Contains: RecName: Full=Nuclear pore complex protein Nup98; AltName: Full=98 kDa nucleoporin; AltName: Full=Nucleoporin Nup98; Short=Nup98;Contains: RecName: Full=Nuclear pore complex protein Nup96; AltName: Full=96 kDa nucleoporin; AltName: Full=Nucleoporin Nup96; Short=Nup96;Flags: Precursor; |
QUERYSEQ |
MFNKSFGTPFGGGTGGFGTTSTFGQNTGFGTTSGGAFGTSAFGSSNNTGGLFGNSQTKPGGLFGTSSFSQPATSTSTGFGFGTSTGTANTLFGTASTGTSLFSSQNNAFAQNKPTGFGNFGTSTSSGGLFGTTNTTSNPFGSTSGSLFGP SSFTAAPTGTTIKFNPPTGTDTMVKAGVSTNISTKHQCITAMKEYESKSLEELRLEDYQANRKGPQNQVGAGTTTGLFGSSPATSSATGLFSSSTTNSGFAYGQNKTAFGTSTTGFGTNPGGLFGQQNQQTTSLFSKPFGQATTTQNTGF SFGNTSTIGQPSTNTMGLFGVTQASQPGGLFGTATNTSTGTAFGTGTGLFGQTNTGFGAVGSTLFGNNKLTTFGSSTTSAPSFGTTSGGLFGNKPTLTLGTNTNTSNFGFGTNTSGNSIFGSKPAPGTLGTGLGAGFGTALGAGQASLFG NNQPKIGGPLGTGAFGAPGFNTTTATLGFGAPQAPVALTDPNASAAQQAVLQQHINSLTYSPFGDSPLFRNPMSDPKKKEERLKPTNPAAQKALTTPTHYKLTPRPATRVRPKALQTTGTAKSHLFDGLDDDEPSLANGAFMPKKSIKKL VLKNLNNSNLFSPVNRDSENLASPSEYPENGERFSFLSKPVDENHQQDGDEDSLVSHFYTNPIAKPIPQTPESAGNKHSNSNSVDDTIVALNMRAALRNGLEGSSEETSFHDESLQDDREEIENNSYHMHPAGIILTKVGYYTIPSMDDL AKITNEKGECIVSDFTIGRKGYGSIYFEGDVNLTNLNLDDIVHIRRKEVVVYLDDNQKPPVGEGLNRKAEVTLDGVWPTDKTSRCLIKSPDRLADINYEGRLEAVSRKQGAQFKEYRPETGSWVFKVSHFSKYGLQDSDEEEEEHPSKTS TKKLKTAPLPPASQTTPLQMALNGKPAPPPQSQSPEVEQLGRVVELDSDMVDITQEPVLDTMLEESMPEDQEPVSASTHIASSLGINPHVLQIMKASLLTDEEDVDMALDQRFSRLPSKADTSQEICSPRLPISASHSSKTRSLVGGLLQ SKFTSGAFLSPSVSVQECRTPRAASLMNIPSTSSWSVPPPLTSVFTMPSPAPEVPLKTVGTRRQLGLVPREKSVTYGKGKLLMDMALFMGRSFRVGWGPNWTLANSGEQLNGSHELENHQIADSMEFGFLPNPVAVKPLTESPFKVHLEK LSLRQRKPDEDMKLYQTPLELKLKHSTVHVDELCPLIVPNLGVAVIHDYADWVKEASGDLPEAQIVKHWSLTWTLCEALWGHLKELDSQLNEPREYIQILERRRAFSRWLSCTATPQIEEEVSLTQKNSPVEAVFSYLTGKRISEACSLA QQSGDHRLALLLSQFVGSQSVRELLTMQLVDWHQLQADSFIQDERLRIFALLAGKPVWQLSEKKQINVCSQLDWKRSLAIHLWYLLPPTASISRALSMYEEAFQNTSDSDRYACSPLPSYLEGSGCVIAEEQNSQTPLRDVCFHLLKLYS DRHYDLNQLLEPRSITADPLDYRLSWHLWEVLRALNYTHLSAQCEGVLQASYAGQLESEGLWEWAIFVLLHIDNSGIREKAVRELLTRHCQLLETPESWAKETFLTQKLRVPAKWIHEAKAVRAHMESDKHLEALCLFKAEHWNRCHKLI IRHLASDAIINENYDYLKGFLEDLAPPERSSLIQDWETSGLVYLDYIRVIEMLRHIQQVDCSGNDLEQLHIKVTSLCSRIEQIQCYSAKDRLAQSDMAKRVANLLRVVLSLHHPPDRTSDSTPDPQRVPLRLLAPHIGRLPMPEDYAMDE LRSLTQSYLRELAVGSL |
1817 | region | name | description |
1-880 | CHAIN | /note="Nuclear pore complex protein Nup98" /id="PRO_0000019929" | |
881-1817 | CHAIN | /note="Nuclear pore complex protein Nup96" /id="PRO_0000019930" | |
738-880 | DOMAIN | /note="Peptidase S59" | |
1-156 | REGION | /note="FG repeats 1" | |
157-213 | REGION | /note="GLEBS; interaction with RAE1" | |
214-480 | REGION | /note="FG repeats 2" | |
512-535 | REGION | /note="Disordered" | |
614-633 | REGION | /note="Disordered" | |
662-682 | REGION | /note="Disordered" | |
886-937 | REGION | /note="Disordered" | |
886-901 | COMPBIAS | /note="Basic and acidic residues" | |
902-921 | COMPBIAS | /note="Polar residues" | |
881-881 | ACT_SITE | /note="Nucleophile" ECO:0000269|PubMed:18287282" | |
1-1817 | DISORDER | predicted by DISOPRED |
MONOMER | |||||||
1817 | |||||||
pdb_id | a1 | identity[%]2 | description | ||||
7r5k | MB | 100.0 | NUP98_HUMAN Nuclear pore complex protein Nup96 | ||||
2q5y | A | 100.0 | NUP98_HUMAN Nuclear pore complex protein Nup98 | ||||
7byf | F | 100.0 | Q3TPG3_MOUSE Peptidase S59 domain-containing protein | ||||
7q64 | CA | 100.0 | NUP98_HUMAN Nuclear pore complex protein Nup98 | ||||
8ci8 | X | 100.0 | NUP98_HUMAN Nuclear pore complex protein Nup98 | ||||
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue. |
HETERO | |||||||
1817 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
1ko6[2] | B | NU98_HUMAN Nuclear Pore Complex Protein Nup98[6 aa] | A | 100.0 /100.0 |
11 /11 |
NUP98_HUMAN Nuclear Pore Complex Protein Nup98 | |
1ko6[1] | B | NU98_HUMAN Nuclear Pore Complex Protein Nup98[6 aa] | C | 100.0 /100.0 |
1 /1 |
NUP98_HUMAN Nuclear Pore Complex Protein Nup98 | |
2q5y[2] | B | NUP98_HUMAN Nuclear pore complex protein Nup96[3 aa] | A | 100.0 /100.0 |
11 /11 |
NUP98_HUMAN Nuclear pore complex protein Nup98 | |
3mmy[15] | A | RAE1L_HUMAN mRNA export factor[354 aa] | B | 100.0 /100.0 |
29 /29 |
NUP98_HUMAN Nuclear pore complex protein Nup98 | |
7f60[4] | B | RAE1L_HUMAN mRNA export factor[330 aa] | C | 100.0 /100.0 |
25 /25 |
NUP98_HUMAN Nuclear pore complex protein Nup98-Nup96 | |
4owr[1] | C | MATRX_VSIVS Matrix protein[176 aa] | B | 100.0 /100.0 |
3 /3 |
NUP98_HUMAN Nuclear pore complex protein Nup98-Nup96 | |
5a9q[32] | E | NU107_HUMAN NUCLEAR PORE COMPLEX PROTEIN NUP107[660 aa] | F | 100.0 /100.0 |
7 /7 |
NUP98_HUMAN NUCLEAR PORE COMPLEX PROTEIN NUP96 | |
5a9q[32] | G | SEC13_HUMAN PROTEIN SEC13 HOMOLOG[285 aa] | F | 100.0 /100.0 |
8 /8 |
NUP98_HUMAN NUCLEAR PORE COMPLEX PROTEIN NUP96 | |
7peq[32] | D | SEC13_HUMAN Protein SEC13 homolog[285 aa] | C | 100.0 /100.0 |
13 /13 |
NUP98_HUMAN Nuclear pore complex protein Nup96 | |
7r5j[64] | OB | SEC13_HUMAN Protein SEC13 homolog[301 aa] | KB | 100.0 /100.0 |
59 /59 |
NUP98_HUMAN Nuclear pore complex protein Nup96 | |
7byf[2] | D | O41931_MHV68 10 protein[399 aa] | B | 100.0 /100.0 |
2 /2 |
Q3TPG3_MOUSE Peptidase S59 domain-containing protein | |
7mni[2] | A | NUP88_HUMAN Nuclear pore complex protein Nup88[409 aa] | B | 100.0 /100.0 |
27 /27 |
NUP98-2_HUMAN Nuclear pore complex protein Nup98 | |
7peq[24] | B | NU107_HUMAN Nuclear pore complex protein Nup107[678 aa] | C | 100.0 /100.0 |
4 /4 |
NUP98_HUMAN Nuclear pore complex protein Nup96 | |
7peq[8] | F | NUP85_HUMAN Nuclear pore complex protein Nup85[632 aa] | C | 100.0 /100.0 |
1 /1 |
NUP98_HUMAN Nuclear pore complex protein Nup96 | |
7r5j[32] | WB | NUP85_HUMAN Nuclear pore complex protein Nup85[655 aa] | LB | 100.0 /100.0 |
2 /2 |
NUP98_HUMAN Nuclear pore complex protein Nup96 | |
7peq[32] | H | NU160_HUMAN Nuclear pore complex protein Nup160[996 aa] | C | 100.0 /100.0 |
32 /32 |
NUP98_HUMAN Nuclear pore complex protein Nup96 | |
7r5j[24] | A | RBP2_HUMAN E3 SUMO-protein ligase RanBP2[756 aa] | KB | 100.0 /100.0 |
1 /1 |
NUP98_HUMAN Nuclear pore complex protein Nup96 | |
7r5j[16] | C | RBP2_HUMAN E3 SUMO-protein ligase RanBP2[756 aa] | KB | 100.0 /100.0 |
3 /3 |
NUP98_HUMAN Nuclear pore complex protein Nup96 | |
7r5j[8] | D | RBP2_HUMAN E3 SUMO-protein ligase RanBP2[756 aa] | LB | 100.0 /100.0 |
5 /5 |
NUP98_HUMAN Nuclear pore complex protein Nup96 | |
7r5k[8] | B | RBP2_HUMAN E3 SUMO-protein ligase RanBP2[756 aa] | KB | 100.0 /100.0 |
7 /7 |
NUP98_HUMAN Nuclear pore complex protein Nup96 | |
7r5k[8] | D | RBP2_HUMAN E3 SUMO-protein ligase RanBP2[756 aa] | LB | 100.0 /100.0 |
4 /4 |
NUP98_HUMAN Nuclear pore complex protein Nup96 | |
7r5j[64] | EC | NU160_HUMAN Nuclear pore complex protein Nup160[1399 aa] | KB | 100.0 /100.0 |
30 /30 |
NUP98_HUMAN Nuclear pore complex protein Nup96 | |
7r5j[64] | GB | NU107_HUMAN Nuclear pore complex protein Nup107[782 aa] | KB | 100.0 /100.0 |
22 /22 |
NUP98_HUMAN Nuclear pore complex protein Nup96 | |
7r5j[32] | HB | NU107_HUMAN Nuclear pore complex protein Nup107[782 aa] | KB | 100.0 /100.0 |
4 /4 |
NUP98_HUMAN Nuclear pore complex protein Nup96 | |
7r5j[24] | U | NUP93_HUMAN Nuclear pore complex protein Nup93[726 aa] | KB | 100.0 /100.0 |
15 /15 |
NUP98_HUMAN Nuclear pore complex protein Nup96 | |
7r5j[8] | V | NUP93_HUMAN Nuclear pore complex protein Nup93[726 aa] | MB | 100.0 /100.0 |
4 /4 |
NUP98_HUMAN Nuclear pore complex protein Nup96 | |
7vpg[2] | K | NS6_SARS ORF6 protein[10 aa] | F | 100.0 /100.0 |
1 /1 |
NUP98_HUMAN Isoform 3 of Nuclear pore complex protein Nup98-Nu.. | |
7vph[1] | L | NS6_SARS2 ORF6 protein[9 aa] | B | 100.0 /100.0 |
1 /1 |
NUP98_HUMAN Isoform 3 of Nuclear pore complex protein Nup98-Nu.. | |
3tkn[3] | A | NUP82_YEAST Nucleoporin NUP82[451 aa] | C | 95.2 /98.0 |
21 /21 |
Q6PFD9_MOUSE Nucleoporin 98 | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
HOMO | |||||||
1817 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
1ko6[1] | C | NUP98_HUMAN Nuclear Pore Complex Protein Nup98[148 aa] | A | 100.0 /100.0 |
12 /12 |
NUP98_HUMAN Nuclear Pore Complex Protein Nup98 | |
1ko6[1] | A | NUP98_HUMAN Nuclear Pore Complex Protein Nup98[152 aa] | C | 100.0 /100.0 |
16 /16 |
NUP98_HUMAN Nuclear Pore Complex Protein Nup98 | |
7peq[8] | L | NUP98_HUMAN Nuclear pore complex protein Nup96[543 aa] | C | 100.0 /100.0 |
1 /1 |
NUP98_HUMAN Nuclear pore complex protein Nup96 | |
7peq[8] | C | NUP98_HUMAN Nuclear pore complex protein Nup96[543 aa] | L | 100.0 /100.0 |
3 /3 |
NUP98_HUMAN Nuclear pore complex protein Nup96 | |
7q64[576] | G | NUP98_HUMAN Nuclear pore complex protein Nup98[34 aa] | A | 100.0 /100.0 |
2 /2 |
NUP98_HUMAN Nuclear pore complex protein Nup98 | |
7q66[21] | B | NUP98_HUMAN Nuclear pore complex protein Nup98[25 aa] | A | 100.0 /100.0 |
6 /6 |
NUP98_HUMAN Nuclear pore complex protein Nup98 | |
7q66[20] | D | NUP98_HUMAN Nuclear pore complex protein Nup98[25 aa] | B | 100.0 /100.0 |
25 /25 |
NUP98_HUMAN Nuclear pore complex protein Nup98 | |
7q66[19] | B | NUP98_HUMAN Nuclear pore complex protein Nup98[25 aa] | C | 100.0 /100.0 |
1 /1 |
NUP98_HUMAN Nuclear pore complex protein Nup98 | |
8ci8[9] | A | NUP98_HUMAN Nuclear pore complex protein Nup98[10 aa] | B | 100.0 /100.0 |
6 /6 |
NUP98_HUMAN Nuclear pore complex protein Nup98 | |
8ci8[84] | C | NUP98_HUMAN Nuclear pore complex protein Nup98[26 aa] | B | 100.0 /100.0 |
13 /13 |
NUP98_HUMAN Nuclear pore complex protein Nup98 | |
8ci8[13] | E | NUP98_HUMAN Nuclear pore complex protein Nup98[10 aa] | D | 100.0 /100.0 |
9 /9 |
NUP98_HUMAN Nuclear pore complex protein Nup98 | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. |