Contact Molecules for Homologous Proteins

[Summary Bars]
[Full Bars]


Site Table[40 %]


[Back to Search Page]
[Back to HOMCOS]

[Sites by Variants]
[SupCon3D]
[help] 		seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
11352 740 50 Q92499(DDX1_HUMAN) RecName: Full=ATP-dependent RNA helicase DDX1; EC=3.6.4.13 ;AltName: Full=DEAD box protein 1;AltName: Full=DEAD box protein retinoblastoma; Short=DBP-RB;
QUERYSEQ 
MAAFSEMGVMPEIAQAVEEMDWLLPTDIQAESIPLILGGGDVLMAAETGSGKTGAFSIPVIQIVYETLKDQQEGKKGKTTIKTGASVLNKWQMNPYDRGSAFAIGSDGLCCQSREVKEWHGCRATKGLMKGKHYYEVSCHDQGLCRVGWS
TMQASLDLGTDKFGFGFGGTGKKSHNKQFDNYGEEFTMHDTIGCYLDIDKGHVKFSKNGKDLGLAFEIPPHMKNQALFPACVLKNAELKFNFGEEEFKFPPKDGFVALSKAPDGYIVKSQHSGNAQVTQTKFLPNAPKALIVEPSRELAE
QTLNNIKQFKKYIDNPKLRELLIIGGVAARDQLSVLENGVDIVVGTPGRLDDLVSTGKLNLSQVRFLVLDEADGLLSQGYSDFINRMHNQIPQVTSDGKRLQVIVCSATLHSFDVKKLSEKIMHFPTWVDLKGEDSVPDTVHHVVVPVNP
KTDRLWERLGKSHIRTDDVHAKDNTRPGANSPEMWSEAIKILKGEYAVRAIKEHKMDQAIIFCRTKIDCDNLEQYFIQQGGGPDKKGHQFSCVCLHGDRKPHERKQNLERFKKGDVRFLICTDVAARGIDIHGVPYVINVTLPDEKQNYV
HRIGRVGRAERMGLAISLVATEKEKVWYHVCSSRGKGCYNTRLKEDGGCTIWYNEMQLLSEIEEHLNCTISQVEPDIKVPVDEFDGKVTYGQKRAAGGGSYKGHVDILAPTVQELAALEKEAQTSFLHLGYLPNQLFRTF
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ] 
  [n]:site number of query sequence.  [a]:amino acid of query sequence.  [s]:predicted secondary structure.
  [e]:predicted exposed/buried.  [acc]:predicted relative accesssibility(%).  [pdb]:PDB code of homologous structure.
  [contact_mols]:predicted binding molecules  [observed aa]:Observed amino acids among homologous sequences.  [feature table]:UniProt Feature Table
  [variant]:UniProt Human Variant.
n a s e acc pdb contact_mols observed aa feature table variant
1MTe 28.5 8tbx_A 
IMVLF
 REGION /note="Necessary for interaction with HNRNPK" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
2AHe 47.3 8tbx_A 
STAKRLPQEMGN
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
3AHb 11.6 8tbx_A 
STAKGREQCDHLN
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
4FHb 0.0 8tbx_A compound AMP 
FWIL
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
5SHe 28.9 8tbx_A 
SEADKQTNHRVGL
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
6ETe 82.9 8tbx_A 
EDSQANHTGIP
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
7MTb 17.9 8tbx_A 
LFMCISAYPVT
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
8GTe 52.4 8tbx_A 
GNPDKQSACEFHLRTY
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
9V b 3.3 8tbx_A 
LIVFCMER
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
10M b 12.6 8tbx_A 
SHKPDGNTVELQRAICM
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
11PHe 52.7 8tbx_A 
PEDRSKAQTGNVY
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
12EHe 41.7 8tbx_A 
EPRWDKQSLNTAHFIYGV
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
13IHb 0.0 8tbx_A 
LIVTMAS
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
14AHb 0.0 8tbx_A 
LIVMACRSKQTEFGHNY
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
15QHe 35.7 8tbx_A 
KREQDSAHMGLNIT
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
16AHb 0.0 8tbx_A 
AGNSTVELRIKQ
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
17VHb 0.0 8tbx_A 
LIVCAFKMQ
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
18EHe 39.2 8tbx_A 
KEYASDNRTQFLGHIMPV
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
19ETe 46.2 8tbx_A 
EKDARSQNLTGFV
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
20MTe 28.0 8tbx_A 
LMAKSYIQVFNCEGT
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
21DTe 82.7 8tbx_A compound ADP 
GKNEADHRSLPQ
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
22W e 27.1 8tbx_A compound AMP ADP 
FYIWLVDKMS
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
23L e 46.6 8tbx_A 
EKTNVDSALQRMPYGHI
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
24LSe 66.3 8tbx_A compound AMP ADP 
KRETAVNQHSFLYDIM
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
25P e 23.3 8tbx_A compound ADP 
PMLVCATS
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
26T e 30.5 8tbx_A compound AMP ADP 
TSRAKM
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
27DHe 84.6 8tbx_A 
PAEDLSTKHQVGR
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
28IHb 2.3 8tbx_A 
IVT
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
29QHb 3.1 8tbx_A compound AMP ADP 
QN
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
30AHe 39.3 8tbx_A 
ASFKREQMCGILNTV
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
31EHe 50.8 8tbx_A 
ADKREQSYLVGHIMNT
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
32SHb 0.0 8tbx_A 
ASTNCGMVIL
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
33IHb 0.0 8tbx_A 
ILVWFM
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
34PHe 41.1 8tbx_A 
PLMSFGKNRTV
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
35LHe 29.8 8tbx_A 
LIPVQAEHMSTYFGKR
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
36IHb 0.0 8tbx_A 
IALYVFSGTCM
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
37LHe 24.2 8tbx_A 
LIMACFQRSTVY
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
38GTe 79.8 8tbx_A 
QSKAEDGNTLRCHM
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
39GTe 36.9 8tbx_A 
GNKREHSDQ
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
40G e 45.2 8tbx_A 
RKHQTEGLNPSVADIY
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
41D b 4.3 8tbx_A 
DNSEHAGIKLPRTV
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
42VEb 0.7 8tbx_A 
VILCAMTDEGKNPRS
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
43LEb 0.0 8tbx_A 
ILVMAFCDEGKNPRST
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
44MEb 0.0 8tbx_A 
GAVILCSDEKMNPRT
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
45AEb 2.7 8tbx_A 
QACKGIVRELMSDTHNP
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
46A b 4.5 8tbx_A 
ASDGEIKLNPRTV
 BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
47E e 73.4 8tbx_A compound ADP 
QKERVPSADHFGILNTY
 BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
48TTe 70.8 8tbx_A compound AMP ADP 
TSNC
 BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
49GTe 91.7 8tbx_A compound AMP ADP 
GNS
 BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
50SSb 15.6 8tbx_A compound AMP ADP 
STYAM
 BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
51GSe 21.4 8tbx_A compound AMP ADP 
G
 BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
52KHb 2.8 8tbx_A compound AMP ADP 
KE
 MUTAGEN /note="K->N: Abolishes ability to promote guanylylation of RTCB." BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" MUTAGEN /note="K->N: Abolishes ability to promote guanylylation of RTCB." BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
53THb 7.8 8tbx_A compound AMP ADP metal MG 
TNS
 BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
54GHb 3.6 8tbx_A compound ADP 
ALVGHIMFS
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
55AHb 0.0 8tbx_A 
ALSGTVMC
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
56FHb 0.0 8tbx_A 
FYRI
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
57SHb 1.6 8tbx_A 
LSAVGICTM
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
58IHb 0.0 8tbx_A 
ILDVFAGTW
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
59PHb 0.8 8tbx_A 
PSGATIL
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
60VHb 0.7 8tbx_A 
IVLMARCTFS
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
61IHb 0.6 8tbx_A 
LIVWFCMAE
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
62QHb 5.1 8tbx_A 
ACDEHIKLMNQRSV
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
63IHb 13.5 8tbx_A 
YKFLHQANRSEGIMTVC
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
64VHb 1.3 8tbx_A 
ILVACMSWYEHT
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
65YHb 17.0 8tbx_A 
LYFSDWAEHIKMQRVCNPTG
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
66EHe 43.2 8tbx_A 
EKQDRHSNPTAYIL
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
67THb 10.4 8tbx_A 
TSHKLNEQRYACPVDFGIW
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
68LHb 17.4 8tbx_A 
LRAEIPGKMNSDVYHQ
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
69KTe 32.5 8tbx_A 
KRPNALSEGQYDFHIMV
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
70DTe 88.3 8tbx_A 
DEASKNPQTHLRVGIM
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
71Q e 58.7 8tbx_A 
QKSPRLTDEINAVCFMY
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
72Q b 1.0 5gju_A 
QRETDNAKSPCFHILMV
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
73E---- 
EPKTQLNDAMSVYHIRG
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
74G---- 
GLASENTDHKPFMQR
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
75K---- 
KRAIEPNLQCGSVY
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
76K---- 
KREAIQDLPSYFGNT
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
77G---- 
GPNTAKSDEFIR
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
78K---- 
KPEARLNQSTHDMCGV
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
79T---- 
TSARGVLEDKPIMQ
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
80T---- 
TASPVIKERYGL
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
81I---- 
IVATLREGSFMDN
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
82K---- 
KRGPQENAYCLSIV
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
83T---- 
TPALIEDGSKQRV
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
84G---- 
GAILNPSTFVEK
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
85A---- 
AIVKGQTEHLS
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
86S e 89.1 4xw3_B 
SLRVPQAGT
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
87VGe 22.7 4xw3_B 
IPVATEGLY
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
88LGb 7.9 4xw3_B 
LTVIPGK
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
89NGe 57.0 4xw3_B 
SRNDQTHLY
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
90KSe 51.9 4xw3_B 
ESIGKHRTPADLV
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
91WSb 9.6 4xw3_B 
LWYIFADEGKNPQRSTV
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
92QSb 12.8 4xw3_B 
AQGETHIKDFLNPRSV
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
93MEb 0.0 4xw3_B 
LMYVAGS
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
94NEb 0.0 4xw3_B 
NQDEGSAV
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
95PEe 22.5 4xw3_B 
PILADFQKST
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
96YEe 36.5 4xw3_B 
YNMEHPLIFQ
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
97DEb 0.0 4xw3_B 
DANKMTCE
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
98REe 31.6 4xw3_B 
QRKPENV
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
99G b 1.2 4xw3_B 
DGSILYV
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
100STe 69.5 4xw3_B 
STQKLNVEHD
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
101ATe 28.6 4xw3_B 
KANDISYGHR
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
102FEb 0.5 4xw3_B 
FLYMHADEGIKNPQRSTV
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
103AEe 38.4 4xw3_B 
AKPESTGNDFILQRV
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
104IEe 20.5 4xw3_B 
LAIKPSVDEGNQRT
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
105G e 38.1 4xw3_B 
ADGNRSTMEIKLPV
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
106STe107.8 4xw3_B 
SGENIPARTVM
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
107DTe 35.8 4xw3_B 
DETGNVAHKL
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
108GSb 1.2 4xw3_B 
GANEKRLSV
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
109L b 12.4 4xw3_B 
LVMTCIF
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
110CEe 21.3 4xw3_B 
CAGLSEITR
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
111CEb 0.0 4xw3_B 
CSAVKYIL
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
112QEe 35.7 4xw3_B 
QDGELKS
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
113SEb 0.0 4xw3_B 
SATRDKEGLV
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
114R e 37.9 4xw3_B 
RLGQAESKTV
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
115E e 39.2 4xw3_B 
ESKVDRATFGILNPQ
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
116VTe 67.3 4xw3_B 
VKLRAIMFDEGNPQSTY
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
117KTe 84.4 4xw3_B 
KSFMERAL
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
118E e 47.7 4xw3_B 
RSAEQGNDKFILPTV
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
119W e 26.7 4xw3_B 
WFDIAKY
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
120HEb 1.6 4xw3_B 
HSAFELRC
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
121GEb 0.0 4xw3_B 
GARSVM
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
122CEb 0.7 4xw3_B 
AIVCFG
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
123REb 1.6 4xw3_B 
REQPIVK
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
124AEb 0.0 4xw3_B 
ASKTCG
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
125TSb 0.0 4xw3_B 
TNVYES
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
126KEb 10.4 4xw3_B 
YTKRAPSF
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
127GEb 0.0 4xw3_B 
GACS
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
128LEb 0.0 4xw3_B 
VILR
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
129MSe 25.1 4xw3_B 
LTYKSDQRMWVNAEG
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
130KSe 44.3 4xw3_B 
KSANERDGLTV
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
131GSb 13.1 4xw3_B 
GDAEKLSTV
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
132KEe 33.5 4xw3_B 
KFRILAVEGST
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
133HEb 4.7 4xw3_B 
HWYVF
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
134YEb 0.9 4xw3_B 
YLSCMV
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
135YEb 0.0 4xw3_B 
YFDW
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
136EEb 1.0 4xw3_B 
ED
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
137VEb 0.0 4xw3_B 
VIFSAM
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
138SEb 9.4 4xw3_B 
SKETDLQAI
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
139CEb 4.7 4xw3_B 
IVCALK
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
140H e 40.3 4xw3_B 
VGHTLSYENR
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
141DSb 17.3 4xw3_B 
DTESR
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
142QSe 78.1 4xw3_B 
SQKTEDRPVANL
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
143GSe 32.1 4xw3_B 
GPHSAL
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
144LEe 43.3 4xw3_B 
LVYDFHEIPA
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
145CEb 4.0 4xw3_B 
MCVITLQ
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
146REb 6.7 4xw3_B 
RQGS
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
147VEb 0.0 4xw3_B 
IVL
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
148GEb 0.0 4xw3_B 
GL
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
149WEb 0.0 4xw3_B 
WLVF
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
150SEb 0.8 4xw3_B 
SACKT
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
151T b 2.6 4xw3_B 
TRLASV
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
152MTb 13.5 4xw3_B 
LDQMKCITRA
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
153QTe 67.9 4xw3_B 
QDGKSPTAFRN
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
154ASb 6.2 4xw3_B 
CSAPGYTVF
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
155S e 38.3 4xw3_B 
SDNPGRKC
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
156LSb 6.2 4xw3_B 
LFMRASTVQ
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
157DSe 25.9 4xw3_B 
NQDLEFGMT
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
158LTb 0.6 4xw3_B 
LRVIP
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
159GTb 0.0 4xw3_B 
G
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
160TSb 16.9 4xw3_B 
DWETSCYAK
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
161DSb 19.8 4xw3_B 
DETHACG
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
162KTe 46.7 4xw3_B 
KEDHAGPLR
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
163FTb 16.3 4xw3_B 
FYNDREHLTMQ
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
164GEb 0.0 4xw3_B 
SGA
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
165FEb 0.5 4xw3_B 
YFWVC
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
166GEb 0.0 4xw3_B 
GAV
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
167FEb 0.0 4xw3_B 
YFL
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
168GEb 6.0 4xw3_B 
DGAHRSTN
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
169GTb 17.9 4xw3_B 
GPDLS
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
170TTe 51.9 4xw3_B 
TENDHCRFIK
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
171GTb 10.7 4xw3_B 
GRDKNSAL
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
172KEe 33.0 4xw3_B 
KGSVAHCITLM
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
173KEe 20.3 4xw3_B 
KQRHENSAL
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
174SEb 0.0 4xw3_B 
SRKFITAML
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
175HEb 18.8 4xw3_B 
HWDTFYCSENAL
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
176NTe 59.4 4xw3_B 
NHDSKAEL
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
177KTe 68.4 4xw3_B 
KGQRSACVL
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
178QEe 59.2 4xw3_B 
QTGESKLPR
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
179FEe 37.8 4xw3_B 
FGTYLNRAIS
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
180DEe 40.7 4xw3_B 
EDISTQN
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
181NEe 79.4 4xw3_B 
DNPKHTWGAES
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
182Y b 10.0 4xw3_B 
YFK
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
183GSe 50.0 4xw3_B 
GMNA
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
184E e 35.2 4xw3_B 
EQPRKADLV
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
185E e 73.4 4xw3_B 
EPTRSAKQ
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
186F b 5.7 4xw3_B 
FWYIS
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
187T e 39.6 4xw3_B 
TKLQAGVDE
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
188MTe 29.0 4xw3_B 
TAEMPQLSKN
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
189HTe 84.3 4xw3_B 
GNHEA
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
190D b 14.2 4xw3_B 
D
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
191TEb 3.9 4xw3_B 
VTFI
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
192IEb 0.0 4xw3_B 
IVF
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
193GEb 1.2 4xw3_B 
GTS
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
194CEb 0.0 4xw3_B 
CFSV
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
195YEb 3.9 4xw3_B 
YFLCMG
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
196LEb 0.0 4xw3_B 
ILVDAFY
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
197DEb 3.7 4xw3_B 
DNER
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
198ITb 15.2 4xw3_B 
LFVIMPT
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
199DTe 66.0 4xw3_B 
DNCIEKPRTV
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
200KTe 64.6 4xw3_B 
EDNTCKS
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
201GTb 1.2 4xw3_B 
GSNEKQRHVD
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
202HEe 25.7 4xw3_B 
TEQHINADGKLPRSV
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
203VEb 0.0 4xw3_B 
ILMVCADEGKNPQRST
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
204KEb 10.4 4xw3_B 
SFIKMEGWYADLNPQRTV
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
205FEb 0.0 4xw3_B 
FYW
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
206SEb 1.6 4xw3_B 
TSDFACY
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
207KEb 16.0 4xw3_B 
KLSR
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
208NTe 34.5 4xw3_B 
NM
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
209GTe 53.6 4xw3_B 
GAF
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
210KEe 60.8 4xw3_B 
EKVLQAGHN
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
211DEe 39.5 4xw3_B 
DWQCSKLNVY
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
212LEb 14.6 4xw3_B 
LMQEFSI
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
213GEe 28.6 4xw3_B 
GKPNE
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
214LEe 43.3 4xw3_B 
LIAVSPTE
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
215AEb 2.7 4xw3_B 
AEGDKQL
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
216FEb 10.5 4xw3_B 
FPALK
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
217EEe 63.3 4xw3_B 
ERKTSDQA
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
218I b 8.2 4xw3_B 
ITVFKALDNS
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
219P e 22.5 4xw3_B 
PSLKAFDRQEGTV
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
220PGe 94.6 4xw3_B 
KSPDHEVAGLT
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
221HGe 41.4 4xw3_B 
GESHKANFRDL
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
222MGb 0.5 4xw3_B 
LIVGDWTKSYMA
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
223KTe 39.2 4xw3_B 
KVTAQSLGPR
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
224NTe 87.9 4xw3_B 
GNVSQADKL
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
225QSe 30.1 4xw3_B 
QRGMDSTAHEF
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
226A b 12.5 4xw3_B 
AGNPFMTCVIRSK
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
227LBb 0.6 4xw3_B 
LFTYIKV
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
228FEb 0.5 4xw3_B 
FYLRVAI
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
229PEb 0.0 4xw3_B 
PEAKSD
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
230AEb 1.8 4xw3_B 
ASVFPHT
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
231CEb 0.0 4xw3_B 
VCMSITAL
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
232VEb 0.0 4xw3_B 
SGVLKNFAE
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
233LEb 0.0 4xw3_B 
LMCIAVEGS
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
234KEe 27.8 4xw3_B 
KQSGNHAELV
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
235NSe 37.0 4xw3_B 
NEGTVYFDQSPAL
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
236AEb 0.9 4xw3_B 
APCDSRQKEGFILNTV
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
237EEe 20.1 4xw3_B 
ELAQGTSHVDFIKNPR
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
238LEb 1.1 4xw3_B 
LVCMADEFGIKNPQRSTY
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
239KEe 21.7 4xw3_B 
REPAKDQSHLFGINTVY
 MOD_RES /note="N6-acetyllysine" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" MOD_RES /note="N6-acetyllysine" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
240FEb 1.0 4xw3_B 
YLFMAVGSDEIKNPQRT
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
241NEb 10.9 4xw3_B 
NLASFGDEIKPQRTVY
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
242FSb 1.9 4xw3_B 
FLYADEGIKNPQRSTV
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
243GSb 13.1 4xw3_B 
GSNVEADFIKLPQRTY
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
244ESe 68.3 4xw3_B 
NEQRKSYAFLDGIPTV
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
245ESe 53.3 4xw3_B 
ELKQMDRSNPTYAGVFHI
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
246E e 96.5 4xw3_B 
PGKRSEDALFINQTVY
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
247F b 19.1 4xw3_B 
FPALSKMDEGINQRTVY
 DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
248KSe 57.1 4xw3_B 
KSEIRLVPADFGNQTY
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
249FSe 35.9 4xw3_B 
AFIKLNHYDEGPRSTV
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
250P e 78.3 4xw3_B 
PDQVIAFEGKLNRST
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
251P e 26.4 4xw3_B 
PQEILSCTVAG
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
252K e 39.2 4xw3_B 
KSEAGIQVLR
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
253DTe 63.0 4xw3_B 
DRKNIAMEGLPQSTV
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
254GTe 71.4 4xw3_B 
GQLAKDEFINPRSTVY
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
255F b 7.7 4xw3_B 
AFILMPRSY
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
256VEe 47.3 4xw3_B 
VLIRDMKQPT
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
257AEb 11.6 4xw3_B 
APGMSQVLT
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
258LGb 0.0 4xw3_B 
LIQPFAV
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
259SGb 12.5 4xw3_B 
SACQDNPTG
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
260KGe 59.0 4xw3_B 
QKRDNEHT
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
261ASb 6.2 4xw3_B 
APGSIKTV
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
262P e 55.8 4xw3_B 
PGLIKQER
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
263DGe 82.1 4xw3_B 
DSNTQHREFL
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
264GGe 85.7 4xw3_B 
GANHTLRK
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
265YGe 50.0 4xw3_B 
YFLHKSIDMVNAEGPT
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
266IEb 15.2 4xw3_B 
ILVSTDKAY
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
267VEe 35.3 4xw3_B 
AILVMSEGFQ
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
268KEe 52.4 4xw3_B 
KAPQERSNMDTV
 MOD_RES /note="N6-acetyllysine" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" MOD_RES /note="N6-acetyllysine" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
269S b 4.7 4xw3_B 
STAQFKHPMGNYDL
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
270QSe 69.9 4xw3_B 
QLRASKTVWEIP
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
271H b 10.5 4xw3_B 
ADEGLPRSTVHNQ
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
272SSe 36.7 4xw3_B 
SLNTERGFDPQVAIK
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
273GGe 54.8 4xw3_B 
GIATELPCKNRVMQ
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
274NGe103.6 4xw3_B 
NTKSCGALPRDEI
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
275AGe 36.6 4xw3_B 
ASFTGPKDEHLQVR
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
276Q e 57.7 4xw3_B 
QKELMRTGASIP
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
277VBe 29.3 4xw3_B 
LIAVKSRDGMTHNP
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
278T e 64.9 4xw3_B 
STVNQLAKYDERFCIMP
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
279Q e 37.8 4xw3_B 
QRLAEKSNDFHIMTVY
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
280T---- 
STLIVANEKDGQRMPY
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
281KTe 40.1 8eti_J 
KREVQDPNTAILSGHMY
 MOD_RES /note="N6-acetyllysine; alternate" CROSSLNK /note="Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternate" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" MOD_RES /note="N6-acetyllysine; alternate" CROSSLNK /note="Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternate" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
282F e 20.1 8eti_J 
FIEPLVYGAKQRSDMNTWH
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
283L e 34.9 8eti_J 
LVKRDIAEMNQSTGYCFHP
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
284PTe 47.3 8eti_J 
PDLQKEGAINRSVHMT
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
285NSe 31.5 8eti_J 
NDRGHQSPTEKALYV
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
286ASb 4.5 8tbx_A 
AGQVESKCRTHIPYDFLN
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
287P b 1.6 8tbx_A 
PTVIFELCSAKMRY
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
288KSb 5.2 8tbx_A 
QRSGTIFKLYAEHMNV
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
289AEb 0.0 8tbx_A 
AVGRSICTM
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
290LEb 1.1 8tbx_A 
LIVAFMC
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
291IEb 1.2 8tbx_A 
IVACLFM
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
292VEb 1.3 8tbx_A 
LIVMEDFCT
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
293E b 0.0 8tbx_A 
ASVTCLQRFEGM
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
294PSb 14.7 8tbx_A 
PEHNAS
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
295S e 32.8 8tbx_A 
TSNADVI
 REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
296RHb 19.4 8tbx_A 
RKSTHQVAFLNY
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
297EHe 34.7 8tbx_A 
EDSTLMP
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
298LHe 25.8 8tbx_A 
LWI
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
299AHb 0.0 8tbx_A 
AVSCQIGT
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
300EHe 42.7 8tbx_A 
LQVDEIANRSHMTYKCFGW
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
301QHe 51.5 8tbx_A compound ADP 
QEADT
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
302THb 1.3 8tbx_A 
IVTGAELQCNS
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
303LHb 11.2 8tbx_A nucleotide 
YFALQHVKSGETIRCDMN
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
304NHe 69.1 8tbx_A 
DKENQSRAGPTHLVIM
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
305NHb 8.5 8tbx_A 
VETGKDNSHIAMQRFLCP
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
306IHb 2.3 8tbx_A 
LVAIECFYGMSTDK
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
307KHe 20.8 8tbx_A nucleotide 
KELTRNQISAVDGMCFY
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
308QHe 30.1 8tbx_A 
KEQRATDLSGVNPCFHIMY
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
309FHb 0.0 8tbx_A 
LFIMTAHVCGYEQSW
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
310KTb 18.9 8tbx_A 
GASLKTERVCIMPQDHNY
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
311KTe 24.5 8tbx_A 
KARSQEHDTGLPYFINV
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
312YTe 43.0 8tbx_A 
FYHLAGEPIKTVCRSWDMNQ
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
313I b 5.3 8tbx_A 
LTICMVGASNHPDFYEKQRW
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
314D e 44.4 8tbx_A 
DGSNAEKPTVFQYHILRCM
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
315NSe 86.1 8tbx_A 
GNSALRDHKQEPTVFIMYC
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
316PSe 47.3 8tbx_A 
PSTKLVAEGIRDHMNFQYC
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
317K e 55.2 8tbx_A 
KGNRDLSEQTAIPVWYCHFM
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
318L b 6.2 8tbx_A 
LIVFKACGMTYHNPQRS
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
319R b 14.2 8tbx_A 
RKSVTNAQEGDHICFLPY
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
320EEe 33.7 8tbx_A 
VSTAPCIEFKNQDGLHMRWY
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
321LEb 12.4 8tbx_A 
VALGQCMHITFSEKRYDN
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
322LEb 19.1 8tbx_A 
LVACNSTIMYGKPQEFHR
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
323IEb 0.6 8tbx_A 
VILAFCSMTWDNPQRY
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
324I b 10.5 8tbx_A 
IVYTSLAFGKMPCDNR
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
325GSe 79.8 8tbx_A 
GPSAKTNQRDEFLV
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
326GSe102.4 8tbx_A 
GADNSKEQTVCILMPR
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
327VSe 28.7 8tbx_A nucleotide 
TVLASMEIDKQRFGHNPCY
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
328A e 46.4 8tbx_A nucleotide 
SPDANGKTRELVQCFHIMY
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
329AHe 36.6 8tbx_A 
LIAKVMPRYDSEFTGNHQW
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
330RHe 28.9 8tbx_A hetero RL36B_SCHPO nucleotide 
RKEQDGASNVLMPTFHIWY
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
331DHe 66.0 8tbx_A nucleotide 
DEKNQSVARGLPTHIFMY
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
332QHb 5.6 8tbx_A 
QDELSIKNRMTAFGHVY
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
333LHe 42.1 8tbx_A 
LAIKRVEFSNQDGMTCHPY
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
334SHe 44.5 8tbx_A 
RSKEANTDLQGIPVYFHMW
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
335VHe 26.0 8tbx_A nucleotide 
RKLAVEIQDFMSNTPCGHWY
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
336LHb 12.9 8tbx_A 
LIMVAFKRSCEGHNPQTY
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
337EHe 45.7 8tbx_A hetero RL36B_SCHPO 
KERSQADNTMPFGHILVY
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
338NHe 83.0 8tbx_A 
KNDREQSTGAHIMPVLYCFW
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
339G e 38.1 8tbx_A 
GKNPREASTQCDHILVYMW
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
340V b 2.0 8tbx_A 
PVACITGLMQSYEFKNR
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
341DSb 11.7 8tbx_A 
DHNQESARTGIKLPV
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
342IEb 2.3 8tbx_A 
IVLFMAGS
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
343VEb 0.7 8tbx_A 
LVIAMCFGS
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
344VEb 0.7 8tbx_A 
VIFSACGLT
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
345GEb 0.0 8tbx_A 
AGSTCIL
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
346T b 13.6 8tbx_A 
TNSAGLM
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
347PHb 1.6 8tbx_A 
PTAVCGILMS
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
348GHe 44.0 8tbx_A 
GADSHLCFMNPQTY
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
349RHb 12.6 8tbx_A 
RKLTMACGHIQS
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
350LHb 0.0 8tbx_A 
LVIFMACGST
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
351DHe 22.2 8tbx_A 
LIDVAKFHMQENSWCGPRTY
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
352DHe 64.2 8tbx_A 
DHEQSAKGNFILRTVY
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
353LHb 6.7 8tbx_A 
LMHIFNVTYACSWEGKQ
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
354VHb 10.0 8tbx_A 
LIVADEFKMQTCRSGHNY
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
355STe 67.2 8tbx_A 
ENKQSRDAGLTVIFHMY
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
356TTe 62.3 8tbx_A 
RSTKENAQDPLGMCFHIV
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
357GTe 88.1 8tbx_A hetero RL36B_SCHPO 
GKRNESDPQAMTHLVFIY
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
358K b 18.4 8tbx_A hetero RL36B_SCHPO 
AKSGRVHNPTEILQYDMCF
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
359LSb 4.5 8tbx_A 
LIFVTYAMEKNCDGPQRS
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
360N e 48.5 8tbx_A hetero RL36B_SCHPO 
DSNKRVFEHGITALQCMPY
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
361L b 6.7 8tbx_A 
LFTVIMPACDGKNRSY
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
362STe 49.2 8tbx_A 
SKDRANEGTHQPFLMV
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
363QTe 32.7 8tbx_A 
NSKRQHADTEGFLCIMVY
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
364V b 2.0 8tbx_A 
VLICRAMTDFPS
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
365R b 17.4 8tbx_A 
KREQTSDNACGHLMPVY
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
366FEb 0.0 8tbx_A 
YFVMILHTWASCDGKNQ
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
367LEb 0.6 8tbx_A 
LVFITAMCKR
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
368VEb 0.0 8tbx_A 
VIDATCGL
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
369LEb 1.1 8tbx_A 
LIFMVCY
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
370DTb 0.0 8tbx_A metal MG 
DSAEGLV
 MOTIF /note="DEAD box" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" MOTIF /note="DEAD box" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
371ETb 13.6 8tbx_A metal MG 
EKN
 MUTAGEN /note="E->G: Inhibits the transcriptional activity of RELA and attenuates NF-kappa-B-mediated gene expression." ECO:0000269|PubMed:24870230" MUTAGEN /note="E->Q: Abolishes ability to promote guanylylation of RTCB." ECO:0000269|PubMed:24870230" MOTIF /note="DEAD box" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" MUTAGEN /note="E->G: Inhibits the transcriptional activity of RELA and attenuates NF-kappa-B-mediated gene expression." ECO:0000269|PubMed:24870230" MUTAGEN /note="E->Q: Abolishes ability to promote guanylylation of RTCB." ECO:0000269|PubMed:24870230" MOTIF /note="DEAD box" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
372AHb 0.0 8tbx_A 
ACIVGFSTL
 MOTIF /note="DEAD box" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" MOTIF /note="DEAD box" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
373DHb 14.8 8tbx_A 
DHN
 MOTIF /note="DEAD box" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" MOTIF /note="DEAD box" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
374GHe 27.4 8tbx_A 
RLTKEGQMINSACDFHV
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
375LHb 0.0 8tbx_A 
MLFIVCT
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
376LHb 10.7 8tbx_A 
LIFMVNTY
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
377SHe 78.9 8tbx_A 
DEKMSGTANQLRYC
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
378QTe 49.0 8tbx_A 
MQDVLREIFKPSYGAHNT
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
379GTe 54.8 8tbx_A 
GESHDQAILNTMPRY
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
380Y e 31.7 8tbx_A 
FALYVDHISCEGKMPQRTW
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
381SHe 27.3 8tbx_A 
EQAGDKSILRTFNVHMY
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
382DHe 62.3 8tbx_A 
DEKPQGSFNALRTVHIY
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
383FHb 1.4 8tbx_A 
QDEFMTVNWILSAHKPCGY
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
384IHb 0.0 8tbx_A 
ILVMCTESAFKNPR
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
385NHb 20.0 8tbx_A 
REDSKNLQTPVYCIAGFHM
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
386RHe 39.1 8tbx_A 
RKDEQASTNVFHLCGIMPWY
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
387MHb 1.9 8tbx_A 
ILVMDCTAEFGQRS
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
388HHb 14.1 8tbx_A 
LVIFKRAEHMDQYGSTCNP
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
389NHe 87.3 8tbx_A 
SEKDNQRGATCHLFIMPVY
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
390QHe 51.5 8tbx_A 
RHIAELQKVCDFNSTYMGP
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
391ISb 0.6 8tbx_A 
LIMTVFACEPRSGHKNQY
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
392P e 48.1 8tbx_A 
PADSFNKTEGILQRVHMY
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
393QSe 43.4 8tbx_A 
KQRAEDSPGHLNTVIMCFWY
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
394VBe 54.0 8tbx_A 
IAVLTSQCEGKMYDFNPRH
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
395T b 14.9 8tbx_A 
TRPSAKLEFNDGIVCMQHY
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
396STe 87.5 8tbx_A 
SPARGKQTEDLNIMVCFHYW
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
397DTe 45.7 8tbx_A 
DTSANPKEIGHLQRVFCMWY
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
398GSe 65.5 8tbx_A 
GSANDKLPTERQIVCFHMWY
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
399K e 21.7 8tbx_A 
KRESPQADTVLGHIMNCFWY
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
400RBe 47.0 8tbx_A 
RKNDEQTLSGPVAHFIYCM
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
401L b 2.2 8tbx_A 
RLIVPTACKDGSYEFMNQWH
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
402QEb 5.6 8tbx_A 
QRNETDHKLMSVACGI
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
403VEb 0.7 8tbx_A 
TVLMIKAFNSGCEHQRY
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
404IEb 0.0 8tbx_A 
LVMIFAEKSTYCDG
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
405VEb 0.0 8tbx_A 
LMVFSIPACDEKTY
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
406CEb 0.0 8tbx_A 
FCVLAMSYEGPWDIKNQT
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
407SEb 0.0 8tbx_A 
STNACDEFGKP
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
408ASe 25.0 8tbx_A 
AQSEDGIKNTV
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
409TSe 41.6 8tbx_A 
TLSADFGIKMNRV
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
410LSe 44.9 8tbx_A 
LMFIVWSTADKPYCEGNQR
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
411HSe 37.7 8tbx_A 
PTANSEKQDHFGLIRVWYCM
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
412S e 26.6 8tbx_A 
SDTKPEARNQVGILFHY
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
413FHe 62.7 8tbx_A 
LAEFKSDMQRVYGPTHINWC
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
414DHe 59.9 8tbx_A 
DESKNLAGQRPTFIVMY
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
415VHb 2.0 8tbx_A 
VILFPAESDMTGKNQRY
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
416KHb 16.5 8tbx_A 
EKRQLADNSGHTPFIMVWY
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
417KHb 18.9 8tbx_A 
KERQDSAPVNTFGIHLMY
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
418LHb 1.1 8tbx_A 
LIFVMATHYCDEGKNPQSW
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
419SHb 5.5 8tbx_A 
ASTKCGIPQLMRVHDEFNY
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
420EHe 50.3 8tbx_A 
KREDQSNAGLTFMYHIPV
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
421KHe 57.1 8tbx_A 
KLQRAETSDFVGINCHMPY
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
422IHb 2.3 8tbx_A 
FILSVYGTHNKPADEMQRW
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
423M b 8.7 8tbx_A 
LMAFVGIQRCDKNPTESY
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
424HSe 40.3 8tbx_A 
NHRKQTGSEPVDFILYAM
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
425FSe 47.8 8tbx_A 
NDFKESLRTGQIAHMPVY
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
426P e 23.3 8tbx_A 
PAYSETVGIKLDFHMNQR
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
427TEe 40.9 8tbx_A 
VTELAIKRNSGYDQFHMP
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
428WEe 21.5 8tbx_A 
REYLKTVISWAFMNQDGHCP
 DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
429VEb 1.3 8tbx_A 
IVLEKRTAFMCDGNPQS
 REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
430D e 52.5 8tbx_A 
DQSTEKNRLAGIYFVHPM
 REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
431L e 58.4 8tbx_A 
LVIAETKMSGHNQRCDFPY
 REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
432K---- 
GKDLENVARSTMQFIPYH
 REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
433G---- 
GASDEKNRPTVFLHIQMY
 REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
434E---- 
EDKRSNQVIALTGHPCFMY
 REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
435D---- 
DEKSAGNLQTIPRVFHYM
 REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
436S e 80.5 8tbx_A 
SALTEKVFNQRDGPICHMWY
 REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
437V b 17.3 8tbx_A 
ALTVIMFSKDEGNQYCPR
 REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
438P e 44.2 8tbx_A 
PKVASLENGRTHQCDFIMY
 REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
439DSb 13.6 8tbx_A 
DESKLNPGVATQHIRFY
 REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
440TSe 29.9 8tbx_A 
TSNGADEIKLRQVYFPCHM
 REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
441VEb 2.7 8tbx_A 
VILAKTFGMQSDENPRY
 REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
442HEe 30.4 8tbx_A 
HEKQRTFNYDGILSAMPV
 REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
443HEb 14.1 8tbx_A 
QYHLEGISKNTVADFPRM
 REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
444VEb 18.7 8tbx_A 
VILTFYKSAEGMNRCHPQD
 REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
445VEb 0.0 8tbx_A 
VIAFLYEMSTDGKNPQRCHW
 REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
446VEb 11.3 8tbx_A 
VILGATEFMSYCDKNQRHP
 REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
447PEe 29.5 8tbx_A 
PKERSVADNFILTGQHMWYC
 REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
448VEb 0.0 8tbx_A 
VLAISCEKTFGMPDNRHQY
 REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
449N e 24.2 8tbx_A 
NGEDSKLPTAQRVFHIMYC
 REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with RELA"
450PTb 0.0 8tbx_A 
PSEKALDNQTFGRVHICMY
 REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with RELA"
451KTe 42.9 8tbx_A 
KERTDSALQGHNVFIMPYC
 REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with RELA"
452TTe 74.0 8tbx_A 
TLEKSAVFIDGPNRMQCHY
 REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with RELA"
453D b 18.5 8tbx_A 
DEKGLHSAINPQVFRTMYC
 REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with RELA"
454R e 38.3 8tbx_A 
RKNALQSTVEGIPYCDFHMW
 REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with RELA"
455LGe 23.6 8tbx_A 
LIFVATGMRSEKDNPQYCH
 REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with RELA"
456WGb 5.2 8tbx_A 
LVTFSWAKYEGIMPQDNRCH
 REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with RELA"
457EGe 34.7 8tbx_A 
EQKADLSGNRTIPVFHYCMW
 REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with RELA"
458RGe 69.2 8tbx_A 
RKLEAGSTVFIDNQYHPCMW
 REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with RELA"
459LTe 23.0 8tbx_A 
LIVAEFSGKPRYDMQTCHN
 REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with RELA"
460GSe 75.0 8tbx_A 
GASKQELNTVDFIPRCHMWY
 REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA"
461KSe 44.8 8tbx_A 
KQELRASDGPVFIMNTYCHW
 REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA"
462SSe 53.9 8tbx_A 
SLAEKTVIRGNPQYFDMCHW
 REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA"
463HSe 27.7 8tbx_A 
HYLEKADFGPSNQVRTIMC
 REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA"
464I b 9.4 8tbx_A 
LIVAEGKSTDFNPQRMYCHW
 REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA"
465R e 58.1 8tbx_A 
RKLAEIFNQSTGVDPYMCHW
 REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA"
466T b 5.8 8tbx_A 
TVSLAKEIQRDGNPCFHMWY
 REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA"
467D b 5.6 8tbx_A 
DEKPSGLAQINTVRFHYCMW
 REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA"
468DSe 40.1 8tbx_A 
DELNPAGIKSTVFQYRHCMW
 REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA"
469VTb 0.0 8tbx_A 
VLIAEGKTSYDFPRCMNQHW
 REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA"
470HTb 2.6 8tbx_A 
HEADLKRSFGIQTVYNPMCW
 REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA"
471ASe 71.4 8tbx_A 
AVSKLGITREFPCDNQYMHW
 REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA"
472KSe 42.9 8tbx_A 
KLSNRAEGDTIPQVFHYCMW
 REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA"
473DSe 33.3 8tbx_A 
DEAGLSVIKNPQRTYFHCMW
 REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA"
474N e 61.2 8tbx_A 
NSLERGKADIVQTHPFMYCW
 REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA"
475T e 26.0 8tbx_A 
TLKSVAEDGIFNPQRYCHMW
 REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA"
476RSe 31.2 8tbx_A 
KRELAVGPQSDINFTYHMCW
 REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA"
477PTe 59.7 8tbx_A 
PLSEADGIKTVFMQNRYCHW
 REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA"
478GTe 70.2 8tbx_A 
GALSEFKTVDINPQRYCHMW
 REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA"
479A b 19.6 8tbx_A 
ALSVGIEKPDFRTCNQHMYW
 REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA"
480N e 72.1 8tbx_A 
NDEKGLSTAFIQRVPYCHMW
 REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA"
481SSe 24.2 8tbx_A 
SAELKRVGQTDIPFNCHMYW
 MOD_RES /note="Phosphoserine" ECO:0007744|PubMed:21406692, ECO:0007744|PubMed:23186163" REGION /note="Necessary for interaction with RELA" MOD_RES /note="Phosphoserine" ECO:0007744|PubMed:21406692, ECO:0007744|PubMed:23186163" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA"
482PHe 59.7 8tbx_A 
PKLSADEVGRTINQCFYHMW
 REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA"
483EHe 23.6 8tbx_A 
EKADYLNRSTQFGIPVCHMW
 REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA"
484MHb 1.4 8tbx_A 
LKVIQSEMTADFGNYPRHCW
 REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA"
485WHb 14.7 8tbx_A 
LFWKVGAEIYTDNQRSCHMP
 REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA"
486SHb 0.0 8tbx_A 
SKALVEPTFINQCDGRYHM
 REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA"
487EHb 7.5 8tbx_A 
EKDQLSAIRVGNPTFHYCMW
 REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA"
488AHb 0.0 8tbx_A 
LAKVSTGIRCEPFNQDMYH
 REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA"
489IHb 0.0 8tbx_A 
LIVKDAFGSTERYPMNQCH
 REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA"
490KHb 7.1 8tbx_A 
KADERGQSVCLNPTFHIYM
 REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA"
491IHb 7.6 8tbx_A 
LIVFTKSARDEGMPCNQYH
 REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA"
492LHb 0.0 8tbx_A 
LIVAFEKMRSTDGNPQYCHW
 REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA"
493KHb 4.2 8tbx_A 
KSLRENQVAGPCDITFYHM
 DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA"
494GHb 1.2 8tbx_A 
GSDAKLNFTEPRQVCHIYM
 DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA"
495EHb 19.6 8tbx_A 
ELSKDTAGIQVFHNRPYCM
 DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA"
496YHb 7.4 8tbx_A hetero OSKA_DROME 
YFLKASVDEGITHNQRPCMW
 DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA"
497AHb 1.8 8tbx_A 
LASGKPETVDIRNQCFMYH
 DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA"
498VHb 8.0 8tbx_A 
VLIAETYKRCDFGPSMNQH
 DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA"
499RHe 38.7 8tbx_A hetero OSKA_DROME 
RKEFLSYADNVHQTGIMPC
 DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA"
500AHb 8.0 8tbx_A 
LASTVFGIKENPQRDHMYC
 DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA"
501IHb 0.6 8tbx_A 
LIVNSKAFTEGMPCDQRYH
 DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA"
502KHe 49.1 8tbx_A 
KERLSDNTAGQPFHIMVCY
 DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA"
503EHe 65.3 8tbx_A 
EKQRDNSLTACGHPVFIMY
 DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA"
504HHe 36.1 8tbx_A 
HENLGKSADFPQTVYIRMCW
 DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA"
505KTe 66.0 8tbx_A 
KEPQRLSAGTVDINYFHWCM
 DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA"
506M b 0.5 8tbx_A 
FVLGIAPTDKNQSEMRYCHW
 DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA"
507DSe 43.2 8tbx_A 
DNEGKSAPHLQTFMRVYCIW
 DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA"
508Q e 23.5 8tbx_A 
KQRSELPTADGINCFHMVY
 DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA"
509AEb 0.0 8tbx_A 
ATVISCGLEKMDFHPQR
 DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA"
510IEb 1.8 8tbx_A 
ILVAMFDEGKQRT
 DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA"
511IEb 0.6 8tbx_A 
IVLAQYCDFKMPRT
 DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA"
512FEb 0.5 8tbx_A 
FYLDAEHIRSTV
 DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA"
513C b 1.3 8tbx_A hetero GLE1_YEAST precipitant 
VCFLTASGIDEMNR
 DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA"
514RSe 22.9 8tbx_A hetero GLE1_YEAST precipitant 
NRSKEAPLQTHVDGFIM
 DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA"
515TSb 18.8 8tbx_A hetero CWC22_HUMAN metal CL precipitant 
TSEIRKNHLQVYACDFMP
 DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA"
516KHe 34.0 8tbx_A hetero CWC22_HUMAN metal CL precipitant 
KRATQCIVELNSDGHPY
 DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA"
517IHe 37.4 8tbx_A hetero OSKA_DROME CWC22_HUMAN 
KREIAHVDTLNQSFMCGY
 DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA"
518DHe 21.6 8tbx_A 
DREKTSANVGHMPQFILY
 DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA"
519CHb 0.0 8tbx_A 
ACVTLSDEGIKMNPQR
 DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA"
520DHe 25.9 8tbx_A hetero OSKA_DROME 
DEQHNAKSTIRGLVYFMP
 DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA"
521NHb 18.8 8tbx_A hetero OSKA_DROME 
SERLYADFKNWTVGHIQCMP
 DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA"
522LHb 2.8 8tbx_A 
LVIFMYARSCEHPQT
 DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA"
523EHb 5.5 8tbx_A hetero OSKA_DROME 
AESTLYDHRVIKNFGMQWCP
 DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA"
524QHe 53.1 8tbx_A hetero OSKA_DROME 
KREDSAQTYIGHLNVPCFM
 DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA"
525YHb 12.2 8tbx_A hetero OSKA_DROME 
LYFKTEIADRVQWGHMNPS
 DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with RELA"
526FHb 0.0 8tbx_A 
LFIMARYKSTVCDEGHNPQ
 DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
527IHe 41.5 8tbx_A hetero OSKA_DROME 
LTRIVAKSFGMNEQCDHPY
 DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
528QHe 49.5 8tbx_A hetero OSKA_DROME 
EQLRAKSDNTGMVFHIPYC
 DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
529QTe 28.6 8tbx_A hetero OSKA_DROME 
LQKERADSFTINPVGHMYCW
 DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
530GTe 35.7 8tbx_A 
GALPSDEFNRTIKQVYCHMW
 DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
531G b 4.8 8tbx_A 
GLADEPSKTINVCFQRHMYW
 DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
532GBb 1.2 8tbx_A 
GALKINSVDPTERFHQYWCM
 DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
533PTe 22.5 8tbx_A 
PLTKSVAEGIDRFNQHMYCW
 DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
534DTe 91.4 8tbx_A 
DELSPAKNQTVGIRFHMYCW
 DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
535KSe 42.0 8tbx_A 
KALVEQRGIPSTDNYFHMCW
 DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
536KTe 67.9 8tbx_A hetero GLE1_YEAST 
KRLEADSFNPGITVQHYCMW
 REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
537GTe 40.5 8tbx_A hetero GLE1_YEAST 
GASELKNQTDRVIPFHYCMW
 REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
538H e 48.7 8tbx_A hetero GLE1_YEAST CWC22_HUMAN 
HLKRSNADEGPVTCIMQYFW
 REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
539QTe 48.0 8tbx_A hetero OSKA_DROME CWC22_HUMAN 
QKNDRELSGAPTHIVFYCMW
 REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
540FTb 2.9 8tbx_A hetero CWC22_HUMAN 
FYILVAEHMWDPRSCGKNQT
 REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
541SBb 0.0 8tbx_A hetero CWC22_HUMAN 
PSKTADNEGRLQVFICHMY
 REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
542CEb 0.0 8tbx_A hetero OSKA_DROME 
AVCLSITNEFKDGHPQRY
 REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
543VEb 0.0 8tbx_A hetero OSKA_DROME 
LIVASTFGYEMPRKCDHNQW
 REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
544CEb 0.0 8tbx_A hetero OSKA_DROME 
ASEYPTCGLRVHIKDFMNQ
 REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
545LEb 3.9 8tbx_A 
LIYVFMSAKDEGNPRT
 REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
546HSb 1.0 8tbx_A hetero OSKA_DROME nucleotide 
HYSTENAPFIKLQR
 REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
547GTe 63.1 8tbx_A hetero GLE1_YEAST OSKA_DROME nucleotide 
GSAREFHKLQT
 REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
548DTe 62.3 8tbx_A hetero OSKA_DROME CWC22_HUMAN nucleotide 
DGKSENQRAPVCHLTY
 REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
549RSb 11.1 8tbx_A hetero OSKA_DROME 
LMKRQVIHSTYADEFN
 REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
550K e 35.8 8tbx_A hetero OSKA_DROME nucleotide 
DSKTPAERNQGILHV
 REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
551PHe 70.5 8tbx_A 
QPADGKSVETFILMNRY
 REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
552HHe 63.4 8tbx_A 
QESTKHNRADGLVFIMPY
 REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
553EHe 29.1 8tbx_A hetero OSKA_DROME 
EAQDKSGRVHINTLMPY
 REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
554RHe 35.2 8tbx_A hetero GLE1_YEAST OSKA_DROME nucleotide 
RNSDHKPQTY
 REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
555KHe 57.1 8tbx_A 
EDLKTRNQSAIGMPFVY
 REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
556QHe 48.5 8tbx_A 
KRESAGQNDITWHFLMVY
 REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
557NHb 10.3 8tbx_A 
ITVANSLQRGMDEKP
 REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
558LHb 15.7 8tbx_A 
LIFVMQTYEKPSAGH
 REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
559EHe 40.2 8tbx_A precipitant 
KEAQDHNSRTGFLMVWY
 REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
560RHe 26.9 8tbx_A 
DEKRQASGNLTFHMP
 REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
561FHb 1.4 8tbx_A 
FWLDYAGIMPRSV
 REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
562KHe 57.5 8tbx_A hetero GLE1_YEAST precipitant 
RKSTGLINPAFQVCEM
 REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
563KTe 75.5 8tbx_A hetero GLE1_YEAST 
NKESATDQRGLCFHIMPV
 REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
564GTe 60.7 8tbx_A hetero GLE1_YEAST CWC22_HUMAN 
GSAFNQDTKLRCEHIMPVY
 REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
565DSb 9.3 8tbx_A hetero GLE1_YEAST CWC22_HUMAN 
KDEANSLQRVGHTIMPY
 REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
566VSb 0.7 8tbx_A hetero OSKA_DROME 
SITVKYALNCFPGHRQDEM
 REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
567RSe 27.3 8tbx_A hetero GLE1_YEAST CWC22_HUMAN 
RNPDKSEGACLQTVWYFHIM
 REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
568FEb 0.0 8tbx_A 
IVLFACNQYGMSTDEKPR
 REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
569LEb 1.1 8tbx_A 
LIMVGCADEFKPRST
 REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
570IEb 0.0 8tbx_A 
VILFACDEGKMPST
 REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
571CEb 2.0 8tbx_A 
ACTSVGDEIKLPR
 REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
572T b 8.4 8tbx_A hetero GLE1_YEAST nucleotide 
TSANDEGIKLPQRV
 REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
573DHe 27.2 8tbx_A hetero GLE1_YEAST CWC22_HUMAN nucleotide metal CL 
DQNEASTVGKILPR
 REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
574VHe 84.7 8tbx_A hetero GLE1_YEAST CWC22_HUMAN nucleotide precipitant 
VLAIMDEGPRSKNQT
 REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
575AHb 14.3 8tbx_A hetero CWC22_HUMAN metal ZN 
ALFTVISGMCWDEKNPQR
 REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
576AHb 6.2 8tbx_A 
ASGTEVDFIKLNPQR
 REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
577RHe 34.4 8tbx_A metal CL 
RNLMKADEFGIPQSTV
 REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
578GHe 85.7 8tbx_A 
GCADEFIKLNPQRSTV
 REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
579I b 8.8 8tbx_A 
ILVYMFTADEGKNPQRS
 REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
580D e 50.0 8tbx_A 
DNRHGAEFIKLPQSTV
 REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
581I b 17.0 8tbx_A 
IVFLHKMYQTARSDEGNP
 REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
582H e 39.3 8tbx_A hetero GLE1_YEAST 
PSKAQEYLNDGMRTVHI
 REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
583G e 26.2 8tbx_A hetero GLE1_YEAST 
NGDTASREKQHIVLMPY
 REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
584VBb 1.3 8tbx_A 
VILHAFTCM
 REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
585PSb 4.7 8tbx_A 
DKSENRTAPQHCFGI
 REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
586YEb 15.7 8tbx_A hetero CIC1_YEAST 
LHYVNPAFTWCIMQDEGRS
 REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
587VEb 0.0 8tbx_A 
VRAIM
 REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
588IEb 1.2 8tbx_A 
IVLHFYAM
 REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
589NEb 0.0 8tbx_A 
NQHLEFSCIMTV
 REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
590VSb 11.3 8tbx_A 
YFLVIMAHWC
 REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
591TSb 5.2 8tbx_A metal CL precipitant 
DGRSNTEHQCFM
 REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
592L b 0.6 8tbx_A precipitant 
LFVMPIACSTY
 REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
593P b 1.6 8tbx_A precipitant 
PASCLTV
 REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
594DSe 44.4 8tbx_A hetero GLE1_YEAST CWC22_HUMAN precipitant 
DKNTFSRALQEPGHYIMV
 REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
595ESe 58.8 8tbx_A hetero GLE1_YEAST CWC22_HUMAN nucleotide 
DSTNEHKQAGILMPRV
 REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
596KTe 35.4 8tbx_A 
PAISTVLYFKRCDMGHNW
 REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
597QHe 44.4 8tbx_A hetero GLE1_YEAST CWC22_HUMAN metal ZN 
EDKSARVIQTMLNP
 REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
598NHb 18.8 8tbx_A hetero CWC22_HUMAN 
DNTSEIQAVGFKLCHM
 REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
599YHb 1.3 8tbx_A 
YFLHI
 REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
600VHe 20.7 8tbx_A metal ZN 
VILCTAHMRY
 REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
601HHe 67.0 8tbx_A hetero CWC22_HUMAN metal ZN CL 
HQSRN
 REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
602RHb 1.6 8tbx_A precipitant 
RSEHQAKTV
 REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
603IHb 1.8 8tbx_A 
VISACLMTF
 REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
604GTe 44.0 8tbx_A 
GSA
 REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
605RTb 17.0 8tbx_A 
REQY
 REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
606VBb 2.7 8tbx_A 
TASDVGIL
 REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
607G b 13.1 8tbx_A 
GAS
 REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
608R e 47.8 8tbx_A 
RPHQ
 REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
609ATe 75.9 8tbx_A 
AFRMGHDLYNSCEIKTV
 REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
610ETe 27.6 8tbx_A 
GNWEDSTAKLR
 REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
611RSe 33.6 8tbx_A hetero GLE1_YEAST 
RKANQTEHSFV
 REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
612M e 31.4 8tbx_A 
KESTPRADLVNQGHIMWY
 REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
613GEb 1.2 8tbx_A 
GASCK
 REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
614LEb 15.7 8tbx_A 
LVTRKEIFSHACMNQWDGY
 REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
615AEb 0.0 8tbx_A 
ASGVCKRT
 REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
616IEb 2.3 8tbx_A 
IVLYTFAHCMRW
 REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
617SEb 0.0 8tbx_A 
TSLNVQAIMYCFG
 REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
618LEb 1.1 8tbx_A 
FLIPMVTY
 REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
619VEb 0.0 8tbx_A 
VILFCAMYGT
 REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
620AEb 0.9 8tbx_A 
TSALQDGNCEHVFIPYKMR
 REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
621TSe 23.4 8tbx_A 
PTSEDKNGQLVYAHIMRW
 REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
622ESe 31.7 8tbx_A 
EKDQTCPSGNRHYALMVW
 REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
623K e 57.5 8tbx_A 
EDRKQNSGAPTYH
 REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
624EEb 6.0 8tbx_A 
EDRSKALVTGHIMNPQ
 REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
625KEb 8.5 8tbx_A 
KREADQSNFGYHILMPTV
 REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
626VEb 2.7 8tbx_A 
VILASMTFKDEGNYPHQR
 REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
627WEb 8.8 8tbx_A 
FLWYSVMAGIKPRDEQ
 REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
628Y e 27.4 8tbx_A 
YLVRFHKEADISGMWPQT
 REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
629H e 30.9 8tbx_A metal ZN 
DRKHESANITGLPQYMV
 REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
630V e 67.3 8tbx_A 
ILVAFMKTRSDEGPW
 REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
631CSe 24.0 8tbx_A metal ZN 
LEAICTKVMDSGPQRFNY
 REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
632STe 85.2 8tbx_A 
KSNAEQRLDGTIPVFHY
 DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
633STe 46.1 8tbx_A 
SATEVKDILRGMHNQFPY
 DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
634RTe 53.0 8tbx_A 
RKLIEAVDQSTFHNGMPY
 DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
635GTe 23.8 8tbx_A 
GQASNDLVIKRPTEFHMY
 DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
636KTe 40.6 8tbx_A 
KERSVQAGPTDILNFHY
 DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
637GTe 72.6 8tbx_A 
GKQSAFNRVDEPLTIY
 DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
638C b 15.3 8tbx_A metal ZN 
CLAVFKGSYIMQDHNRTWEP
 DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
639Y e 80.4 8tbx_A 
YELFKIHSQTADGNRVMPW
 DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
640N e 47.9 8tbx_A 
NESKLGDVAIMPQRFHT
 DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
641T e 31.8 8tbx_A 
TLSVEIRYDGHANPFKQ
 DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
642RSb 13.8 8tbx_A 
RKQESDTVNLHPAGI
 DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
643LBe 32.0 8tbx_A 
ILVRCDKMSGPTYAEFNQ
 DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
644KGe 27.8 8tbx_A 
EKDINTVHSAPRQGL
 DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
645EGe 52.8 8tbx_A 
EKADSRPVMQTGILNW
 DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
646DGe 48.1 8tbx_A 
DEHANVQPLGKSMFIRTY
 DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
647GTe 70.2 8tbx_A 
GAKSVMDNREPLQTFIY
 DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
648G b 0.0 8tbx_A 
GDESVLKRTAINMFPQY
 DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
649CSb 3.3 8tbx_A metal ZN 
VCEKALNSRTDFPQYIG
 DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
650TEb 0.0 8tbx_A 
TSVDENKQACHLYFGIPR
 DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
651IEe 32.7 8tbx_A 
ILDSVKEFMAGNQRPTY
 DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
652WEe 29.5 8tbx_A 
WFLERDTAQGIKSVPNY
 DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
653YEb 8.3 8tbx_A 
LYPERVFHQAMKSWDGINT
 DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
654N e 38.8 8tbx_A 
NEAKIDHVGLSTFPQR
 DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
655EHb 2.0 8tbx_A 
EQDKSVNFLIRAGPT
 DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
656MHe 28.0 8tbx_A 
MVLKRAIPFSEDQTGN
 DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
657QHe 48.0 8tbx_A 
QEDKRNPAHSTGML
 DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
658LHb 13.5 8tbx_A 
LAIEMKRVNSG
 DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
659LHb 1.1 8tbx_A 
LVIFTYRAMPSDEQ
 DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
660SHe 38.3 8tbx_A 
SATNQDKEMVLPGR
 DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
661EHe 32.2 8tbx_A 
EKQRDPAGLSV
 DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
662IHb 1.2 8tbx_A 
ILVAKEMNRDGPST
 DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
663EHb 14.1 8tbx_A 
EDKQVFLAPRGINST
 DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
664EHe 69.3 8tbx_A 
EDPKARQSNTGLV
 DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
665HHe 52.9 8tbx_A 
HRSPQKNYEIVMADGLT
 DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
666LTb 11.8 8tbx_A 
LVFYICMAKEGST
 DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
667NTe 80.0 8tbx_A 
NDETARSGIKYQLPV
 DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
668CSb 20.0 8tbx_A 
ACISTKQEVDFPGLR
 DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
669T e 79.2 8tbx_A 
TSVAEINRKQGL
 DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
670I b 3.5 8tbx_A 
ILVKQMEFSTAG
 DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
671S e 46.9 8tbx_A 
SEQRKDANVGL
 DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
672QBe 57.7 8tbx_A 
EQRGLPKDAF
 DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
673V e 78.7 8tbx_A 
VLIAMRK
 DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
674E---- 
EDRSHPTV
 DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
675P---- 
PKESACIDMT
 DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
676D---- 
DESKTPNQV
 DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
677I---- 
IVSLERAFM
 DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
678K---- 
KPQDRL
 DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
679V---- 
VKLENTFIA
 DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
680P---- 
EPKAVMNGLS
 DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
681V---- 
VLNAISKMEG
 DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
682D---- 
DKNRS
 REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK"
683E---- 
EDFGHSMA
 REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK"
684F---- 
FKHLM
 REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK"
685D---- 
DSKPLQR
 REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK"
686G---- 
GEKL
 REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK"
687K---- 
KQAGN
 REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK"
688V---- 
VQNIKF
 REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK"
689T---- 
TKVELG
 REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK"
690Y---- 
YSHKG
 REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK"
691G---- 
GSADEFIKLNPQRTVY
 REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK"
692Q---- 
QRKTADEFGILNPSVY
 REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK"
693K---- 
KARDEFGILNPQSTVY
 REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK"
694R---- 
RNLADEFGIKPQSTVY
 REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK"
695A---- 
APLTDEGKSVCFHIMNQRY
 REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK"
696A---- 
AVGNRLTDEKSCFHIMPQY
 REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK"
697G---- 
GLNAMT
 REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK"
698G---- 
GS
 REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK"
699G---- 
GAQYST
 REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK"
700S---- 
ATEGDLSIKNPQRV
 REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK"
701Y---- 
YCK
 REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK"
702K---- 
KRLES
 REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK"
703G---- 
GRDP
 REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK"
704H---- 
HQ
 REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK"
705V---- 
VEDTAFGIKLNPQRSY
 REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK"
706D---- 
DERAFGIKLNPQSTVY
 REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK"
707I---- 
AIMQEDFGKLNPRSTVY
 REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK"
708L---- 
LAGDEFIKNPQRSTVY
 REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK"
709A---- 
APRGVLDEFIKNQSTY
 REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK"
710P---- 
PS
 REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK"
711T---- 
TR
 REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK"
712V---- 
VS
 REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with HNRNPK"
713Q---- 
QRL
 REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with HNRNPK"
714E---- 
EAGKQ
 REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK"
715L---- 
LFQ
 REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK"
716A---- 
ADPTS
 REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with HNRNPK"
717A---- 
QAMDE
 REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK"
718L---- 
LTQ
 REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK"
719E---- 
EP
 REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with HNRNPK"
720K---- 
EKPL
 REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with HNRNPK"
721E---- 
QEAT
 REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with HNRNPK"
722A---- 
AIS
 REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with HNRNPK"
723Q---- 
QEN
 REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with HNRNPK"
724T---- 
TSI
 REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with HNRNPK"
725S---- 
LSGD
 REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with HNRNPK"
726F---- 
FYL
 REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with HNRNPK"
727L---- 
LC
 REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with HNRNPK"
728H---- 
HYT
 REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with HNRNPK"
729L---- 
L
 REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with HNRNPK"
730G---- 
GE
 REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with HNRNPK"
731Y---- 
YL
 REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with HNRNPK"
732L---- 
LH
 REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with HNRNPK"
733P---- 
PS
 REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with HNRNPK"
734N---- 
NR
 REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with HNRNPK"
735Q---- 
Q
 REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with HNRNPK"
736L---- 
L
 REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with HNRNPK"
737F---- 
F
 REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with HNRNPK"
738R---- 
R
 REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with HNRNPK"
739T---- 
T
 REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with HNRNPK"
740F---- 
F
 REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with HNRNPK"