Contact Molecules for Homologous Proteins | ||||
[Summary Bars] |
[Full Bars] |
|
[Back to Search Page] |
[Back to HOMCOS] |
[Sites by Variants] |
[SupCon3D] |
[help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
4093023 | 740 | 417 | Q92499(DDX1_HUMAN) | RecName: Full=ATP-dependent RNA helicase DDX1; EC=3.6.4.13 ;AltName: Full=DEAD box protein 1;AltName: Full=DEAD box protein retinoblastoma; Short=DBP-RB; |
QUERYSEQ |
MAAFSEMGVMPEIAQAVEEMDWLLPTDIQAESIPLILGGGDVLMAAETGSGKTGAFSIPVIQIVYETLKDQQEGKKGKTTIKTGASVLNKWQMNPYDRGSAFAIGSDGLCCQSREVKEWHGCRATKGLMKGKHYYEVSCHDQGLCRVGWS TMQASLDLGTDKFGFGFGGTGKKSHNKQFDNYGEEFTMHDTIGCYLDIDKGHVKFSKNGKDLGLAFEIPPHMKNQALFPACVLKNAELKFNFGEEEFKFPPKDGFVALSKAPDGYIVKSQHSGNAQVTQTKFLPNAPKALIVEPSRELAE QTLNNIKQFKKYIDNPKLRELLIIGGVAARDQLSVLENGVDIVVGTPGRLDDLVSTGKLNLSQVRFLVLDEADGLLSQGYSDFINRMHNQIPQVTSDGKRLQVIVCSATLHSFDVKKLSEKIMHFPTWVDLKGEDSVPDTVHHVVVPVNP KTDRLWERLGKSHIRTDDVHAKDNTRPGANSPEMWSEAIKILKGEYAVRAIKEHKMDQAIIFCRTKIDCDNLEQYFIQQGGGPDKKGHQFSCVCLHGDRKPHERKQNLERFKKGDVRFLICTDVAARGIDIHGVPYVINVTLPDEKQNYV HRIGRVGRAERMGLAISLVATEKEKVWYHVCSSRGKGCYNTRLKEDGGCTIWYNEMQLLSEIEEHLNCTISQVEPDIKVPVDEFDGKVTYGQKRAAGGGSYKGHVDILAPTVQELAALEKEAQTSFLHLGYLPNQLFRTF |
[n]:site number of query sequence. [a]:amino acid of query sequence. [s]:predicted secondary structure. [e]:predicted exposed/buried. [acc]:predicted relative accesssibility(%). [pdb]:PDB code of homologous structure. [contact_mols]:predicted binding molecules [observed aa]:Observed amino acids among homologous sequences. [feature table]:UniProt Feature Table [variant]:UniProt Human Variant.
n | a | s | e | acc | pdb | contact_mols | observed aa | feature table | variant |
1 | M | T | e | 28.5 | 8tbx_A | IMVLF |
REGION /note="Necessary for interaction with HNRNPK" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
2 | A | H | e | 47.3 | 8tbx_A | hetero Q38FJ3_TRYB2 nucleotide precipitant | STAKRLPQEMGN |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
3 | A | H | b | 11.6 | 8tbx_A | hetero A0A1G4IEQ9_TRYEQ Q57ZS6_TRYB2 nucleotide | STAKGREQCDHLN |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
4 | F | H | b | 0.0 | 8tbx_A | compound ADP AMP ANP 8OP 8OD 8OX M2A ATP | FWIL |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
5 | S | H | e | 28.9 | 8tbx_A | hetero RBM8A_HUMAN GLE1_YEAST CNOT1_HUMAN A0A1G4IEQ9_TRYEQ Q57ZS6_TRYB2 A0A3L6L538_9TRYP THO2_YEAST nucleotide metal MG NA homo precipitant | SEADKQTNHRVGL |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
6 | E | T | e | 82.9 | 8tbx_A | hetero RBM8A_HUMAN THO2_YEAST Q586A6_TRYB2 metal NA homo precipitant | EDSQANHTGIP |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
7 | M | T | b | 17.9 | 8tbx_A | hetero CWC22_HUMAN THO2_YEAST NOC3L_HUMAN metal NA homo precipitant | LFMCISAYPVT |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
8 | G | T | e | 52.4 | 8tbx_A | hetero RBM8A_HUMAN Q586A6_TRYB2 THO2_YEAST CWC22_HUMAN A0A3L6L538_9TRYP homo precipitant | GNPDKQSACEFHLRTY |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
9 | V | b | 3.3 | 8tbx_A | hetero RBM8A_HUMAN Q586A6_TRYB2 THO2_YEAST | LIVFCMER |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
10 | M | b | 12.6 | 8tbx_A | hetero RBM8A_HUMAN Q586A6_TRYB2 A0A3L6L538_9TRYP metal CL homo | SHKPDGNTVELQRAICM |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
11 | P | H | e | 52.7 | 8tbx_A | hetero RBM8A_HUMAN CWC22_HUMAN CNOT1_HUMAN THO2_YEAST PRP8_HUMAN homo | PEDRSKAQTGNVY |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
12 | E | H | e | 41.7 | 8tbx_A | hetero homo | EPRWDKQSLNTAHFIYGV |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
13 | I | H | b | 0.0 | 8tbx_A | LIVTMAS |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
14 | A | H | b | 0.0 | 8tbx_A | hetero RBM8A_HUMAN CWC22_HUMAN CNOT1_HUMAN Q586A6_TRYB2 A0A3L6L538_9TRYP homo | LIVMACRSKQTEFGHNY |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
15 | Q | H | e | 35.7 | 8tbx_A | hetero CWC22_HUMAN GLE1_YEAST CNOT1_HUMAN THO2_YEAST RBM8A_HUMAN PRP8_HUMAN nucleotide homo | KREQDSAHMGLNIT |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
16 | A | H | b | 0.0 | 8tbx_A | homo | AGNSTVELRIKQ |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
17 | V | H | b | 0.0 | 8tbx_A | LIVCAFKMQ |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
18 | E | H | e | 39.2 | 8tbx_A | hetero RBM8A_HUMAN GLE1_YEAST CNOT1_HUMAN CWC22_HUMAN nucleotide homo | KEYASDNRTQFLGHIMPV |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
19 | E | T | e | 46.2 | 8tbx_A | hetero CWC22_HUMAN CNOT1_HUMAN THO2_YEAST nucleotide metal ZN homo | EKDARSQNLTGFV |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
20 | M | T | e | 28.0 | 8tbx_A | compound ANP AMP ADP M2A SAU ATP homo precipitant | LMAKSYIQVFNCEGT |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
21 | D | T | e | 82.7 | 8tbx_A | hetero GLE1_YEAST nucleotide compound ADP AMP ANP homo precipitant | GKNEADHRSLPQ |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
22 | W | e | 27.1 | 8tbx_A | hetero GLE1_YEAST compound ADP ANP AMP ATP 8OP 8OD 8OX CDP GDP UDP M2A SAU FPJ homo precipitant | FYIWLVDKMS |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
23 | L | e | 46.6 | 8tbx_A | hetero CWC22_HUMAN GLE1_YEAST CNOT1_HUMAN A0A1G4IEQ9_TRYEQ Q57ZS6_TRYB2 nucleotide compound ADP ANP AMP GDP homo precipitant | EKTNVDSALQRMPYGHI |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
24 | L | S | e | 66.3 | 8tbx_A | hetero MGN_HUMAN A0A1G4IEQ9_TRYEQ Q57ZS6_TRYB2 nucleotide compound ADP ANP AMP ATP 8OP 8OD 8OX CDP GDP UDP M2A FPJ homo precipitant | KRETAVNQHSFLYDIM |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
25 | P | e | 23.3 | 8tbx_A | hetero THO2_YEAST MGN_HUMAN compound ADP ANP AMP 8OP 8OD ATP 8OX GDP UDP M2A | PMLVCATS |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
26 | T | e | 30.5 | 8tbx_A | hetero MGN_HUMAN MGN2_HUMAN compound ADP ANP AMP 8OP 8OD ATP 8OX CDP GDP UDP M2A FPJ homo precipitant | TSRAKM |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
27 | D | H | e | 84.6 | 8tbx_A | hetero MGN_HUMAN MGN2_HUMAN A0A6A5Q2X9_YEASX homo precipitant | PAEDLSTKHQVGR |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
28 | I | H | b | 2.3 | 8tbx_A | precipitant | IVT |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
29 | Q | H | b | 3.1 | 8tbx_A | compound ADP ANP AMP ATP 8OP 8OD 8OX CDP GDP UDP M2A FPJ precipitant | QN |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
30 | A | H | e | 39.3 | 8tbx_A | hetero THO2_YEAST THOC2_HUMAN A0A6A5Q2X9_YEASX MGN_HUMAN nucleotide homo precipitant | ASFKREQMCGILNTV |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
31 | E | H | e | 50.8 | 8tbx_A | hetero MGN_HUMAN MGN2_HUMAN A0A6A5Q2X9_YEASX nucleotide homo precipitant | ADKREQSYLVGHIMNT |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
32 | S | H | b | 0.0 | 8tbx_A | nucleotide | ASTNCGMVIL |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
33 | I | H | b | 0.0 | 8tbx_A | ILVWFM |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
34 | P | H | e | 41.1 | 8tbx_A | hetero THO2_YEAST THOC2_HUMAN nucleotide homo precipitant | PLMSFGKNRTV |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
35 | L | H | e | 29.8 | 8tbx_A | hetero A0A6A5Q2X9_YEASX THO2_YEAST nucleotide homo precipitant | LIPVQAEHMSTYFGKR |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
36 | I | H | b | 0.0 | 8tbx_A | hetero CWC22_HUMAN | IALYVFSGTCM |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
37 | L | H | e | 24.2 | 8tbx_A | hetero NOC3L_HUMAN CWC22_HUMAN precipitant | LIMACFQRSTVY |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
38 | G | T | e | 79.8 | 8tbx_A | hetero THO2_YEAST NOC3L_HUMAN CWC22_HUMAN Q385V2_TRYB2 RL30_YEAST G0SEI0_CHATD nucleotide compound IHP homo precipitant | QSKAEDGNTLRCHM |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
39 | G | T | e | 36.9 | 8tbx_A | hetero RL30_YEAST G0SEI0_CHATD CWC22_HUMAN RM38_HUMAN compound IHP metal MG precipitant | GNKREHSDQ |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
40 | G | e | 45.2 | 8tbx_A | hetero Q385V2_TRYB2 RM38_HUMAN NOC3L_HUMAN G0SEI0_CHATD nucleotide metal MG homo precipitant | RKHQTEGLNPSVADIY |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
41 | D | b | 4.3 | 8tbx_A | hetero RM38_HUMAN metal MG | DNSEHAGIKLPRTV |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
42 | V | E | b | 0.7 | 8tbx_A | VILCAMTDEGKNPRS |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
43 | L | E | b | 0.0 | 8tbx_A | hetero G0S7E9_CHATD homo | ILVMAFCDEGKNPRST |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
44 | M | E | b | 0.0 | 8tbx_A | GAVILCSDEKMNPRT |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
45 | A | E | b | 2.7 | 8tbx_A | precipitant | QACKGIVRELMSDTHNP |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
46 | A | b | 4.5 | 8tbx_A | metal MG precipitant | ASDGEIKLNPRTV |
BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
47 | E | e | 73.4 | 8tbx_A | hetero MGN_HUMAN MGN2_HUMAN compound ADP ANP ATP AMP CDP GDP UDP M2A homo precipitant | QKERVPSADHFGILNTY |
BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
48 | T | T | e | 70.8 | 8tbx_A | compound ADP ANP AMP ATP 8OD CDP M2A metal NA MG CL homo precipitant | TSNC |
BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
49 | G | T | e | 91.7 | 8tbx_A | compound ADP ANP AMP ATP 8OP 8OD 8OX CDP GDP UDP M2A SAU FPJ metal MG CL homo precipitant | GNS |
BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
50 | S | S | b | 15.6 | 8tbx_A | hetero MGN_HUMAN compound ADP ANP AMP ATP 8OP 8OD 8OX CDP GDP UDP M2A SAU FPJ metal MG CL homo precipitant | STYAM |
BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
51 | G | S | e | 21.4 | 8tbx_A | compound ADP ANP AMP ATP 8OP 8OD 8OX CDP GDP UDP M2A SAU FPJ metal MG CL homo precipitant | G |
BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
52 | K | H | b | 2.8 | 8tbx_A | compound ADP ANP AMP 8OP ATP 8OD 8OX CDP GDP UDP M2A metal MG CL precipitant | KE |
MUTAGEN /note="K->N: Abolishes ability to promote guanylylation of RTCB." BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" MUTAGEN /note="K->N: Abolishes ability to promote guanylylation of RTCB." BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
53 | T | H | b | 7.8 | 8tbx_A | compound ADP ANP AMP ATP 8OP 8OD 8OX CDP GDP UDP M2A metal MG precipitant | TNS |
BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
54 | G | H | b | 3.6 | 8tbx_A | compound ADP ANP AMP 8OP 8OD ATP 8OX CDP GDP metal MG precipitant | ALVGHIMFS |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
55 | A | H | b | 0.0 | 8tbx_A | ALSGTVMC |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
56 | F | H | b | 0.0 | 8tbx_A | FYRI |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
57 | S | H | b | 1.6 | 8tbx_A | LSAVGICTM |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
58 | I | H | b | 0.0 | 8tbx_A | ILDVFAGTW |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
59 | P | H | b | 0.8 | 8tbx_A | PSGATIL |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
60 | V | H | b | 0.7 | 8tbx_A | IVLMARCTFS |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
61 | I | H | b | 0.6 | 8tbx_A | LIVWFCMAE |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
62 | Q | H | b | 5.1 | 8tbx_A | hetero CWC22_HUMAN A0A3L6L538_9TRYP THO2_YEAST | ACDEHIKLMNQRSV |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
63 | I | H | b | 13.5 | 8tbx_A | precipitant | YKFLHQANRSEGIMTVC |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
64 | V | H | b | 1.3 | 8tbx_A | ILVACMSWYEHT |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
65 | Y | H | b | 17.0 | 8tbx_A | LYFSDWAEHIKMQRVCNPTG |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
66 | E | H | e | 43.2 | 8tbx_A | EKQDRHSNPTAYIL |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
67 | T | H | b | 10.4 | 8tbx_A | hetero RL30_YEAST | TSHKLNEQRYACPVDFGIW |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
68 | L | H | b | 17.4 | 8tbx_A | LRAEIPGKMNSDVYHQ |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
69 | K | T | e | 32.5 | 8tbx_A | hetero E9Q238_MOUSE nucleotide | KRPNALSEGQYDFHIMV |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
70 | D | T | e | 88.3 | 8tbx_A | DEASKNPQTHLRVGIM |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
71 | Q | e | 58.7 | 8tbx_A | QKSPRLTDEINAVCFMY |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |||
72 | Q | b | 4.6 | 7pli_G | QRETDNAKSPCFHILMV |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |||
73 | E | T | e | 83.4 | 4kbf_A | EPKTQLNDAMSVYHIRG |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
74 | G | T | e | 26.2 | 4kbf_A | GLASENTDHKPFMQR |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
75 | K | b | 14.2 | 4kbf_A | hetero RL27A_YEAST | KRAIEPNLQCGSVY |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
76 | K | e | 39.2 | 4kbf_A | KREAIQDLPSYFGNT |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |||
77 | G | b | 4.7 | 4kbf_A | GPNTAKSDEFIR |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |||
78 | K | S | b | 14.6 | 4kbf_A | KPEARLNQSTHDMCGV |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
79 | T | E | b | 0.0 | 4kbf_A | TSARGVLEDKPIMQ |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
80 | T | E | b | 0.6 | 4kbf_A | TASPVIKERYGL |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
81 | I | E | b | 0.0 | 4kbf_A | IVATLREGSFMDN |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
82 | K | E | b | 0.6 | 4kbf_A | KRGPQENAYCLSIV |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
83 | T | b | 0.0 | 4kbf_A | TPALIEDGSKQRV |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |||
84 | G | - | - | - | - | GAILNPSTFVEK |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
85 | A | - | - | - | - | AIVKGQTEHLS |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
86 | S | e | 89.1 | 4xw3_B | SLRVPQAGT |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |||
87 | V | G | e | 22.7 | 4xw3_B | IPVATEGLY |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
88 | L | G | b | 7.9 | 4xw3_B | LTVIPGK |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
89 | N | G | e | 57.0 | 4xw3_B | SRNDQTHLY |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
90 | K | S | e | 51.9 | 4xw3_B | ESIGKHRTPADLV |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
91 | W | S | b | 9.6 | 4xw3_B | LWYIFADEGKNPQRSTV |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
92 | Q | S | b | 12.8 | 4xw3_B | AQGETHIKDFLNPRSV |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
93 | M | E | b | 0.0 | 4xw3_B | LMYVAGS |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
94 | N | E | b | 0.0 | 4xw3_B | NQDEGSAV |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
95 | P | E | e | 22.5 | 4xw3_B | PILADFQKST |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
96 | Y | E | e | 36.5 | 4xw3_B | YNMEHPLIFQ |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
97 | D | E | b | 0.0 | 4xw3_B | DANKMTCE |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
98 | R | E | e | 31.6 | 4xw3_B | QRKPENV |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
99 | G | b | 1.2 | 4xw3_B | DGSILYV |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |||
100 | S | T | e | 69.5 | 4xw3_B | STQKLNVEHD |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
101 | A | T | e | 28.6 | 4xw3_B | KANDISYGHR |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
102 | F | E | b | 0.5 | 4xw3_B | FLYMHADEGIKNPQRSTV |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
103 | A | E | e | 38.4 | 4xw3_B | AKPESTGNDFILQRV |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
104 | I | E | e | 20.5 | 4xw3_B | LAIKPSVDEGNQRT |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
105 | G | e | 38.1 | 4xw3_B | ADGNRSTMEIKLPV |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |||
106 | S | T | e | 107.8 | 4xw3_B | SGENIPARTVM |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
107 | D | T | e | 35.8 | 4xw3_B | DETGNVAHKL |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
108 | G | S | b | 1.2 | 4xw3_B | GANEKRLSV |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
109 | L | b | 12.4 | 4xw3_B | LVMTCIF |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |||
110 | C | E | e | 21.3 | 4xw3_B | CAGLSEITR |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
111 | C | E | b | 0.0 | 4xw3_B | CSAVKYIL |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
112 | Q | E | e | 35.7 | 4xw3_B | QDGELKS |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
113 | S | E | b | 0.0 | 4xw3_B | SATRDKEGLV |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
114 | R | e | 37.9 | 4xw3_B | RLGQAESKTV |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |||
115 | E | e | 39.2 | 4xw3_B | ESKVDRATFGILNPQ |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |||
116 | V | T | e | 67.3 | 4xw3_B | VKLRAIMFDEGNPQSTY |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
117 | K | T | e | 84.4 | 4xw3_B | KSFMERAL |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
118 | E | e | 47.7 | 4xw3_B | RSAEQGNDKFILPTV |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |||
119 | W | e | 26.7 | 4xw3_B | WFDIAKY |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |||
120 | H | E | b | 1.6 | 4xw3_B | HSAFELRC |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
121 | G | E | b | 0.0 | 4xw3_B | GARSVM |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
122 | C | E | b | 0.7 | 4xw3_B | AIVCFG |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
123 | R | E | b | 1.6 | 4xw3_B | REQPIVK |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
124 | A | E | b | 0.0 | 4xw3_B | ASKTCG |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
125 | T | S | b | 0.0 | 4xw3_B | TNVYES |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
126 | K | E | b | 10.4 | 4xw3_B | YTKRAPSF |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
127 | G | E | b | 0.0 | 4xw3_B | GACS |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
128 | L | E | b | 0.0 | 4xw3_B | VILR |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
129 | M | S | e | 25.1 | 4xw3_B | LTYKSDQRMWVNAEG |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
130 | K | S | e | 44.3 | 4xw3_B | KSANERDGLTV |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
131 | G | S | b | 13.1 | 4xw3_B | GDAEKLSTV |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
132 | K | E | e | 33.5 | 4xw3_B | KFRILAVEGST |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
133 | H | E | b | 4.7 | 4xw3_B | HWYVF |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
134 | Y | E | b | 0.9 | 4xw3_B | YLSCMV |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
135 | Y | E | b | 0.0 | 4xw3_B | YFDW |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
136 | E | E | b | 1.0 | 4xw3_B | ED |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
137 | V | E | b | 0.0 | 4xw3_B | VIFSAM |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
138 | S | E | b | 9.4 | 4xw3_B | hetero GID4_HUMAN | SKETDLQAI |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
139 | C | E | b | 4.7 | 4xw3_B | hetero GID4_HUMAN | IVCALK |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
140 | H | e | 40.3 | 4xw3_B | VGHTLSYENR |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |||
141 | D | S | b | 17.3 | 4xw3_B | hetero GID4_HUMAN | DTESR |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
142 | Q | S | e | 78.1 | 4xw3_B | hetero GID4_HUMAN | SQKTEDRPVANL |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
143 | G | S | e | 32.1 | 4xw3_B | hetero GID4_HUMAN | GPHSAL |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
144 | L | E | e | 43.3 | 4xw3_B | hetero DDX4_MOUSE | LVYDFHEIPA |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
145 | C | E | b | 4.0 | 4xw3_B | hetero GID4_HUMAN | MCVITLQ |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
146 | R | E | b | 6.7 | 4xw3_B | RQGS |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
147 | V | E | b | 0.0 | 4xw3_B | IVL |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
148 | G | E | b | 0.0 | 4xw3_B | GL |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
149 | W | E | b | 0.0 | 4xw3_B | WLVF |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
150 | S | E | b | 0.8 | 4xw3_B | SACKT |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
151 | T | b | 2.6 | 4xw3_B | TRLASV |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |||
152 | M | T | b | 13.5 | 4xw3_B | LDQMKCITRA |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
153 | Q | T | e | 67.9 | 4xw3_B | QDGKSPTAFRN |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
154 | A | S | b | 6.2 | 4xw3_B | CSAPGYTVF |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
155 | S | e | 38.3 | 4xw3_B | SDNPGRKC |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |||
156 | L | S | b | 6.2 | 4xw3_B | LFMRASTVQ |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
157 | D | S | e | 25.9 | 4xw3_B | NQDLEFGMT |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
158 | L | T | b | 0.6 | 4xw3_B | hetero DDX4_MOUSE precipitant | LRVIP |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
159 | G | T | b | 0.0 | 4xw3_B | G |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
160 | T | S | b | 16.9 | 4xw3_B | hetero DDX4_MOUSE precipitant | DWETSCYAK |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
161 | D | S | b | 19.8 | 4xw3_B | DETHACG |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
162 | K | T | e | 46.7 | 4xw3_B | KEDHAGPLR |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
163 | F | T | b | 16.3 | 4xw3_B | FYNDREHLTMQ |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
164 | G | E | b | 0.0 | 4xw3_B | SGA |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
165 | F | E | b | 0.5 | 4xw3_B | YFWVC |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
166 | G | E | b | 0.0 | 4xw3_B | GAV |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
167 | F | E | b | 0.0 | 4xw3_B | YFL |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
168 | G | E | b | 6.0 | 4xw3_B | hetero DDX4_MOUSE | DGAHRSTN |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
169 | G | T | b | 17.9 | 4xw3_B | hetero GID4_HUMAN | GPDLS |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
170 | T | T | e | 51.9 | 4xw3_B | hetero DDX4_MOUSE GID4_HUMAN | TENDHCRFIK |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
171 | G | T | b | 10.7 | 4xw3_B | hetero DDX4_MOUSE | GRDKNSAL |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
172 | K | E | e | 33.0 | 4xw3_B | KGSVAHCITLM |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
173 | K | E | e | 20.3 | 4xw3_B | KQRHENSAL |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
174 | S | E | b | 0.0 | 4xw3_B | SRKFITAML |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
175 | H | E | b | 18.8 | 4xw3_B | HWDTFYCSENAL |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
176 | N | T | e | 59.4 | 4xw3_B | NHDSKAEL |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
177 | K | T | e | 68.4 | 4xw3_B | hetero DDX4_MOUSE precipitant | KGQRSACVL |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
178 | Q | E | e | 59.2 | 4xw3_B | QTGESKLPR |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
179 | F | E | e | 37.8 | 4xw3_B | FGTYLNRAIS |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
180 | D | E | e | 40.7 | 4xw3_B | EDISTQN |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
181 | N | E | e | 79.4 | 4xw3_B | DNPKHTWGAES |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
182 | Y | b | 10.0 | 4xw3_B | hetero ARMC8_HUMAN | YFK |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
183 | G | S | e | 50.0 | 4xw3_B | GMNA |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
184 | E | e | 35.2 | 4xw3_B | EQPRKADLV |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |||
185 | E | e | 73.4 | 4xw3_B | EPTRSAKQ |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |||
186 | F | b | 5.7 | 4xw3_B | hetero GID4_HUMAN | FWYIS |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
187 | T | e | 39.6 | 4xw3_B | hetero GID4_HUMAN | TKLQAGVDE |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
188 | M | T | e | 29.0 | 4xw3_B | TAEMPQLSKN |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
189 | H | T | e | 84.3 | 4xw3_B | GNHEA |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
190 | D | b | 14.2 | 4xw3_B | D |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |||
191 | T | E | b | 3.9 | 4xw3_B | VTFI |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
192 | I | E | b | 0.0 | 4xw3_B | IVF |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
193 | G | E | b | 1.2 | 4xw3_B | GTS |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
194 | C | E | b | 0.0 | 4xw3_B | CFSV |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
195 | Y | E | b | 3.9 | 4xw3_B | YFLCMG |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
196 | L | E | b | 0.0 | 4xw3_B | ILVDAFY |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
197 | D | E | b | 3.7 | 4xw3_B | DNER |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
198 | I | T | b | 15.2 | 4xw3_B | LFVIMPT |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
199 | D | T | e | 66.0 | 4xw3_B | DNCIEKPRTV |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
200 | K | T | e | 64.6 | 4xw3_B | EDNTCKS |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
201 | G | T | b | 1.2 | 4xw3_B | GSNEKQRHVD |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
202 | H | E | e | 25.7 | 4xw3_B | TEQHINADGKLPRSV |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
203 | V | E | b | 0.0 | 4xw3_B | ILMVCADEGKNPQRST |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
204 | K | E | b | 10.4 | 4xw3_B | precipitant | SFIKMEGWYADLNPQRTV |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
205 | F | E | b | 0.0 | 4xw3_B | FYW |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
206 | S | E | b | 1.6 | 4xw3_B | TSDFACY |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
207 | K | E | b | 16.0 | 4xw3_B | KLSR |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
208 | N | T | e | 34.5 | 4xw3_B | NM |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
209 | G | T | e | 53.6 | 4xw3_B | hetero ARMC8_HUMAN | GAF |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
210 | K | E | e | 60.8 | 4xw3_B | hetero ARMC8_HUMAN | EKVLQAGHN |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
211 | D | E | e | 39.5 | 4xw3_B | hetero ARMC8_HUMAN precipitant | DWQCSKLNVY |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
212 | L | E | b | 14.6 | 4xw3_B | hetero ARMC8_HUMAN | LMQEFSI |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
213 | G | E | e | 28.6 | 4xw3_B | hetero ARMC8_HUMAN | GKPNE |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
214 | L | E | e | 43.3 | 4xw3_B | hetero ARMC8_HUMAN | LIAVSPTE |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
215 | A | E | b | 2.7 | 4xw3_B | AEGDKQL |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
216 | F | E | b | 10.5 | 4xw3_B | FPALK |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
217 | E | E | e | 63.3 | 4xw3_B | precipitant | ERKTSDQA |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
218 | I | b | 8.2 | 4xw3_B | precipitant | ITVFKALDNS |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
219 | P | e | 22.5 | 4xw3_B | PSLKAFDRQEGTV |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |||
220 | P | G | e | 94.6 | 4xw3_B | KSPDHEVAGLT |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
221 | H | G | e | 41.4 | 4xw3_B | GESHKANFRDL |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
222 | M | G | b | 0.5 | 4xw3_B | LIVGDWTKSYMA |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
223 | K | T | e | 39.2 | 4xw3_B | KVTAQSLGPR |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
224 | N | T | e | 87.9 | 4xw3_B | GNVSQADKL |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
225 | Q | S | e | 30.1 | 4xw3_B | QRGMDSTAHEF |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
226 | A | b | 12.5 | 4xw3_B | AGNPFMTCVIRSK |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |||
227 | L | B | b | 0.6 | 4xw3_B | LFTYIKV |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
228 | F | E | b | 0.5 | 4xw3_B | FYLRVAI |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
229 | P | E | b | 0.0 | 4xw3_B | PEAKSD |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
230 | A | E | b | 1.8 | 4xw3_B | ASVFPHT |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
231 | C | E | b | 0.0 | 4xw3_B | VCMSITAL |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
232 | V | E | b | 0.0 | 4xw3_B | SGVLKNFAE |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
233 | L | E | b | 0.0 | 4xw3_B | LMCIAVEGS |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
234 | K | E | e | 27.8 | 4xw3_B | hetero DDX4_MOUSE | KQSGNHAELV |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
235 | N | S | e | 37.0 | 4xw3_B | NEGTVYFDQSPAL |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
236 | A | E | b | 0.9 | 4xw3_B | APCDSRQKEGFILNTV |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
237 | E | E | e | 20.1 | 4xw3_B | ELAQGTSHVDFIKNPR |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
238 | L | E | b | 1.1 | 4xw3_B | LVCMADEFGIKNPQRSTY |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
239 | K | E | e | 21.7 | 4xw3_B | REPAKDQSHLFGINTVY |
MOD_RES /note="N6-acetyllysine" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" MOD_RES /note="N6-acetyllysine" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
240 | F | E | b | 1.0 | 4xw3_B | YLFMAVGSDEIKNPQRT |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
241 | N | E | b | 10.9 | 4xw3_B | NLASFGDEIKPQRTVY |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
242 | F | S | b | 1.9 | 4xw3_B | FLYADEGIKNPQRSTV |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
243 | G | S | b | 13.1 | 4xw3_B | GSNVEADFIKLPQRTY |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
244 | E | S | e | 68.3 | 4xw3_B | NEQRKSYAFLDGIPTV |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
245 | E | S | e | 53.3 | 4xw3_B | ELKQMDRSNPTYAGVFHI |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
246 | E | e | 96.5 | 4xw3_B | PGKRSEDALFINQTVY |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |||
247 | F | b | 19.1 | 4xw3_B | homo | FPALSKMDEGINQRTVY |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
248 | K | S | e | 57.1 | 4xw3_B | homo | KSEIRLVPADFGNQTY |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
249 | F | S | e | 35.9 | 4xw3_B | homo | AFIKLNHYDEGPRSTV |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
250 | P | e | 78.3 | 4xw3_B | PDQVIAFEGKLNRST |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |||
251 | P | e | 26.4 | 4xw3_B | PQEILSCTVAG |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |||
252 | K | e | 39.2 | 4xw3_B | precipitant | KSEAGIQVLR |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
253 | D | T | e | 63.0 | 4xw3_B | hetero ARMC8_HUMAN RS7_HUMAN | DRKNIAMEGLPQSTV |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
254 | G | T | e | 71.4 | 4xw3_B | GQLAKDEFINPRSTVY |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
255 | F | b | 7.7 | 4xw3_B | AFILMPRSY |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |||
256 | V | E | e | 47.3 | 4xw3_B | VLIRDMKQPT |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
257 | A | E | b | 11.6 | 4xw3_B | APGMSQVLT |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
258 | L | G | b | 0.0 | 4xw3_B | LIQPFAV |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
259 | S | G | b | 12.5 | 4xw3_B | SACQDNPTG |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
260 | K | G | e | 59.0 | 4xw3_B | hetero PDCD4_HUMAN | QKRDNEHT |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
261 | A | S | b | 6.2 | 4xw3_B | precipitant | APGSIKTV |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
262 | P | e | 55.8 | 4xw3_B | compound ANP precipitant | PGLIKQER |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
263 | D | G | e | 82.1 | 4xw3_B | compound ANP precipitant | DSNTQHREFL |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
264 | G | G | e | 85.7 | 4xw3_B | compound ANP | GANHTLRK |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
265 | Y | G | e | 50.0 | 4xw3_B | YFLHKSIDMVNAEGPT |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
266 | I | E | b | 15.2 | 4xw3_B | compound ANP precipitant | ILVSTDKAY |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
267 | V | E | e | 35.3 | 4xw3_B | compound ANP | AILVMSEGFQ |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
268 | K | E | e | 52.4 | 4xw3_B | compound ANP precipitant | KAPQERSNMDTV |
MOD_RES /note="N6-acetyllysine" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" MOD_RES /note="N6-acetyllysine" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
269 | S | b | 4.7 | 4xw3_B | compound ANP metal MG | STAQFKHPMGNYDL |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
270 | Q | S | e | 69.9 | 4xw3_B | compound ANP | QLRASKTVWEIP |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
271 | H | b | 10.5 | 4xw3_B | ADEGLPRSTVHNQ |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |||
272 | S | S | e | 36.7 | 4xw3_B | compound ANP ADP | SLNTERGFDPQVAIK |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
273 | G | G | e | 54.8 | 4xw3_B | compound ANP ADP | GIATELPCKNRVMQ |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
274 | N | G | e | 103.6 | 4xw3_B | compound ANP ADP | NTKSCGALPRDEI |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
275 | A | G | e | 36.6 | 4xw3_B | precipitant | ASFTGPKDEHLQVR |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
276 | Q | e | 57.7 | 4xw3_B | QKELMRTGASIP |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |||
277 | V | B | e | 29.3 | 4xw3_B | LIAVKSRDGMTHNP |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
278 | T | e | 64.9 | 4xw3_B | STVNQLAKYDERFCIMP |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |||
279 | Q | e | 37.8 | 4xw3_B | precipitant | QRLAEKSNDFHIMTVY |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
280 | T | H | b | 8.8 | 2z0m_A | hetero G0S832_CHATD RL36_HUMAN | STLIVANEKDGQRMPY |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
281 | K | H | b | 0.0 | 2z0m_A | hetero G0S832_CHATD | KREVQDPNTAILSGHMY |
MOD_RES /note="N6-acetyllysine; alternate" CROSSLNK /note="Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternate" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" MOD_RES /note="N6-acetyllysine; alternate" CROSSLNK /note="Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternate" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
282 | F | H | b | 1.2 | 2z0m_A | hetero G0S832_CHATD RL36_HUMAN | FIEPLVYGAKQRSDMNTWH |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
283 | L | H | b | 3.4 | 2z0m_A | hetero G0S832_CHATD NOP16_SCHPO | LVKRDIAEMNQSTGYCFHP |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
284 | P | H | e | 29.6 | 2z0m_A | PDLQKEGAINRSVHMT |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
285 | N | e | 35.2 | 8ark_B | hetero RL36_HUMAN G0S832_CHATD RUXE_HUMAN homo | NDRGHQSPTEKALYV |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
286 | A | S | b | 4.5 | 8tbx_A | AGQVESKCRTHIPYDFLN |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
287 | P | b | 1.6 | 8tbx_A | metal CL | PTVIFELCSAKMRY |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
288 | K | S | b | 5.2 | 8tbx_A | QRSGTIFKLYAEHMNV |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
289 | A | E | b | 0.0 | 8tbx_A | AVGRSICTM |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
290 | L | E | b | 1.1 | 8tbx_A | metal HG | LIVAFMC |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
291 | I | E | b | 1.2 | 8tbx_A | IVACLFM |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
292 | V | E | b | 1.3 | 8tbx_A | LIVMEDFCT |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
293 | E | b | 0.0 | 8tbx_A | ASVTCLQRFEGM |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |||
294 | P | S | b | 14.7 | 8tbx_A | hetero NU159_YEAST nucleotide compound 8OD otherpoly precipitant | PEHNAS |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
295 | S | e | 32.8 | 8tbx_A | hetero PDCD4_HUMAN Q63UP7_BURPS PDCD4_MOUSE nucleotide compound 8OD metal MG otherpoly homo | TSNADVI |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
296 | R | H | b | 19.4 | 8tbx_A | hetero PDCD4_HUMAN PDCD4_MOUSE CNOT1_HUMAN Q63UP7_BURPS NU159_YEAST nucleotide compound 8OD ADP KEG V6D metal MG otherpoly homo precipitant | RKSTHQVAFLNY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
297 | E | H | e | 34.7 | 8tbx_A | hetero PDCD4_HUMAN PDCD4_MOUSE NU159_YEAST Q63UP7_BURPS nucleotide compound 8OD KEG metal MG homo precipitant | EDSTLMP |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
298 | L | H | e | 25.8 | 8tbx_A | compound ADP ANP homo precipitant | LWI |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
299 | A | H | b | 0.0 | 8tbx_A | AVSCQIGT |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
300 | E | H | e | 42.7 | 8tbx_A | nucleotide homo precipitant | LQVDEIANRSHMTYKCFGW |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
301 | Q | H | e | 51.5 | 8tbx_A | compound ADP ANP 8OX 8OD LMR SAU AMP homo precipitant | QEADT |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
302 | T | H | b | 1.3 | 8tbx_A | IVTGAELQCNS |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
303 | L | H | b | 11.2 | 8tbx_A | nucleotide homo precipitant | YFALQHVKSGETIRCDMN |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
304 | N | H | e | 69.1 | 8tbx_A | compound AMP homo precipitant | DKENQSRAGPTHLVIM |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
305 | N | H | b | 8.5 | 8tbx_A | compound ADP ANP AMP 8OP 8OD 8OX FPJ metal MG homo precipitant | VETGKDNSHIAMQRFLCP |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
306 | I | H | b | 2.3 | 8tbx_A | LVAIECFYGMSTDK |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
307 | K | H | e | 20.8 | 8tbx_A | nucleotide homo precipitant | KELTRNQISAVDGMCFY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
308 | Q | H | e | 30.1 | 8tbx_A | nucleotide compound ADP AMP ANP M2A homo precipitant | KEQRATDLSGVNPCFHIMY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
309 | F | H | b | 0.0 | 8tbx_A | homo | LFIMTAHVCGYEQSW |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
310 | K | T | b | 18.9 | 8tbx_A | homo precipitant | GASLKTERVCIMPQDHNY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
311 | K | T | e | 24.5 | 8tbx_A | hetero THO2_YEAST nucleotide homo precipitant | KARSQEHDTGLPYFINV |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
312 | Y | T | e | 43.0 | 8tbx_A | hetero CWC22_HUMAN CNOT1_HUMAN THO2_YEAST GLE1_YEAST U5S1_HUMAN IF4G1_HUMAN metal ZN homo precipitant | FYHLAGEPIKTVCRSWDMNQ |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
313 | I | b | 5.3 | 8tbx_A | hetero U5S1_HUMAN homo precipitant | LTICMVGASNHPDFYEKQRW |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
314 | D | e | 44.4 | 8tbx_A | hetero U5S1_HUMAN nucleotide homo | DGSNAEKPTVFQYHILRCM |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
315 | N | S | e | 86.1 | 8tbx_A | nucleotide homo | GNSALRDHKQEPTVFIMYC |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
316 | P | S | e | 47.3 | 8tbx_A | nucleotide metal CL homo precipitant | PSTKLVAEGIRDHMNFQYC |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
317 | K | e | 55.2 | 8tbx_A | nucleotide homo | KGNRDLSEQTAIPVWYCHFM |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
318 | L | b | 6.2 | 8tbx_A | homo precipitant | LIVFKACGMTYHNPQRS |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
319 | R | b | 14.2 | 8tbx_A | hetero CASC3_HUMAN U5S1_HUMAN homo precipitant | RKSVTNAQEGDHICFLPY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
320 | E | E | e | 33.7 | 8tbx_A | nucleotide precipitant | VSTAPCIEFKNQDGLHMRWY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
321 | L | E | b | 12.4 | 8tbx_A | nucleotide | VALGQCMHITFSEKRYDN |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
322 | L | E | b | 19.1 | 8tbx_A | nucleotide precipitant | LVACNSTIMYGKPQEFHR |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
323 | I | E | b | 0.6 | 8tbx_A | nucleotide precipitant | VILAFCSMTWDNPQRY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
324 | I | b | 10.5 | 8tbx_A | hetero Q63UP7_BURPS nucleotide compound ADP otherpoly homo precipitant | IVYTSLAFGKMPCDNR |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
325 | G | S | e | 79.8 | 8tbx_A | hetero PDCD4_HUMAN CNOT1_HUMAN NU159_YEAST nucleotide compound 8OD KEG metal MG CL otherpoly homo precipitant | GPSAKTNQRDEFLV |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
326 | G | S | e | 102.4 | 8tbx_A | hetero PDCD4_HUMAN PDCD4_MOUSE NU159_YEAST nucleotide compound KEG otherpoly homo precipitant | GADNSKEQTVCILMPR |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
327 | V | S | e | 28.7 | 8tbx_A | hetero PDCD4_HUMAN PDCD4_MOUSE SNR48_HUMAN nucleotide homo precipitant | TVLASMEIDKQRFGHNPCY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
328 | A | e | 46.4 | 8tbx_A | hetero PDCD4_MOUSE SNR48_HUMAN nucleotide compound 8OP homo precipitant | SPDANGKTRELVQCFHIMY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
329 | A | H | e | 36.6 | 8tbx_A | hetero PDCD4_HUMAN PDCD4_MOUSE DHX8_HUMAN nucleotide compound 8OP homo precipitant | LIAKVMPRYDSEFTGNHQW |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
330 | R | H | e | 28.9 | 8tbx_A | hetero G0SBN1_CHATD RL36B_SCHPO ERB1_YEAST NU159_YEAST E9Q238_MOUSE DHX8_HUMAN ERB1_CHATD nucleotide compound 8OP homo precipitant | RKEQDGASNVLMPTFHIWY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
331 | D | H | e | 66.0 | 8tbx_A | hetero ERB1_YEAST NU159_YEAST SNR48_HUMAN nucleotide homo precipitant | DEKNQSVARGLPTHIFMY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
332 | Q | H | b | 5.6 | 8tbx_A | nucleotide precipitant | QDELSIKNRMTAFGHVY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
333 | L | H | e | 42.1 | 8tbx_A | hetero CASC3_HUMAN G0SBN1_CHATD E9Q238_MOUSE nucleotide compound 8OP homo precipitant | LAIKRVEFSNQDGMTCHPY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
334 | S | H | e | 44.5 | 8tbx_A | hetero CASC3_HUMAN RL36_HUMAN E9Q238_MOUSE SNR48_HUMAN RUXE_HUMAN nucleotide homo precipitant | RSKEANTDLQGIPVYFHMW |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
335 | V | H | e | 26.0 | 8tbx_A | hetero E9Q238_MOUSE SNR48_HUMAN nucleotide homo | RKLAVEIQDFMSNTPCGHWY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
336 | L | H | b | 12.9 | 8tbx_A | precipitant | LIMVAFKRSCEGHNPQTY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
337 | E | H | e | 45.7 | 8tbx_A | hetero RL36_HUMAN CASC3_HUMAN U5S1_HUMAN RL36B_SCHPO RL36A_YEAST E9Q238_MOUSE G0SBN1_CHATD RUXE_HUMAN nucleotide metal ZN homo precipitant | KERSQADNTMPFGHILVY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
338 | N | H | e | 83.0 | 8tbx_A | hetero CASC3_HUMAN U5S1_HUMAN E9Q238_MOUSE G0SBN1_CHATD RUXE_HUMAN nucleotide homo precipitant | KNDREQSTGAHIMPVLYCFW |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
339 | G | e | 38.1 | 8tbx_A | hetero CASC3_HUMAN precipitant | GKNPREASTQCDHILVYMW |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
340 | V | b | 2.0 | 8tbx_A | precipitant | PVACITGLMQSYEFKNR |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
341 | D | S | b | 11.7 | 8tbx_A | hetero U5S1_HUMAN homo | DHNQESARTGIKLPV |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
342 | I | E | b | 2.3 | 8tbx_A | IVLFMAGS |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
343 | V | E | b | 0.7 | 8tbx_A | LVIAMCFGS |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
344 | V | E | b | 0.7 | 8tbx_A | VIFSACGLT |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
345 | G | E | b | 0.0 | 8tbx_A | AGSTCIL |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
346 | T | b | 13.6 | 8tbx_A | hetero PDCD4_HUMAN PDCD4_MOUSE CNOT1_HUMAN NU159_YEAST Q63UP7_BURPS nucleotide compound 8OD metal CA CL MG otherpoly precipitant | TNSAGLM |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
347 | P | H | b | 1.6 | 8tbx_A | hetero NU159_YEAST nucleotide compound RCG V6D otherpoly precipitant | PTAVCGILMS |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
348 | G | H | e | 44.0 | 8tbx_A | hetero PDCD4_HUMAN PDCD4_MOUSE NU159_YEAST nucleotide compound 8OD RCG V6D metal CA CL otherpoly homo precipitant | GADSHLCFMNPQTY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
349 | R | H | b | 12.6 | 8tbx_A | hetero PDCD4_HUMAN PDCD4_MOUSE NU159_YEAST Q63UP7_BURPS nucleotide compound 8OD ADP metal CA CL otherpoly homo precipitant | RKLTMACGHIQS |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
350 | L | H | b | 0.0 | 8tbx_A | LVIFMACGST |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
351 | D | H | e | 22.2 | 8tbx_A | nucleotide compound KEG RCG V6D homo precipitant | LIDVAKFHMQENSWCGPRTY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
352 | D | H | e | 64.2 | 8tbx_A | hetero PDCD4_HUMAN PDCD4_MOUSE NU159_YEAST nucleotide otherpoly homo precipitant | DHEQSAKGNFILRTVY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
353 | L | H | b | 6.7 | 8tbx_A | LMHIFNVTYACSWEGKQ |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
354 | V | H | b | 10.0 | 8tbx_A | homo | LIVADEFKMQTCRSGHNY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
355 | S | T | e | 67.2 | 8tbx_A | hetero IF4F1_YEAST NU159_YEAST nucleotide compound KEG V6D homo precipitant | ENKQSRDAGLTVIFHMY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
356 | T | T | e | 62.3 | 8tbx_A | hetero IF4F1_YEAST NU159_YEAST RUXG_HUMAN nucleotide compound 8OP otherpoly homo precipitant | RSTKENAQDPLGMCFHIV |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
357 | G | T | e | 88.1 | 8tbx_A | hetero CASC3_HUMAN RL36B_SCHPO IF4F1_YEAST RUXG_HUMAN RL36A_YEAST E9Q238_MOUSE G0SBN1_CHATD RUXE_HUMAN nucleotide homo precipitant | GKRNESDPQAMTHLVFIY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
358 | K | b | 18.4 | 8tbx_A | hetero RL36_HUMAN G0SBN1_CHATD RL36B_SCHPO RL36A_YEAST E9Q238_MOUSE RUXE_HUMAN nucleotide homo precipitant | AKSGRVHNPTEILQYDMCF |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
359 | L | S | b | 4.5 | 8tbx_A | hetero CASC3_HUMAN G0SBN1_CHATD RL36B_SCHPO nucleotide homo precipitant | LIFVTYAMEKNCDGPQRS |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
360 | N | e | 48.5 | 8tbx_A | hetero CASC3_HUMAN G0SBN1_CHATD RL36_HUMAN U5S1_HUMAN RL36B_SCHPO RUXE_HUMAN nucleotide metal CL homo precipitant | DSNKRVFEHGITALQCMPY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
361 | L | b | 6.7 | 8tbx_A | hetero CASC3_HUMAN MALE_ECO57 THOC4_HUMAN G0SEI0_CHATD nucleotide metal CL HG | LFTVIMPACDGKNRSY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
362 | S | T | e | 49.2 | 8tbx_A | hetero RL36_HUMAN CASC3_HUMAN U5S1_HUMAN MALE_ECO57 THOC4_HUMAN RL36B_SCHPO EIF3E_HUMAN DDX3X_HUMAN RL13_SCHPO G0S992_CHATD G0SEI0_CHATD RUXE_HUMAN nucleotide metal CL homo | SKDRANEGTHQPFLMV |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
363 | Q | T | e | 32.7 | 8tbx_A | hetero RL36_HUMAN G0S832_CHATD DDX3X_HUMAN metal CL | NSKRQHADTEGFLCIMVY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
364 | V | b | 2.0 | 8tbx_A | hetero G0SEI0_CHATD metal CL HG | VLICRAMTDFPS |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
365 | R | b | 17.4 | 8tbx_A | hetero RL36_HUMAN G0S832_CHATD RL30_YEAST DDX3X_HUMAN G0SEI0_CHATD precipitant | KREQTSDNACGHLMPVY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
366 | F | E | b | 0.0 | 8tbx_A | hetero CWC22_HUMAN metal HG precipitant | YFVMILHTWASCDGKNQ |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
367 | L | E | b | 0.6 | 8tbx_A | metal HG | LVFITAMCKR |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
368 | V | E | b | 0.0 | 8tbx_A | VIDATCGL |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
369 | L | E | b | 1.1 | 8tbx_A | LIFMVCY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
370 | D | T | b | 0.0 | 8tbx_A | compound ADP metal MG precipitant | DSAEGLV |
MOTIF /note="DEAD box" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" MOTIF /note="DEAD box" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
371 | E | T | b | 13.6 | 8tbx_A | compound ANP ADP 08T ATP metal MG homo precipitant | EKN |
MUTAGEN /note="E->G: Inhibits the transcriptional activity of RELA and attenuates NF-kappa-B-mediated gene expression." ECO:0000269|PubMed:24870230" MUTAGEN /note="E->Q: Abolishes ability to promote guanylylation of RTCB." ECO:0000269|PubMed:24870230" MOTIF /note="DEAD box" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" MUTAGEN /note="E->G: Inhibits the transcriptional activity of RELA and attenuates NF-kappa-B-mediated gene expression." ECO:0000269|PubMed:24870230" MUTAGEN /note="E->Q: Abolishes ability to promote guanylylation of RTCB." ECO:0000269|PubMed:24870230" MOTIF /note="DEAD box" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
372 | A | H | b | 0.0 | 8tbx_A | ACIVGFSTL |
MOTIF /note="DEAD box" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" MOTIF /note="DEAD box" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
373 | D | H | b | 14.8 | 8tbx_A | precipitant | DHN |
MOTIF /note="DEAD box" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" MOTIF /note="DEAD box" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
374 | G | H | e | 27.4 | 8tbx_A | hetero PDCD4_HUMAN Q63UP7_BURPS nucleotide otherpoly homo precipitant | RLTKEGQMINSACDFHV |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
375 | L | H | b | 0.0 | 8tbx_A | MLFIVCT |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
376 | L | H | b | 10.7 | 8tbx_A | hetero Q63UP7_BURPS precipitant | LIFMVNTY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
377 | S | H | e | 78.9 | 8tbx_A | hetero PDCD4_HUMAN Q63UP7_BURPS PDCD4_MOUSE NU159_YEAST nucleotide compound ANP otherpoly homo precipitant | DEKMSGTANQLRYC |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
378 | Q | T | e | 49.0 | 8tbx_A | hetero PDCD4_HUMAN RL19A_YEAST PDCD4_MOUSE CNOT1_HUMAN Q63UP7_BURPS NU159_YEAST G0S9T3_CHATD nucleotide compound 8OD ANP homo precipitant | MQDVLREIFKPSYGAHNT |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
379 | G | T | e | 54.8 | 8tbx_A | hetero PDCD4_HUMAN YRA1_YEAST PDCD4_MOUSE Q63UP7_BURPS DHX8_HUMAN nucleotide metal CA MG otherpoly homo precipitant | GESHDQAILNTMPRY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
380 | Y | e | 31.7 | 8tbx_A | hetero PDCD4_HUMAN PDCD4_MOUSE Q63UP7_BURPS NU159_YEAST nucleotide compound 8OD metal CA otherpoly homo precipitant | FALYVDHISCEGKMPQRTW |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
381 | S | H | e | 27.3 | 8tbx_A | hetero CASC3_HUMAN Q63UP7_BURPS MALE_ECO57 THOC4_HUMAN precipitant | EQAGDKSILRTFNVHMY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
382 | D | H | e | 62.3 | 8tbx_A | hetero RL19A_YEAST CNOT1_HUMAN Q63UP7_BURPS NU159_YEAST nucleotide metal CA homo precipitant | DEKPQGSFNALRTVHIY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
383 | F | H | b | 1.4 | 8tbx_A | hetero CNOT1_HUMAN Q63UP7_BURPS nucleotide compound RCG V6D metal CA MG otherpoly homo precipitant | QDEFMTVNWILSAHKPCGY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
384 | I | H | b | 0.0 | 8tbx_A | hetero CASC3_HUMAN MALE_ECO57 THOC4_HUMAN nucleotide precipitant | ILVMCTESAFKNPR |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
385 | N | H | b | 20.0 | 8tbx_A | hetero CASC3_HUMAN MALE_ECO57 THOC4_HUMAN RL19A_YEAST YRA1_YEAST NU159_YEAST nucleotide precipitant | REDSKNLQTPVYCIAGFHM |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
386 | R | H | e | 39.1 | 8tbx_A | hetero YRA1_YEAST CNOT1_HUMAN NU159_YEAST nucleotide compound KEG RCG V6D homo precipitant | RKDEQASTNVFHLCGIMPWY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
387 | M | H | b | 1.9 | 8tbx_A | ILVMDCTAEFGQRS |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
388 | H | H | b | 14.1 | 8tbx_A | hetero CASC3_HUMAN MALE_ECO57 THOC4_HUMAN precipitant | LVIFKRAEHMDQYGSTCNP |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
389 | N | H | e | 87.3 | 8tbx_A | hetero CASC3_HUMAN THOC4_HUMAN MALE_ECO57 YRA1_YEAST NU159_YEAST RL19A_YEAST nucleotide precipitant | SEKDNQRGATCHLFIMPVY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
390 | Q | H | e | 51.5 | 8tbx_A | hetero CASC3_HUMAN MALE_ECO57 THOC4_HUMAN homo precipitant | RHIAELQKVCDFNSTYMGP |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
391 | I | S | b | 0.6 | 8tbx_A | hetero CASC3_HUMAN MALE_ECO57 THOC4_HUMAN metal HG precipitant | LIMTVFACEPRSGHKNQY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
392 | P | e | 48.1 | 8tbx_A | hetero CASC3_HUMAN MALE_ECO57 THOC4_HUMAN YRA1_YEAST | PADSFNKTEGILQRVHMY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
393 | Q | S | e | 43.4 | 8tbx_A | hetero CASC3_HUMAN MALE_ECO57 THOC4_HUMAN YRA1_YEAST G0S5L0_CHATD nucleotide homo precipitant | KQRAEDSPGHLNTVIMCFWY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
394 | V | B | e | 54.0 | 8tbx_A | hetero RL30_YEAST G0SEI0_CHATD CASC3_HUMAN G0S5L0_CHATD metal MG | IAVLTSQCEGKMYDFNPRH |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
395 | T | b | 14.9 | 8tbx_A | hetero YRA1_YEAST CASC3_HUMAN G0SEI0_CHATD precipitant | TRPSAKLEFNDGIVCMQHY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
396 | S | T | e | 87.5 | 8tbx_A | hetero RL30_YEAST YRA1_YEAST G0SEI0_CHATD | SPARGKQTEDLNIMVCFHYW |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
397 | D | T | e | 45.7 | 8tbx_A | hetero YRA1_YEAST THOC4_HUMAN NOC3L_HUMAN | DTSANPKEIGHLQRVFCMWY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
398 | G | S | e | 65.5 | 8tbx_A | hetero NOC3L_HUMAN | GSANDKLPTERQIVCFHMWY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
399 | K | e | 21.7 | 8tbx_A | hetero YRA1_YEAST precipitant | KRESPQADTVLGHIMNCFWY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
400 | R | B | e | 47.0 | 8tbx_A | hetero RL36_HUMAN | RKNDEQTLSGPVAHFIYCM |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
401 | L | b | 2.2 | 8tbx_A | metal MG | RLIVPTACKDGSYEFMNQWH |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
402 | Q | E | b | 5.6 | 8tbx_A | hetero CWC22_HUMAN metal MG precipitant | QRNETDHKLMSVACGI |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
403 | V | E | b | 0.7 | 8tbx_A | TVLMIKAFNSGCEHQRY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
404 | I | E | b | 0.0 | 8tbx_A | LVMIFAEKSTYCDG |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
405 | V | E | b | 0.0 | 8tbx_A | LMVFSIPACDEKTY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
406 | C | E | b | 0.0 | 8tbx_A | metal MG precipitant | FCVLAMSYEGPWDIKNQT |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
407 | S | E | b | 0.0 | 8tbx_A | metal MG precipitant | STNACDEFGKP |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
408 | A | S | e | 25.0 | 8tbx_A | hetero PDCD4_HUMAN compound ANP 08T metal MG homo precipitant | AQSEDGIKNTV |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
409 | T | S | e | 41.6 | 8tbx_A | hetero PDCD4_HUMAN homo precipitant | TLSADFGIKMNRV |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
410 | L | S | e | 44.9 | 8tbx_A | hetero PDCD4_HUMAN CNOT1_HUMAN SF3B1_HUMAN homo precipitant | LMFIVWSTADKPYCEGNQR |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
411 | H | S | e | 37.7 | 8tbx_A | hetero PDCD4_HUMAN SF3B1_HUMAN precipitant | PTANSEKQDHFGLIRVWYCM |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
412 | S | e | 26.6 | 8tbx_A | hetero MGN_HUMAN MGN2_HUMAN CNOT1_HUMAN SF3B1_HUMAN Q63UP7_BURPS G0S9T3_CHATD precipitant | SDTKPEARNQVGILFHY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
413 | F | H | e | 62.7 | 8tbx_A | hetero MGN_HUMAN MGN2_HUMAN CNOT1_HUMAN G0S9T3_CHATD precipitant | LAEFKSDMQRVYGPTHINWC |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
414 | D | H | e | 59.9 | 8tbx_A | hetero MGN_HUMAN MGN2_HUMAN Q63UP7_BURPS | DESKNLAGQRPTFIVMY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
415 | V | H | b | 2.0 | 8tbx_A | hetero G0S7E9_CHATD | VILFPAESDMTGKNQRY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
416 | K | H | b | 16.5 | 8tbx_A | hetero CNOT1_HUMAN A0A6A5Q2X9_YEASX G0S9T3_CHATD G0S7E9_CHATD nucleotide homo precipitant | EKRQLADNSGHTPFIMVWY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
417 | K | H | b | 18.9 | 8tbx_A | hetero MGN_HUMAN MGN2_HUMAN nucleotide precipitant | KERQDSAPVNTFGIHLMY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
418 | L | H | b | 1.1 | 8tbx_A | hetero G0S7E9_CHATD precipitant | LIFVMATHYCDEGKNPQSW |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
419 | S | H | b | 5.5 | 8tbx_A | hetero G0S7E9_CHATD nucleotide homo | ASTKCGIPQLMRVHDEFNY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
420 | E | H | e | 50.3 | 8tbx_A | hetero CASC3_HUMAN NOP2_HUMAN G0SHQ0_CHATD nucleotide homo precipitant | KREDQSNAGLTFMYHIPV |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
421 | K | H | e | 57.1 | 8tbx_A | hetero CASC3_HUMAN MALE_ECO57 THOC4_HUMAN YRA1_YEAST precipitant | KLQRAETSDFVGINCHMPY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
422 | I | H | b | 2.3 | 8tbx_A | hetero CASC3_HUMAN MALE_ECO57 THOC4_HUMAN YRA1_YEAST nucleotide precipitant | FILSVYGTHNKPADEMQRW |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
423 | M | b | 8.7 | 8tbx_A | hetero CASC3_HUMAN A0A6A5Q2X9_YEASX G0S7E9_CHATD homo | LMAFVGIQRCDKNPTESY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
424 | H | S | e | 40.3 | 8tbx_A | hetero CASC3_HUMAN RL30_YEAST YRA1_YEAST A0A6A5Q2X9_YEASX NOC3L_HUMAN G0SEI0_CHATD G0S5L0_CHATD metal MG | NHRKQTGSEPVDFILYAM |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
425 | F | S | e | 47.8 | 8tbx_A | hetero RL30_YEAST NOC3L_HUMAN G0SEI0_CHATD G0S7E9_CHATD metal MG homo precipitant | NDFKESLRTGQIAHMPVY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
426 | P | e | 23.3 | 8tbx_A | hetero A0A6A5Q2X9_YEASX G0S7E9_CHATD homo | PAYSETVGIKLDFHMNQR |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
427 | T | E | e | 40.9 | 8tbx_A | hetero A0A6A5Q2X9_YEASX G0S7E9_CHATD compound ANP homo | VTELAIKRNSGYDQFHMP |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
428 | W | E | e | 21.5 | 8tbx_A | hetero A0A6A5Q2X9_YEASX G0S7E9_CHATD compound ANP homo precipitant | REYLKTVISWAFMNQDGHCP |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
429 | V | E | b | 1.3 | 8tbx_A | hetero A0A6A5Q2X9_YEASX G0S7E9_CHATD homo precipitant | IVLEKRTAFMCDGNPQS |
REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
430 | D | e | 52.5 | 8tbx_A | hetero A0A6A5Q2X9_YEASX G0S7E9_CHATD homo precipitant | DQSTEKNRLAGIYFVHPM |
REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
431 | L | e | 58.4 | 8tbx_A | hetero A0A6A5Q2X9_YEASX G0S7E9_CHATD homo | LVIAETKMSGHNQRCDFPY |
REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
432 | K | S | e | 26.2 | 8ark_B | hetero MGN_HUMAN MGN2_HUMAN A0A6A5Q2X9_YEASX PDCD4_HUMAN G0S7E9_CHATD | GKDLENVARSTMQFIPYH |
REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
433 | G | e | 50.0 | 8ark_B | hetero MGN_HUMAN MGN2_HUMAN homo precipitant | GASDEKNRPTVFLHIQMY |
REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
434 | E | e | 31.7 | 8ark_B | hetero MGN_HUMAN MGN2_HUMAN SF3B1_HUMAN homo | EDKRSNQVIALTGHPCFMY |
REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
435 | D | e | 77.0 | 8ark_B | hetero MGN_HUMAN MGN2_HUMAN PDCD4_HUMAN PDCD4_MOUSE homo | DEKSAGNLQTIPRVFHYM |
REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
436 | S | e | 80.5 | 8tbx_A | metal NA MG homo precipitant | SALTEKVFNQRDGPICHMWY |
REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
437 | V | b | 17.3 | 8tbx_A | hetero MGN_HUMAN MGN2_HUMAN PDCD4_HUMAN | ALTVIMFSKDEGNQYCPR |
REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
438 | P | e | 44.2 | 8tbx_A | hetero PDCD4_HUMAN PDCD4_MOUSE RM38_HUMAN MGN_HUMAN metal NA MG | PKVASLENGRTHQCDFIMY |
REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
439 | D | S | b | 13.6 | 8tbx_A | hetero MGN_HUMAN RBM8A_HUMAN MGN2_HUMAN PDCD4_HUMAN RM38_HUMAN | DESKLNPGVATQHIRFY |
REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
440 | T | S | e | 29.9 | 8tbx_A | nucleotide metal MG | TSNGADEIKLRQVYFPCHM |
REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
441 | V | E | b | 2.7 | 8tbx_A | VILAKTFGMQSDENPRY |
REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
442 | H | E | e | 30.4 | 8tbx_A | precipitant | HEKQRTFNYDGILSAMPV |
REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
443 | H | E | b | 14.1 | 8tbx_A | hetero CNOT1_HUMAN | QYHLEGISKNTVADFPRM |
REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
444 | V | E | b | 18.7 | 8tbx_A | hetero 4ET_HUMAN precipitant | VILTFYKSAEGMNRCHPQD |
REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
445 | V | E | b | 0.0 | 8tbx_A | hetero MGN_HUMAN MGN2_HUMAN 4ET_HUMAN | VIAFLYEMSTDGKNPQRCHW |
REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
446 | V | E | b | 11.3 | 8tbx_A | hetero 4ET_HUMAN REN3B_HUMAN PAT1_YEAST CWC22_HUMAN | VILGATEFMSYCDKNQRHP |
REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
447 | P | E | e | 29.5 | 8tbx_A | hetero MGN_HUMAN REN3B_HUMAN CWC22_HUMAN homo precipitant | PKERSVADNFILTGQHMWYC |
REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
448 | V | E | b | 0.0 | 8tbx_A | hetero REN3B_HUMAN PAT1_YEAST homo precipitant | VLAISCEKTFGMPDNRHQY |
REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
449 | N | e | 24.2 | 8tbx_A | hetero GTPB4_HUMAN PAT1_YEAST metal NI homo precipitant | NGEDSKLPTAQRVFHIMYC |
REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with RELA" | ||
450 | P | T | b | 0.0 | 8tbx_A | hetero PAT1_YEAST homo | PSEKALDNQTFGRVHICMY |
REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with RELA" | |
451 | K | T | e | 42.9 | 8tbx_A | hetero GTPB4_HUMAN | KERTDSALQGHNVFIMPYC |
REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with RELA" | |
452 | T | T | e | 74.0 | 8tbx_A | hetero PAT1_YEAST homo | TLEKSAVFIDGPNRMQCHY |
REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with RELA" | |
453 | D | b | 18.5 | 8tbx_A | hetero 4ET_HUMAN THO1_YEAST PAT1_YEAST homo | DEKGLHSAINPQVFRTMYC |
REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with RELA" | ||
454 | R | e | 38.3 | 8tbx_A | hetero NOG1_CHATD 4ET_HUMAN PAT1_YEAST homo | RKNALQSTVEGIPYCDFHMW |
REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with RELA" | ||
455 | L | G | e | 23.6 | 8tbx_A | hetero NOG1_CHATD EDC3_YEAST | LIFVATGMRSEKDNPQYCH |
REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with RELA" | |
456 | W | G | b | 5.2 | 8tbx_A | hetero PAT1_YEAST NOG1_CHATD metal MG homo | LVTFSWAKYEGIMPQDNRCH |
REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with RELA" | |
457 | E | G | e | 34.7 | 8tbx_A | hetero EDC3_YEAST PAT1_YEAST CWC22_HUMAN THO1_YEAST metal MG precipitant | EQKADLSGNRTIPVFHYCMW |
REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with RELA" | |
458 | R | G | e | 69.2 | 8tbx_A | hetero CASC3_HUMAN EDC3_YEAST precipitant | RKLEAGSTVFIDNQYHPCMW |
REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with RELA" | |
459 | L | T | e | 23.0 | 8tbx_A | hetero THOC2_HUMAN THO1_YEAST precipitant | LIVAEFSGKPRYDMQTCHN |
REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with RELA" | |
460 | G | S | e | 75.0 | 8tbx_A | hetero EDC3_YEAST PAT1_YEAST precipitant | GASKQELNTVDFIPRCHMWY |
REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA" | |
461 | K | S | e | 44.8 | 8tbx_A | hetero PAT1_YEAST precipitant | KQELRASDGPVFIMNTYCHW |
REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA" | |
462 | S | S | e | 53.9 | 8tbx_A | hetero EDC3_YEAST precipitant | SLAEKTVIRGNPQYFDMCHW |
REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA" | |
463 | H | S | e | 27.7 | 8tbx_A | hetero EDC3_YEAST nucleotide precipitant | HYLEKADFGPSNQVRTIMC |
REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA" | |
464 | I | b | 9.4 | 8tbx_A | hetero EDC3_YEAST nucleotide | LIVAEGKSTDFNPQRMYCHW |
REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA" | ||
465 | R | e | 58.1 | 8tbx_A | nucleotide | RKLAEIFNQSTGVDPYMCHW |
REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA" | ||
466 | T | b | 5.8 | 8tbx_A | hetero NOG1_CHATD nucleotide | TVSLAKEIQRDGNPCFHMWY |
REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA" | ||
467 | D | b | 5.6 | 8tbx_A | DEKPSGLAQINTVRFHYCMW |
REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA" | |||
468 | D | S | e | 40.1 | 8tbx_A | hetero 4ET_HUMAN THO1_YEAST THO2_YEAST homo | DELNPAGIKSTVFQYRHCMW |
REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA" | |
469 | V | T | b | 0.0 | 8tbx_A | hetero 4ET_HUMAN precipitant | VLIAEGKTSYDFPRCMNQHW |
REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA" | |
470 | H | T | b | 2.6 | 8tbx_A | hetero 4ET_HUMAN THOC2_HUMAN THO1_YEAST GTPB4_HUMAN precipitant | HEADLKRSFGIQTVYNPMCW |
REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA" | |
471 | A | S | e | 71.4 | 8tbx_A | hetero 4ET_HUMAN | AVSKLGITREFPCDNQYMHW |
REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA" | |
472 | K | S | e | 42.9 | 8tbx_A | hetero NOG1_CHATD THO2_YEAST | KLSNRAEGDTIPQVFHYCMW |
REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA" | |
473 | D | S | e | 33.3 | 8tbx_A | hetero NOG1_CHATD 4ET_HUMAN | DEAGLSVIKNPQRTYFHCMW |
REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA" | |
474 | N | e | 61.2 | 8tbx_A | hetero 4ET_HUMAN THO2_YEAST | NSLERGKADIVQTHPFMYCW |
REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA" | ||
475 | T | e | 26.0 | 8tbx_A | hetero EDC3_YEAST THO2_YEAST | TLKSVAEDGIFNPQRYCHMW |
REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA" | ||
476 | R | S | e | 31.2 | 8tbx_A | hetero THO2_YEAST | KRELAVGPQSDINFTYHMCW |
REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA" | |
477 | P | T | e | 59.7 | 8tbx_A | PLSEADGIKTVFMQNRYCHW |
REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA" | ||
478 | G | T | e | 70.2 | 8tbx_A | GALSEFKTVDINPQRYCHMW |
REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA" | ||
479 | A | b | 19.6 | 8tbx_A | hetero THO2_YEAST | ALSVGIEKPDFRTCNQHMYW |
REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA" | ||
480 | N | e | 72.1 | 8tbx_A | precipitant | NDEKGLSTAFIQRVPYCHMW |
REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA" | ||
481 | S | S | e | 24.2 | 8tbx_A | precipitant | SAELKRVGQTDIPFNCHMYW |
MOD_RES /note="Phosphoserine" ECO:0007744|PubMed:21406692, ECO:0007744|PubMed:23186163" REGION /note="Necessary for interaction with RELA" MOD_RES /note="Phosphoserine" ECO:0007744|PubMed:21406692, ECO:0007744|PubMed:23186163" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA" | |
482 | P | H | e | 59.7 | 8tbx_A | PKLSADEVGRTINQCFYHMW |
REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA" | ||
483 | E | H | e | 23.6 | 8tbx_A | hetero CASC3_HUMAN | EKADYLNRSTQFGIPVCHMW |
REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA" | |
484 | M | H | b | 1.4 | 8tbx_A | hetero CASC3_HUMAN G0S7X0_CHATD 4ET_HUMAN EDC3_YEAST | LKVIQSEMTADFGNYPRHCW |
REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA" | |
485 | W | H | b | 14.7 | 8tbx_A | hetero REN3B_HUMAN CNOT1_HUMAN CWC22_HUMAN | LFWKVGAEIYTDNQRSCHMP |
REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA" | |
486 | S | H | b | 0.0 | 8tbx_A | hetero CASC3_HUMAN CNOT1_HUMAN 4ET_HUMAN | SKALVEPTFINQCDGRYHM |
REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA" | |
487 | E | H | b | 7.5 | 8tbx_A | hetero IF4F1_YEAST CNOT1_HUMAN 4ET_HUMAN GLE1_HUMAN | EKDQLSAIRVGNPTFHYCMW |
REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA" | |
488 | A | H | b | 0.0 | 8tbx_A | hetero IF4F1_YEAST CNOT1_HUMAN | LAKVSTGIRCEPFNQDMYH |
REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA" | |
489 | I | H | b | 0.0 | 8tbx_A | LIVKDAFGSTERYPMNQCH |
REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA" | ||
490 | K | H | b | 7.1 | 8tbx_A | hetero GLE1_HUMAN CWC22_HUMAN MRM3_HUMAN | KADERGQSVCLNPTFHIYM |
REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA" | |
491 | I | H | b | 7.6 | 8tbx_A | hetero IF4F1_YEAST GLE1_HUMAN REN3B_HUMAN CWC22_HUMAN | LIVFTKSARDEGMPCNQYH |
REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA" | |
492 | L | H | b | 0.0 | 8tbx_A | hetero IF4F1_YEAST precipitant | LIVAFEKMRSTDGNPQYCHW |
REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA" | |
493 | K | H | b | 4.2 | 8tbx_A | hetero IF4F1_YEAST GLE1_HUMAN precipitant | KSLRENQVAGPCDITFYHM |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" | |
494 | G | H | b | 1.2 | 8tbx_A | hetero G0S7X0_CHATD IF4F1_YEAST GLE1_HUMAN REN3B_HUMAN PRP8_HUMAN CWC22_HUMAN homo | GSDAKLNFTEPRQVCHIYM |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" | |
495 | E | H | b | 19.6 | 8tbx_A | hetero IF4F1_YEAST GLE1_HUMAN PRP8_HUMAN CWC22_HUMAN precipitant | ELSKDTAGIQVFHNRPYCM |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" | |
496 | Y | H | b | 7.4 | 8tbx_A | hetero IF4F1_YEAST GLE1_HUMAN PRP8_HUMAN GLE1_YEAST OSKA_DROME IF4G1_HUMAN CWC22_HUMAN precipitant | YFLKASVDEGITHNQRPCMW |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" | |
497 | A | H | b | 1.8 | 8tbx_A | hetero G0S7X0_CHATD IF4F1_YEAST GLE1_HUMAN IF4G1_HUMAN GLE1_YEAST CWC22_HUMAN precipitant | LASGKPETVDIRNQCFMYH |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" | |
498 | V | H | b | 8.0 | 8tbx_A | hetero G0S7X0_CHATD IF4F1_YEAST GLE1_HUMAN GLE1_YEAST IF4G1_HUMAN CWC22_HUMAN | VLIAETYKRCDFGPSMNQH |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" | |
499 | R | H | e | 38.7 | 8tbx_A | hetero GLE1_HUMAN OSKA_DROME IF4G1_HUMAN GLE1_YEAST CWC22_HUMAN PRP8_HUMAN | RKEFLSYADNVHQTGIMPC |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" | |
500 | A | H | b | 8.0 | 8tbx_A | hetero CWC22_HUMAN GLE1_YEAST IF4G1_HUMAN | LASTVFGIKENPQRDHMYC |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" | |
501 | I | H | b | 0.6 | 8tbx_A | hetero CWC22_HUMAN GLE1_YEAST IF4G1_HUMAN THO2_YEAST | LIVNSKAFTEGMPCDQRYH |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" | |
502 | K | H | e | 49.1 | 8tbx_A | hetero IF4G1_HUMAN THO2_YEAST Q63UP7_BURPS GLE1_YEAST CWC22_HUMAN | KERLSDNTAGQPFHIMVCY |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" | |
503 | E | H | e | 65.3 | 8tbx_A | hetero G0S7X0_CHATD | EKQRDNSLTACGHPVFIMY |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" | |
504 | H | H | e | 36.1 | 8tbx_A | hetero G0S7X0_CHATD PRP8_HUMAN THO2_YEAST | HENLGKSADFPQTVYIRMCW |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" | |
505 | K | T | e | 66.0 | 8tbx_A | hetero THOC2_HUMAN CNOT1_HUMAN THO2_YEAST A0A6A5Q535_YEASX THO1_YEAST compound CXS | KEPQRLSAGTVDINYFHWCM |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" | |
506 | M | b | 0.5 | 8tbx_A | hetero THOC2_HUMAN CNOT1_HUMAN THO2_YEAST A0A6A5Q535_YEASX THO1_YEAST precipitant | FVLGIAPTDKNQSEMRYCHW |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" | ||
507 | D | S | e | 43.2 | 8tbx_A | hetero THOC2_HUMAN IF4F1_YEAST CNOT1_HUMAN THO2_YEAST Q9XW17_CAEEL A0A6A5Q535_YEASX GLE1_YEAST | DNEGKSAPHLQTFMRVYCIW |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" | |
508 | Q | e | 23.5 | 8tbx_A | hetero IF4F1_YEAST CNOT1_HUMAN Q9XW17_CAEEL Q63UP7_BURPS GLE1_HUMAN CWC22_HUMAN IF4G1_HUMAN metal CL | KQRSELPTADGINCFHMVY |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" | ||
509 | A | E | b | 0.0 | 8tbx_A | ATVISCGLEKMDFHPQR |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" | ||
510 | I | E | b | 1.8 | 8tbx_A | ILVAMFDEGKQRT |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" | ||
511 | I | E | b | 0.6 | 8tbx_A | IVLAQYCDFKMPRT |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" | ||
512 | F | E | b | 0.5 | 8tbx_A | FYLDAEHIRSTV |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" | ||
513 | C | b | 1.3 | 8tbx_A | hetero GLE1_YEAST nucleotide precipitant | VCFLTASGIDEMNR |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" | ||
514 | R | S | e | 22.9 | 8tbx_A | hetero CASC3_HUMAN PDCD4_HUMAN PDCD4_MOUSE GLE1_YEAST D8AM26_ECOLX PAT1_YEAST nucleotide compound KEG otherpoly precipitant | NRSKEAPLQTHVDGFIM |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" | |
515 | T | S | b | 18.8 | 8tbx_A | hetero CASC3_HUMAN PDCD4_HUMAN PDCD4_MOUSE D8AM26_ECOLX PAT1_YEAST CWC22_HUMAN nucleotide compound KEG metal CL otherpoly precipitant | TSEIRKNHLQVYACDFMP |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" | |
516 | K | H | e | 34.0 | 8tbx_A | hetero PDCD4_HUMAN PDCD4_MOUSE D8AM26_ECOLX GGYF1_DROME CWC22_HUMAN nucleotide compound KEG V6D metal CL otherpoly homo precipitant | KRATQCIVELNSDGHPY |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" | |
517 | I | H | e | 37.4 | 8tbx_A | hetero CASC3_HUMAN PDCD4_HUMAN PDCD4_MOUSE 4ET_HUMAN OSKA_DROME Q9XW17_CAEEL D0A1K1_TRYB9 EDC3_YEAST PAT1_YEAST GGYF1_DROME CWC22_HUMAN Q4QCK6_LEIMA A0A3L6L070_9TRYP THO2_YEAST nucleotide otherpoly homo precipitant | KREIAHVDTLNQSFMCGY |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" | |
518 | D | H | e | 21.6 | 8tbx_A | hetero CASC3_HUMAN 4ET_HUMAN Q9XW17_CAEEL EDC3_HUMAN D0A1K1_TRYB9 EDC3_YEAST PAT1_YEAST GGYF1_DROME THO2_YEAST nucleotide compound CXS precipitant | DREKTSANVGHMPQFILY |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" | |
519 | C | H | b | 0.0 | 8tbx_A | nucleotide | ACVTLSDEGIKMNPQR |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" | |
520 | D | H | e | 25.9 | 8tbx_A | hetero RL23_HUMAN OSKA_DROME G0SI44_CHATD PAT1_YEAST nucleotide compound KEG homo | DEQHNAKSTIRGLVYFMP |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" | |
521 | N | H | b | 18.8 | 8tbx_A | hetero CASC3_HUMAN 4ET_HUMAN OSKA_DROME Q9XW17_CAEEL THO2_YEAST A0A6A5Q535_YEASX EDC3_YEAST PAT1_YEAST GGYF1_DROME EDC3_HUMAN nucleotide compound CXS precipitant | SERLYADFKNWTVGHIQCMP |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" | |
522 | L | H | b | 2.8 | 8tbx_A | hetero 4ET_HUMAN Q9XW17_CAEEL EDC3_HUMAN EDC3_YEAST PAT1_YEAST GGYF1_DROME nucleotide compound CXS precipitant | LVIFMYARSCEHPQT |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" | |
523 | E | H | b | 5.5 | 8tbx_A | hetero PDCD4_HUMAN OSKA_DROME PDCD4_MOUSE nucleotide homo precipitant | AESTLYDHRVIKNFGMQWCP |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" | |
524 | Q | H | e | 53.1 | 8tbx_A | hetero PDCD4_HUMAN OSKA_DROME PDCD4_MOUSE PAT1_YEAST homo precipitant | KREDSAQTYIGHLNVPCFM |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" | |
525 | Y | H | b | 12.2 | 8tbx_A | hetero EDC3_HUMAN 4ET_HUMAN OSKA_DROME Q9XW17_CAEEL THO2_YEAST A0A6A5Q535_YEASX EDC3_YEAST PAT1_YEAST GGYF1_DROME Q4Q9G4_LEIMA nucleotide homo precipitant | LYFKTEIADRVQWGHMNPS |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with RELA" | |
526 | F | H | b | 0.0 | 8tbx_A | hetero Q57TZ4_TRYB2 Q4Q9G4_LEIMA nucleotide | LFIMARYKSTVCDEGHNPQ |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |
527 | I | H | e | 41.5 | 8tbx_A | hetero OSKA_DROME C9ZS56_TRYB9 THO1_YEAST nucleotide homo precipitant | LTRIVAKSFGMNEQCDHPY |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |
528 | Q | H | e | 49.5 | 8tbx_A | hetero G0S832_CHATD OSKA_DROME Q9XW17_CAEEL EDC3_HUMAN NOG1_CHATD EDC3_YEAST GGYF1_DROME THO1_YEAST nucleotide homo precipitant | EQLRAKSDNTGMVFHIPYC |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |
529 | Q | T | e | 28.6 | 8tbx_A | hetero THOC2_HUMAN G0S832_CHATD EDC3_HUMAN CNOT1_HUMAN 4ET_HUMAN OSKA_DROME Q9XW17_CAEEL THO1_YEAST NOG1_CHATD EDC3_YEAST PAT1_YEAST GGYF1_DROME MRM3_HUMAN GTPB4_HUMAN homo | LQKERADSFTINPVGHMYCW |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |
530 | G | T | e | 35.7 | 8tbx_A | hetero THOC2_HUMAN NOG1_CHATD CNOT1_HUMAN THO1_YEAST homo | GALPSDEFNRTIKQVYCHMW |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |
531 | G | b | 4.8 | 8tbx_A | GLADEPSKTINVCFQRHMYW |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |||
532 | G | B | b | 1.2 | 8tbx_A | GALKINSVDPTERFHQYWCM |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
533 | P | T | e | 22.5 | 8tbx_A | PLTKSVAEGIDRFNQHMYCW |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
534 | D | T | e | 91.4 | 8tbx_A | DELSPAKNQTVGIRFHMYCW |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
535 | K | S | e | 42.0 | 8tbx_A | KALVEQRGIPSTDNYFHMCW |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
536 | K | T | e | 67.9 | 8tbx_A | hetero GLE1_YEAST GLE1_HUMAN PDCD4_HUMAN PDCD4_MOUSE | KRLEADSFNPGITVQHYCMW |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |
537 | G | T | e | 40.5 | 8tbx_A | hetero GLE1_YEAST GLE1_HUMAN PDCD4_HUMAN PDCD4_MOUSE THO2_YEAST precipitant | GASELKNQTDRVIPFHYCMW |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |
538 | H | e | 48.7 | 8tbx_A | hetero IF4F1_YEAST GLE1_YEAST CWC22_HUMAN GLE1_HUMAN THO2_YEAST A0A6A5Q535_YEASX IF4G1_HUMAN MRM3_HUMAN precipitant | HLKRSNADEGPVTCIMQYFW |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
539 | Q | T | e | 48.0 | 8tbx_A | hetero CWC22_HUMAN GTPB4_HUMAN IF4F1_YEAST GLE1_HUMAN GLE1_YEAST OSKA_DROME IF4G1_HUMAN | QKNDRELSGAPTHIVFYCMW |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |
540 | F | T | b | 2.9 | 8tbx_A | hetero THOC2_HUMAN IF4F1_YEAST CWC22_HUMAN CNOT1_HUMAN IF4G1_HUMAN THO1_YEAST compound CXS homo precipitant | FYILVAEHMWDPRSCGKNQT |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |
541 | S | B | b | 0.0 | 8tbx_A | hetero THOC2_HUMAN CWC22_HUMAN IF4F1_YEAST CNOT1_HUMAN IF4G1_HUMAN THO1_YEAST homo precipitant | PSKTADNEGRLQVFICHMY |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |
542 | C | E | b | 0.0 | 8tbx_A | hetero OSKA_DROME homo precipitant | AVCLSITNEFKDGHPQRY |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |
543 | V | E | b | 0.0 | 8tbx_A | hetero OSKA_DROME nucleotide homo precipitant | LIVASTFGYEMPRKCDHNQW |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |
544 | C | E | b | 0.0 | 8tbx_A | hetero G0SI44_CHATD RL23_HUMAN OSKA_DROME PAT1_YEAST nucleotide homo precipitant | ASEYPTCGLRVHIKDFMNQ |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |
545 | L | E | b | 3.9 | 8tbx_A | LIYVFMSAKDEGNPRT |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
546 | H | S | b | 1.0 | 8tbx_A | hetero RL23_HUMAN G0SI44_CHATD OSKA_DROME nucleotide compound KEG otherpoly homo | HYSTENAPFIKLQR |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |
547 | G | T | e | 63.1 | 8tbx_A | hetero GLE1_YEAST OSKA_DROME nucleotide compound KEG otherpoly homo | GSAREFHKLQT |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |
548 | D | T | e | 62.3 | 8tbx_A | hetero RL23_HUMAN OSKA_DROME D0A1K1_TRYB9 PDCD4_HUMAN CWC22_HUMAN A0A3L6L070_9TRYP NOP16_SCHPO G0SI44_CHATD RL23A_YEAST nucleotide compound KEG V6D homo precipitant | DGKSENQRAPVCHLTY |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |
549 | R | S | b | 11.1 | 8tbx_A | hetero OSKA_DROME nucleotide compound KEG otherpoly homo precipitant | LMKRQVIHSTYADEFN |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |
550 | K | e | 35.8 | 8tbx_A | hetero RL23_HUMAN G0SI44_CHATD OSKA_DROME RL23A_YEAST nucleotide compound KEG metal CL otherpoly homo precipitant | DSKTPAERNQGILHV |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
551 | P | H | e | 70.5 | 8tbx_A | hetero RL23_HUMAN nucleotide compound ADP metal CL otherpoly homo precipitant | QPADGKSVETFILMNRY |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |
552 | H | H | e | 63.4 | 8tbx_A | hetero RL23_HUMAN G0SI44_CHATD RL23A_YEAST nucleotide metal CL homo precipitant | QESTKHNRADGLVFIMPY |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |
553 | E | H | e | 29.1 | 8tbx_A | hetero RL23_HUMAN G0SI44_CHATD OSKA_DROME RL23A_YEAST nucleotide compound KEG homo precipitant | EAQDKSGRVHINTLMPY |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |
554 | R | H | e | 35.2 | 8tbx_A | hetero GLE1_YEAST OSKA_DROME nucleotide otherpoly homo precipitant | RNSDHKPQTY |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |
555 | K | H | e | 57.1 | 8tbx_A | hetero Q63UP7_BURPS nucleotide metal MG homo precipitant | EDLKTRNQSAIGMPFVY |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |
556 | Q | H | e | 48.5 | 8tbx_A | hetero RL23_HUMAN RL23A_YEAST nucleotide homo | KRESAGQNDITWHFLMVY |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |
557 | N | H | b | 10.3 | 8tbx_A | hetero G0SI44_CHATD nucleotide compound KEG homo precipitant | ITVANSLQRGMDEKP |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |
558 | L | H | b | 15.7 | 8tbx_A | precipitant | LIFVMQTYEKPSAGH |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |
559 | E | H | e | 40.2 | 8tbx_A | hetero Q63UP7_BURPS homo precipitant | KEAQDHNSRTGFLMVWY |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |
560 | R | H | e | 26.9 | 8tbx_A | hetero GLE1_HUMAN nucleotide homo | DEKRQASGNLTFHMP |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |
561 | F | H | b | 1.4 | 8tbx_A | metal CL | FWLDYAGIMPRSV |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |
562 | K | H | e | 57.5 | 8tbx_A | hetero GLE1_HUMAN GLE1_YEAST Q63UP7_BURPS metal CL MG precipitant | RKSTGLINPAFQVCEM |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |
563 | K | T | e | 75.5 | 8tbx_A | hetero THOC2_HUMAN IF4F1_YEAST GLE1_HUMAN GLE1_YEAST Q63UP7_BURPS THO2_YEAST CWC22_HUMAN metal MG homo precipitant | NKESATDQRGLCFHIMPV |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |
564 | G | T | e | 60.7 | 8tbx_A | hetero THOC2_HUMAN CWC22_HUMAN IF4F1_YEAST GLE1_YEAST GLE1_HUMAN THO2_YEAST CNOT1_HUMAN IF4G1_HUMAN A0A6A5Q535_YEASX homo precipitant | GSAFNQDTKLRCEHIMPVY |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |
565 | D | S | b | 9.3 | 8tbx_A | hetero THOC2_HUMAN CWC22_HUMAN GLE1_YEAST GLE1_HUMAN IF4F1_YEAST CNOT1_HUMAN IF4G1_HUMAN THO2_YEAST A0A6A5Q535_YEASX Q63UP7_BURPS homo precipitant | KDEANSLQRVGHTIMPY |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |
566 | V | S | b | 0.7 | 8tbx_A | hetero CWC22_HUMAN THOC2_HUMAN OSKA_DROME GLE1_HUMAN THO2_YEAST A0A6A5Q535_YEASX homo precipitant | SITVKYALNCFPGHRQDEM |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |
567 | R | S | e | 27.3 | 8tbx_A | hetero THOC2_HUMAN CWC22_HUMAN IF4F1_YEAST GLE1_YEAST GLE1_HUMAN CNOT1_HUMAN THO2_YEAST IF4G1_HUMAN A0A6A5Q535_YEASX Q63UP7_BURPS THO1_YEAST compound CXS precipitant | RNPDKSEGACLQTVWYFHIM |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |
568 | F | E | b | 0.0 | 8tbx_A | hetero CNOT1_HUMAN precipitant | IVLFACNQYGMSTDEKPR |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |
569 | L | E | b | 1.1 | 8tbx_A | LIMVGCADEFKPRST |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
570 | I | E | b | 0.0 | 8tbx_A | VILFACDEGKMPST |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
571 | C | E | b | 2.0 | 8tbx_A | ACTSVGDEIKLPR |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
572 | T | b | 8.4 | 8tbx_A | hetero PDCD4_HUMAN GLE1_YEAST D8AM26_ECOLX PDCD4_MOUSE nucleotide compound KEG otherpoly | TSANDEGIKLPQRV |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
573 | D | H | e | 27.2 | 8tbx_A | hetero PDCD4_HUMAN GLE1_YEAST D8AM26_ECOLX PDCD4_MOUSE CWC22_HUMAN nucleotide compound KEG metal CL otherpoly precipitant | DQNEASTVGKILPR |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |
574 | V | H | e | 84.7 | 8tbx_A | hetero PDCD4_HUMAN GLE1_YEAST D8AM26_ECOLX PDCD4_MOUSE CWC22_HUMAN EIF3L_HUMAN nucleotide compound KEG otherpoly precipitant | VLAIMDEGPRSKNQT |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |
575 | A | H | b | 14.3 | 8tbx_A | hetero PDCD4_HUMAN CWC22_HUMAN nucleotide metal ZN precipitant | ALFTVISGMCWDEKNPQR |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |
576 | A | H | b | 6.2 | 8tbx_A | nucleotide precipitant | ASGTEVDFIKLNPQR |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |
577 | R | H | e | 34.4 | 8tbx_A | hetero PDCD4_HUMAN D8AM26_ECOLX EIF3L_HUMAN compound ADP metal CL precipitant | RNLMKADEFGIPQSTV |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |
578 | G | H | e | 85.7 | 8tbx_A | hetero Q63UP7_BURPS compound ANP ATP 08T ADP metal MG precipitant | GCADEFIKLNPQRSTV |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |
579 | I | b | 8.8 | 8tbx_A | compound ATP precipitant | ILVYMFTADEGKNPQRS |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
580 | D | e | 50.0 | 8tbx_A | hetero Q63UP7_BURPS compound ADP ANP ATP 08T CDP GDP UDP M2A metal MG precipitant | DNRHGAEFIKLPQSTV |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
581 | I | b | 17.0 | 8tbx_A | hetero Q63UP7_BURPS compound ATP metal MG CL precipitant | IVFLHKMYQTARSDEGNP |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
582 | H | e | 39.3 | 8tbx_A | hetero GLE1_YEAST Q63UP7_BURPS GLE1_HUMAN SF3B1_HUMAN compound ADP ANP ATP metal MG precipitant | PSKAQEYLNDGMRTVHI |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
583 | G | e | 26.2 | 8tbx_A | hetero THOC2_HUMAN CWC22_HUMAN GLE1_HUMAN GLE1_YEAST CNOT1_HUMAN Q9XW17_CAEEL THO2_YEAST Q63UP7_BURPS metal CL MG precipitant | NGDTASREKQHIVLMPY |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
584 | V | B | b | 1.3 | 8tbx_A | compound ATP metal MG precipitant | VILHAFTCM |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |
585 | P | S | b | 4.7 | 8tbx_A | hetero THOC2_HUMAN GLE1_HUMAN CNOT1_HUMAN THO2_YEAST precipitant | DKSENRTAPQHCFGI |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |
586 | Y | E | b | 15.7 | 8tbx_A | hetero RL1D1_HUMAN CIC1_YEAST G0S7X0_CHATD precipitant | LHYVNPAFTWCIMQDEGRS |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |
587 | V | E | b | 0.0 | 8tbx_A | precipitant | VRAIM |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |
588 | I | E | b | 1.2 | 8tbx_A | IVLHFYAM |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
589 | N | E | b | 0.0 | 8tbx_A | NQHLEFSCIMTV |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
590 | V | S | b | 11.3 | 8tbx_A | hetero 4ET_HUMAN Q9XW17_CAEEL EDC3_HUMAN EDC3_YEAST PAT1_YEAST GGYF1_DROME nucleotide compound CXS precipitant | YFLVIMAHWC |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |
591 | T | S | b | 5.2 | 8tbx_A | hetero CASC3_HUMAN PAT1_YEAST metal CL precipitant | DGRSNTEHQCFM |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |
592 | L | b | 0.6 | 8tbx_A | precipitant | LFVMPIACSTY |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
593 | P | b | 1.6 | 8tbx_A | hetero CASC3_HUMAN D8AM26_ECOLX metal MG precipitant | PASCLTV |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
594 | D | S | e | 44.4 | 8tbx_A | hetero CASC3_HUMAN PDCD4_HUMAN PDCD4_MOUSE GLE1_YEAST D8AM26_ECOLX CWC22_HUMAN nucleotide compound KEG metal MG precipitant | DKNTFSRALQEPGHYIMV |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |
595 | E | S | e | 58.8 | 8tbx_A | hetero MGN_HUMAN CASC3_HUMAN PDCD4_HUMAN MGN2_HUMAN GLE1_YEAST CNOT1_HUMAN D8AM26_ECOLX PDCD4_MOUSE CWC22_HUMAN EIF3L_HUMAN nucleotide compound KEG metal MG homo precipitant | DSTNEHKQAGILMPRV |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |
596 | K | T | e | 35.4 | 8tbx_A | hetero MGN_HUMAN ERB1_CHATD CASC3_HUMAN PDCD4_HUMAN MGN2_HUMAN D8AM26_ECOLX PDCD4_MOUSE nucleotide compound KEG precipitant | PAISTVLYFKRCDMGHNW |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |
597 | Q | H | e | 44.4 | 8tbx_A | hetero MGN_HUMAN ERB1_CHATD MGN2_HUMAN PDCD4_HUMAN GLE1_YEAST CNOT1_HUMAN D8AM26_ECOLX PDCD4_MOUSE CWC22_HUMAN EIF3L_HUMAN compound KEG metal ZN precipitant | EDKSARVIQTMLNP |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |
598 | N | H | b | 18.8 | 8tbx_A | hetero PDCD4_HUMAN D8AM26_ECOLX PDCD4_MOUSE CWC22_HUMAN EIF3L_HUMAN nucleotide metal MG otherpoly precipitant | DNTSEIQAVGFKLCHM |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |
599 | Y | H | b | 1.3 | 8tbx_A | YFLHI |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
600 | V | H | e | 20.7 | 8tbx_A | hetero ERB1_CHATD PDCD4_HUMAN PDCD4_MOUSE metal ZN | VILCTAHMRY |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |
601 | H | H | e | 67.0 | 8tbx_A | hetero CNOT1_HUMAN D8AM26_ECOLX CWC22_HUMAN metal ZN CL precipitant | HQSRN |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |
602 | R | H | b | 1.6 | 8tbx_A | precipitant | RSEHQAKTV |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |
603 | I | H | b | 1.8 | 8tbx_A | precipitant | VISACLMTF |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |
604 | G | T | e | 44.0 | 8tbx_A | precipitant | GSA |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |
605 | R | T | b | 17.0 | 8tbx_A | hetero Q63UP7_BURPS compound ANP ATP 08T ADP metal MG precipitant | REQY |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |
606 | V | B | b | 2.7 | 8tbx_A | hetero Q63UP7_BURPS compound ATP metal MG | TASDVGIL |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |
607 | G | b | 13.1 | 8tbx_A | hetero Q63UP7_BURPS | GAS |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
608 | R | e | 47.8 | 8tbx_A | hetero Q63UP7_BURPS compound ADP ANP ATP 08T CDP GDP UDP M2A metal MG precipitant | RPHQ |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
609 | A | T | e | 75.9 | 8tbx_A | hetero MGN_HUMAN MGN2_HUMAN Q63UP7_BURPS GLE1_HUMAN compound ADP ANP ATP 08T CDP GDP UDP M2A | AFRMGHDLYNSCEIKTV |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |
610 | E | T | e | 27.6 | 8tbx_A | hetero MGN_HUMAN MGN2_HUMAN GLE1_HUMAN Q63UP7_BURPS | GNWEDSTAKLR |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |
611 | R | S | e | 33.6 | 8tbx_A | hetero GLE1_YEAST SF3B1_HUMAN compound ADP ATP precipitant | RKANQTEHSFV |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |
612 | M | e | 31.4 | 8tbx_A | hetero GLE1_HUMAN Q57TZ4_TRYB2 IF4G1_HUMAN Q63UP7_BURPS homo | KESTPRADLVNQGHIMWY |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
613 | G | E | b | 1.2 | 8tbx_A | hetero CNOT1_HUMAN precipitant | GASCK |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |
614 | L | E | b | 15.7 | 8tbx_A | hetero CNOT1_HUMAN Q57TZ4_TRYB2 C9ZS56_TRYB9 precipitant | LVTRKEIFSHACMNQWDGY |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |
615 | A | E | b | 0.0 | 8tbx_A | ASGVCKRT |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
616 | I | E | b | 2.3 | 8tbx_A | IVLYTFAHCMRW |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
617 | S | E | b | 0.0 | 8tbx_A | TSLNVQAIMYCFG |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
618 | L | E | b | 1.1 | 8tbx_A | FLIPMVTY |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
619 | V | E | b | 0.0 | 8tbx_A | nucleotide | VILFCAMYGT |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |
620 | A | E | b | 0.9 | 8tbx_A | hetero CASC3_HUMAN | TSALQDGNCEHVFIPYKMR |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |
621 | T | S | e | 23.4 | 8tbx_A | hetero GTPB4_HUMAN PRP8_HUMAN MGN_HUMAN precipitant | PTSEDKNGQLVYAHIMRW |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |
622 | E | S | e | 31.7 | 8tbx_A | hetero PRP8_HUMAN CASC3_HUMAN nucleotide homo precipitant | EKDQTCPSGNRHYALMVW |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |
623 | K | e | 57.5 | 8tbx_A | hetero CASC3_HUMAN MALE_ECO57 THOC4_HUMAN SPB1_YEAST G0S9T3_CHATD G0SGD8_CHATD homo precipitant | EDRKQNSGAPTYH |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
624 | E | E | b | 6.0 | 8tbx_A | hetero MGN_HUMAN MGN2_HUMAN precipitant | EDRSKALVTGHIMNPQ |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |
625 | K | E | b | 8.5 | 8tbx_A | hetero MGN_HUMAN MALE_ECO57 THOC4_HUMAN CASC3_HUMAN MGN2_HUMAN nucleotide | KREADQSNFGYHILMPTV |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |
626 | V | E | b | 2.7 | 8tbx_A | hetero CASC3_HUMAN MALE_ECO57 THOC4_HUMAN G0S9T3_CHATD | VILASMTFKDEGNYPHQR |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |
627 | W | E | b | 8.8 | 8tbx_A | FLWYSVMAGIKPRDEQ |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
628 | Y | e | 27.4 | 8tbx_A | hetero MGN_HUMAN MGN2_HUMAN | YLVRFHKEADISGMWPQT |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
629 | H | e | 30.9 | 8tbx_A | hetero MGN_HUMAN CASC3_HUMAN MALE_ECO57 THOC4_HUMAN MGN2_HUMAN PDCD4_HUMAN G0S9T3_CHATD metal ZN precipitant | DRKHESANITGLPQYMV |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
630 | V | e | 67.3 | 8tbx_A | hetero CASC3_HUMAN G0S9T3_CHATD | ILVAFMKTRSDEGPW |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
631 | C | S | e | 24.0 | 8tbx_A | metal ZN | LEAICTKVMDSGPQRFNY |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |
632 | S | T | e | 85.2 | 8tbx_A | KSNAEQRLDGTIPVFHY |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
633 | S | T | e | 46.1 | 8tbx_A | hetero G0S9T3_CHATD | SATEVKDILRGMHNQFPY |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |
634 | R | T | e | 53.0 | 8tbx_A | hetero G0S9T3_CHATD | RKLIEAVDQSTFHNGMPY |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |
635 | G | T | e | 23.8 | 8tbx_A | GQASNDLVIKRPTEFHMY |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
636 | K | T | e | 40.6 | 8tbx_A | hetero MGN_HUMAN | KERSVQAGPTDILNFHY |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |
637 | G | T | e | 72.6 | 8tbx_A | hetero MGN_HUMAN MGN2_HUMAN PDCD4_HUMAN PDCD4_MOUSE | GKQSAFNRVDEPLTIY |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |
638 | C | b | 15.3 | 8tbx_A | hetero MGN_HUMAN PDCD4_HUMAN MGN2_HUMAN PDCD4_MOUSE metal ZN | CLAVFKGSYIMQDHNRTWEP |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
639 | Y | e | 80.4 | 8tbx_A | hetero PDCD4_HUMAN PDCD4_MOUSE | YELFKIHSQTADGNRVMPW |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
640 | N | e | 47.9 | 8tbx_A | hetero MGN_HUMAN MGN2_HUMAN PDCD4_HUMAN PDCD4_MOUSE homo | NESKLGDVAIMPQRFHT |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
641 | T | e | 31.8 | 8tbx_A | hetero MGN_HUMAN MGN2_HUMAN | TLSVEIRYDGHANPFKQ |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
642 | R | S | b | 13.8 | 8tbx_A | hetero MGN_HUMAN RBM8A_HUMAN MGN2_HUMAN | RKQESDTVNLHPAGI |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |
643 | L | B | e | 32.0 | 8tbx_A | ILVRCDKMSGPTYAEFNQ |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
644 | K | G | e | 27.8 | 8tbx_A | hetero RBM8A_HUMAN MGN_HUMAN MGN2_HUMAN | EKDINTVHSAPRQGL |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |
645 | E | G | e | 52.8 | 8tbx_A | hetero MGN_HUMAN MGN2_HUMAN REN3B_HUMAN CWC22_HUMAN | EKADSRPVMQTGILNW |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |
646 | D | G | e | 48.1 | 8tbx_A | DEHANVQPLGKSMFIRTY |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
647 | G | T | e | 70.2 | 8tbx_A | GAKSVMDNREPLQTFIY |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
648 | G | b | 0.0 | 8tbx_A | GDESVLKRTAINMFPQY |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |||
649 | C | S | b | 3.3 | 8tbx_A | metal ZN | VCEKALNSRTDFPQYIG |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |
650 | T | E | b | 0.0 | 8tbx_A | TSVDENKQACHLYFGIPR |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
651 | I | E | e | 32.7 | 8tbx_A | ILDSVKEFMAGNQRPTY |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
652 | W | E | e | 29.5 | 8tbx_A | WFLERDTAQGIKSVPNY |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
653 | Y | E | b | 8.3 | 8tbx_A | LYPERVFHQAMKSWDGINT |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
654 | N | e | 38.8 | 8tbx_A | NEAKIDHVGLSTFPQR |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |||
655 | E | H | b | 2.0 | 8tbx_A | EQDKSVNFLIRAGPT |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
656 | M | H | e | 28.0 | 8tbx_A | MVLKRAIPFSEDQTGN |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
657 | Q | H | e | 48.0 | 8tbx_A | QEDKRNPAHSTGML |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
658 | L | H | b | 13.5 | 8tbx_A | LAIEMKRVNSG |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
659 | L | H | b | 1.1 | 8tbx_A | LVIFTYRAMPSDEQ |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
660 | S | H | e | 38.3 | 8tbx_A | SATNQDKEMVLPGR |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
661 | E | H | e | 32.2 | 8tbx_A | EKQRDPAGLSV |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
662 | I | H | b | 1.2 | 8tbx_A | ILVAKEMNRDGPST |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
663 | E | H | b | 14.1 | 8tbx_A | EDKQVFLAPRGINST |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
664 | E | H | e | 69.3 | 8tbx_A | EDPKARQSNTGLV |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
665 | H | H | e | 52.9 | 8tbx_A | HRSPQKNYEIVMADGLT |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
666 | L | T | b | 11.8 | 8tbx_A | LVFYICMAKEGST |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
667 | N | T | e | 80.0 | 8tbx_A | NDETARSGIKYQLPV |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
668 | C | S | b | 20.0 | 8tbx_A | ACISTKQEVDFPGLR |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
669 | T | e | 79.2 | 8tbx_A | TSVAEINRKQGL |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |||
670 | I | b | 3.5 | 8tbx_A | ILVKQMEFSTAG |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |||
671 | S | e | 46.9 | 8tbx_A | SEQRKDANVGL |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |||
672 | Q | B | e | 57.7 | 8tbx_A | EQRGLPKDAF |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
673 | V | e | 78.7 | 8tbx_A | VLIAMRK |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |||
674 | E | e | 32.1 | 6b4i_E | EDRSHPTV |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |||
675 | P | S | b | 5.8 | 6b4i_E | PKESACIDMT |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
676 | D | S | e | 65.4 | 6b4i_E | hetero GLE1_HUMAN | DESKTPNQV |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |
677 | I | - | - | - | - | IVSLERAFM |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
678 | K | - | - | - | - | KPQDRL |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
679 | V | - | - | - | - | VKLENTFIA |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
680 | P | - | - | - | - | EPKAVMNGLS |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
681 | V | - | - | - | - | VLNAISKMEG |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
682 | D | - | - | - | - | DKNRS |
REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK" | ||
683 | E | - | - | - | - | EDFGHSMA |
REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK" | ||
684 | F | - | - | - | - | FKHLM |
REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK" | ||
685 | D | - | - | - | - | DSKPLQR |
REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK" | ||
686 | G | - | - | - | - | GEKL |
REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK" | ||
687 | K | - | - | - | - | KQAGN |
REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK" | ||
688 | V | - | - | - | - | VQNIKF |
REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK" | ||
689 | T | - | - | - | - | TKVELG |
REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK" | ||
690 | Y | - | - | - | - | YSHKG |
REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK" | ||
691 | G | - | - | - | - | GSADEFIKLNPQRTVY |
REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK" | ||
692 | Q | - | - | - | - | QRKTADEFGILNPSVY |
REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK" | ||
693 | K | - | - | - | - | KARDEFGILNPQSTVY |
REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK" | ||
694 | R | - | - | - | - | RNLADEFGIKPQSTVY |
REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK" | ||
695 | A | - | - | - | - | APLTDEGKSVCFHIMNQRY |
REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK" | ||
696 | A | - | - | - | - | AVGNRLTDEKSCFHIMPQY |
REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK" | ||
697 | G | - | - | - | - | GLNAMT |
REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK" | ||
698 | G | - | - | - | - | GS |
REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK" | ||
699 | G | - | - | - | - | GAQYST |
REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK" | ||
700 | S | - | - | - | - | ATEGDLSIKNPQRV |
REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK" | ||
701 | Y | - | - | - | - | YCK |
REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK" | ||
702 | K | - | - | - | - | KRLES |
REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK" | ||
703 | G | - | - | - | - | GRDP |
REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK" | ||
704 | H | - | - | - | - | HQ |
REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK" | ||
705 | V | - | - | - | - | VEDTAFGIKLNPQRSY |
REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK" | ||
706 | D | - | - | - | - | DERAFGIKLNPQSTVY |
REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK" | ||
707 | I | - | - | - | - | AIMQEDFGKLNPRSTVY |
REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK" | ||
708 | L | - | - | - | - | LAGDEFIKNPQRSTVY |
REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK" | ||
709 | A | - | - | - | - | APRGVLDEFIKNQSTY |
REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK" | ||
710 | P | - | - | - | - | PS |
REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK" | ||
711 | T | - | - | - | - | TR |
REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK" | ||
712 | V | - | - | - | - | VS |
REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with HNRNPK" | ||
713 | Q | - | - | - | - | QRL |
REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with HNRNPK" | ||
714 | E | - | - | - | - | EAGKQ |
REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK" | ||
715 | L | - | - | - | - | LFQ |
REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK" | ||
716 | A | - | - | - | - | ADPTS |
REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with HNRNPK" | ||
717 | A | - | - | - | - | QAMDE |
REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK" | ||
718 | L | - | - | - | - | LTQ |
REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK" | ||
719 | E | - | - | - | - | EP |
REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with HNRNPK" | ||
720 | K | - | - | - | - | EKPL |
REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with HNRNPK" | ||
721 | E | - | - | - | - | QEAT |
REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with HNRNPK" | ||
722 | A | - | - | - | - | AIS |
REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with HNRNPK" | ||
723 | Q | - | - | - | - | QEN |
REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with HNRNPK" | ||
724 | T | - | - | - | - | TSI |
REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with HNRNPK" | ||
725 | S | - | - | - | - | LSGD |
REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with HNRNPK" | ||
726 | F | - | - | - | - | FYL |
REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with HNRNPK" | ||
727 | L | - | - | - | - | LC |
REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with HNRNPK" | ||
728 | H | - | - | - | - | HYT |
REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with HNRNPK" | ||
729 | L | - | - | - | - | L |
REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with HNRNPK" | ||
730 | G | - | - | - | - | GE |
REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with HNRNPK" | ||
731 | Y | - | - | - | - | YL |
REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with HNRNPK" | ||
732 | L | - | - | - | - | LH |
REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with HNRNPK" | ||
733 | P | - | - | - | - | PS |
REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with HNRNPK" | ||
734 | N | - | - | - | - | NR |
REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with HNRNPK" | ||
735 | Q | - | - | - | - | Q |
REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with HNRNPK" | ||
736 | L | - | - | - | - | L |
REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with HNRNPK" | ||
737 | F | - | - | - | - | F |
REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with HNRNPK" | ||
738 | R | - | - | - | - | R |
REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with HNRNPK" | ||
739 | T | - | - | - | - | T |
REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with HNRNPK" | ||
740 | F | - | - | - | - | F |
REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with HNRNPK" |