Contact Molecules for Homologous Proteins


[Summary Bars]

[Full Bars]


Site Table[90 %]


[Back to Search Page]

[Back to HOMCOS]

[Sites by Variants]

[SupCon3D]

[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
10705 740 3 Q92499(DDX1_HUMAN) RecName: Full=ATP-dependent RNA helicase DDX1; EC=3.6.4.13 ;AltName: Full=DEAD box protein 1;AltName: Full=DEAD box protein retinoblastoma; Short=DBP-RB;
QUERYSEQ
MAAFSEMGVMPEIAQAVEEMDWLLPTDIQAESIPLILGGGDVLMAAETGSGKTGAFSIPVIQIVYETLKDQQEGKKGKTTIKTGASVLNKWQMNPYDRGSAFAIGSDGLCCQSREVKEWHGCRATKGLMKGKHYYEVSCHDQGLCRVGWS
TMQASLDLGTDKFGFGFGGTGKKSHNKQFDNYGEEFTMHDTIGCYLDIDKGHVKFSKNGKDLGLAFEIPPHMKNQALFPACVLKNAELKFNFGEEEFKFPPKDGFVALSKAPDGYIVKSQHSGNAQVTQTKFLPNAPKALIVEPSRELAE
QTLNNIKQFKKYIDNPKLRELLIIGGVAARDQLSVLENGVDIVVGTPGRLDDLVSTGKLNLSQVRFLVLDEADGLLSQGYSDFINRMHNQIPQVTSDGKRLQVIVCSATLHSFDVKKLSEKIMHFPTWVDLKGEDSVPDTVHHVVVPVNP
KTDRLWERLGKSHIRTDDVHAKDNTRPGANSPEMWSEAIKILKGEYAVRAIKEHKMDQAIIFCRTKIDCDNLEQYFIQQGGGPDKKGHQFSCVCLHGDRKPHERKQNLERFKKGDVRFLICTDVAARGIDIHGVPYVINVTLPDEKQNYV
HRIGRVGRAERMGLAISLVATEKEKVWYHVCSSRGKGCYNTRLKEDGGCTIWYNEMQLLSEIEEHLNCTISQVEPDIKVPVDEFDGKVTYGQKRAAGGGSYKGHVDILAPTVQELAALEKEAQTSFLHLGYLPNQLFRTF
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]
  [n]:site number of query sequence.  [a]:amino acid of query sequence.  [s]:predicted secondary structure.
  [e]:predicted exposed/buried.  [acc]:predicted relative accesssibility(%).  [pdb]:PDB code of homologous structure.
  [contact_mols]:predicted binding molecules  [observed aa]:Observed amino acids among homologous sequences.  [feature table]:UniProt Feature Table
  [variant]:UniProt Human Variant.
n a s e acc pdb contact_mols observed aa feature table variant
1MTe 28.5 8tbx_A
IMVLF
REGION /note="Necessary for interaction with HNRNPK" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
2AHe 47.3 8tbx_A
STAKRLPQEMGN
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
3AHb 11.6 8tbx_A
STAKGREQCDHLN
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
4FHb 0.0 8tbx_A
FWIL
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
5SHe 28.9 8tbx_A
SEADKQTNHRVGL
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
6ETe 82.9 8tbx_A
EDSQANHTGIP
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
7MTb 17.9 8tbx_A
LFMCISAYPVT
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
8GTe 52.4 8tbx_A
GNPDKQSACEFHLRTY
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
9V b 3.3 8tbx_A
LIVFCMER
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
10M b 12.6 8tbx_A
SHKPDGNTVELQRAICM
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
11PHe 52.7 8tbx_A
PEDRSKAQTGNVY
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
12EHe 41.7 8tbx_A
EPRWDKQSLNTAHFIYGV
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
13IHb 0.0 8tbx_A
LIVTMAS
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
14AHb 0.0 8tbx_A
LIVMACRSKQTEFGHNY
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
15QHe 35.7 8tbx_A
KREQDSAHMGLNIT
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
16AHb 0.0 8tbx_A
AGNSTVELRIKQ
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
17VHb 0.0 8tbx_A
LIVCAFKMQ
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
18EHe 39.2 8tbx_A
KEYASDNRTQFLGHIMPV
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
19ETe 46.2 8tbx_A
EKDARSQNLTGFV
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
20MTe 28.0 8tbx_A
LMAKSYIQVFNCEGT
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
21DTe 82.7 8tbx_A compound ADP
GKNEADHRSLPQ
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
22W e 27.1 8tbx_A compound ADP
FYIWLVDKMS
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
23L e 46.6 8tbx_A
EKTNVDSALQRMPYGHI
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
24LSe 66.3 8tbx_A compound ADP
KRETAVNQHSFLYDIM
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
25P e 23.3 8tbx_A compound ADP
PMLVCATS
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
26T e 30.5 8tbx_A compound ADP
TSRAKM
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
27DHe 84.6 8tbx_A
PAEDLSTKHQVGR
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
28IHb 2.3 8tbx_A
IVT
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
29QHb 3.1 8tbx_A compound ADP
QN
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
30AHe 39.3 8tbx_A
ASFKREQMCGILNTV
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
31EHe 50.8 8tbx_A
ADKREQSYLVGHIMNT
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
32SHb 0.0 8tbx_A
ASTNCGMVIL
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
33IHb 0.0 8tbx_A
ILVWFM
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
34PHe 41.1 8tbx_A
PLMSFGKNRTV
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
35LHe 29.8 8tbx_A
LIPVQAEHMSTYFGKR
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
36IHb 0.0 8tbx_A
IALYVFSGTCM
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
37LHe 24.2 8tbx_A
LIMACFQRSTVY
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
38GTe 79.8 8tbx_A
QSKAEDGNTLRCHM
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
39GTe 36.9 8tbx_A
GNKREHSDQ
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
40G e 45.2 8tbx_A
RKHQTEGLNPSVADIY
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
41D b 4.3 8tbx_A
DNSEHAGIKLPRTV
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
42VEb 0.7 8tbx_A
VILCAMTDEGKNPRS
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
43LEb 0.0 8tbx_A
ILVMAFCDEGKNPRST
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
44MEb 0.0 8tbx_A
GAVILCSDEKMNPRT
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
45AEb 2.7 8tbx_A
QACKGIVRELMSDTHNP
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
46A b 4.5 8tbx_A
ASDGEIKLNPRTV
BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
47E e 73.4 8tbx_A compound ADP
QKERVPSADHFGILNTY
BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
48TTe 70.8 8tbx_A compound ADP
TSNC
BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
49GTe 91.7 8tbx_A compound ADP
GNS
BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
50SSb 15.6 8tbx_A compound ADP
STYAM
BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
51GSe 21.4 8tbx_A compound ADP
G
BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
52KHb 2.8 8tbx_A compound ADP
KE
MUTAGEN /note="K->N: Abolishes ability to promote guanylylation of RTCB." BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" MUTAGEN /note="K->N: Abolishes ability to promote guanylylation of RTCB." BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
53THb 7.8 8tbx_A compound ADP metal MG
TNS
BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
54GHb 3.6 8tbx_A compound ADP
ALVGHIMFS
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
55AHb 0.0 8tbx_A
ALSGTVMC
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
56FHb 0.0 8tbx_A
FYRI
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
57SHb 1.6 8tbx_A
LSAVGICTM
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
58IHb 0.0 8tbx_A
ILDVFAGTW
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
59PHb 0.8 8tbx_A
PSGATIL
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
60VHb 0.7 8tbx_A
IVLMARCTFS
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
61IHb 0.6 8tbx_A
LIVWFCMAE
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
62QHb 5.1 8tbx_A
ACDEHIKLMNQRSV
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
63IHb 13.5 8tbx_A
YKFLHQANRSEGIMTVC
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
64VHb 1.3 8tbx_A
ILVACMSWYEHT
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
65YHb 17.0 8tbx_A
LYFSDWAEHIKMQRVCNPTG
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
66EHe 43.2 8tbx_A
EKQDRHSNPTAYIL
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
67THb 10.4 8tbx_A
TSHKLNEQRYACPVDFGIW
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
68LHb 17.4 8tbx_A
LRAEIPGKMNSDVYHQ
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
69KTe 32.5 8tbx_A
KRPNALSEGQYDFHIMV
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
70DTe 88.3 8tbx_A
DEASKNPQTHLRVGIM
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
71Q e 58.7 8tbx_A
QKSPRLTDEINAVCFMY
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
72Q----
QRETDNAKSPCFHILMV
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
73E----
EPKTQLNDAMSVYHIRG
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
74G----
GLASENTDHKPFMQR
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
75K----
KRAIEPNLQCGSVY
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
76K----
KREAIQDLPSYFGNT
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
77G----
GPNTAKSDEFIR
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
78K----
KPEARLNQSTHDMCGV
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
79T----
TSARGVLEDKPIMQ
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
80T----
TASPVIKERYGL
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
81I----
IVATLREGSFMDN
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
82K----
KRGPQENAYCLSIV
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
83T----
TPALIEDGSKQRV
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
84G----
GAILNPSTFVEK
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
85A----
AIVKGQTEHLS
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
86S e 89.1 4xw3_B
SLRVPQAGT
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
87VGe 22.7 4xw3_B
IPVATEGLY
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
88LGb 7.9 4xw3_B
LTVIPGK
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
89NGe 57.0 4xw3_B
SRNDQTHLY
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
90KSe 51.9 4xw3_B
ESIGKHRTPADLV
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
91WSb 9.6 4xw3_B
LWYIFADEGKNPQRSTV
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
92QSb 12.8 4xw3_B
AQGETHIKDFLNPRSV
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
93MEb 0.0 4xw3_B
LMYVAGS
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
94NEb 0.0 4xw3_B
NQDEGSAV
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
95PEe 22.5 4xw3_B
PILADFQKST
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
96YEe 36.5 4xw3_B
YNMEHPLIFQ
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
97DEb 0.0 4xw3_B
DANKMTCE
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
98REe 31.6 4xw3_B
QRKPENV
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
99G b 1.2 4xw3_B
DGSILYV
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
100STe 69.5 4xw3_B
STQKLNVEHD
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
101ATe 28.6 4xw3_B
KANDISYGHR
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
102FEb 0.5 4xw3_B
FLYMHADEGIKNPQRSTV
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
103AEe 38.4 4xw3_B
AKPESTGNDFILQRV
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
104IEe 20.5 4xw3_B
LAIKPSVDEGNQRT
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
105G e 38.1 4xw3_B
ADGNRSTMEIKLPV
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
106STe107.8 4xw3_B
SGENIPARTVM
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
107DTe 35.8 4xw3_B
DETGNVAHKL
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
108GSb 1.2 4xw3_B
GANEKRLSV
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
109L b 12.4 4xw3_B
LVMTCIF
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
110CEe 21.3 4xw3_B
CAGLSEITR
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
111CEb 0.0 4xw3_B
CSAVKYIL
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
112QEe 35.7 4xw3_B
QDGELKS
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
113SEb 0.0 4xw3_B
SATRDKEGLV
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
114R e 37.9 4xw3_B
RLGQAESKTV
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
115E e 39.2 4xw3_B
ESKVDRATFGILNPQ
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
116VTe 67.3 4xw3_B
VKLRAIMFDEGNPQSTY
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
117KTe 84.4 4xw3_B
KSFMERAL
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
118E e 47.7 4xw3_B
RSAEQGNDKFILPTV
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
119W e 26.7 4xw3_B
WFDIAKY
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
120HEb 1.6 4xw3_B
HSAFELRC
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
121GEb 0.0 4xw3_B
GARSVM
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
122CEb 0.7 4xw3_B
AIVCFG
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
123REb 1.6 4xw3_B
REQPIVK
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
124AEb 0.0 4xw3_B
ASKTCG
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
125TSb 0.0 4xw3_B
TNVYES
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
126KEb 10.4 4xw3_B
YTKRAPSF
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
127GEb 0.0 4xw3_B
GACS
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
128LEb 0.0 4xw3_B
VILR
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
129MSe 25.1 4xw3_B
LTYKSDQRMWVNAEG
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
130KSe 44.3 4xw3_B
KSANERDGLTV
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
131GSb 13.1 4xw3_B
GDAEKLSTV
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
132KEe 33.5 4xw3_B
KFRILAVEGST
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
133HEb 4.7 4xw3_B
HWYVF
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
134YEb 0.9 4xw3_B
YLSCMV
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
135YEb 0.0 4xw3_B
YFDW
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
136EEb 1.0 4xw3_B
ED
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
137VEb 0.0 4xw3_B
VIFSAM
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
138SEb 9.4 4xw3_B
SKETDLQAI
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
139CEb 4.7 4xw3_B
IVCALK
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
140H e 40.3 4xw3_B
VGHTLSYENR
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
141DSb 17.3 4xw3_B
DTESR
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
142QSe 78.1 4xw3_B
SQKTEDRPVANL
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
143GSe 32.1 4xw3_B
GPHSAL
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
144LEe 43.3 4xw3_B
LVYDFHEIPA
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
145CEb 4.0 4xw3_B
MCVITLQ
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
146REb 6.7 4xw3_B
RQGS
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
147VEb 0.0 4xw3_B
IVL
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
148GEb 0.0 4xw3_B
GL
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
149WEb 0.0 4xw3_B
WLVF
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
150SEb 0.8 4xw3_B
SACKT
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
151T b 2.6 4xw3_B
TRLASV
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
152MTb 13.5 4xw3_B
LDQMKCITRA
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
153QTe 67.9 4xw3_B
QDGKSPTAFRN
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
154ASb 6.2 4xw3_B
CSAPGYTVF
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
155S e 38.3 4xw3_B
SDNPGRKC
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
156LSb 6.2 4xw3_B
LFMRASTVQ
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
157DSe 25.9 4xw3_B
NQDLEFGMT
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
158LTb 0.6 4xw3_B
LRVIP
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
159GTb 0.0 4xw3_B
G
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
160TSb 16.9 4xw3_B
DWETSCYAK
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
161DSb 19.8 4xw3_B
DETHACG
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
162KTe 46.7 4xw3_B
KEDHAGPLR
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
163FTb 16.3 4xw3_B
FYNDREHLTMQ
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
164GEb 0.0 4xw3_B
SGA
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
165FEb 0.5 4xw3_B
YFWVC
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
166GEb 0.0 4xw3_B
GAV
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
167FEb 0.0 4xw3_B
YFL
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
168GEb 6.0 4xw3_B
DGAHRSTN
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
169GTb 17.9 4xw3_B
GPDLS
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
170TTe 51.9 4xw3_B
TENDHCRFIK
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
171GTb 10.7 4xw3_B
GRDKNSAL
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
172KEe 33.0 4xw3_B
KGSVAHCITLM
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
173KEe 20.3 4xw3_B
KQRHENSAL
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
174SEb 0.0 4xw3_B
SRKFITAML
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
175HEb 18.8 4xw3_B
HWDTFYCSENAL
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
176NTe 59.4 4xw3_B
NHDSKAEL
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
177KTe 68.4 4xw3_B
KGQRSACVL
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
178QEe 59.2 4xw3_B
QTGESKLPR
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
179FEe 37.8 4xw3_B
FGTYLNRAIS
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
180DEe 40.7 4xw3_B
EDISTQN
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
181NEe 79.4 4xw3_B
DNPKHTWGAES
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
182Y b 10.0 4xw3_B
YFK
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
183GSe 50.0 4xw3_B
GMNA
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
184E e 35.2 4xw3_B
EQPRKADLV
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
185E e 73.4 4xw3_B
EPTRSAKQ
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
186F b 5.7 4xw3_B
FWYIS
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
187T e 39.6 4xw3_B
TKLQAGVDE
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
188MTe 29.0 4xw3_B
TAEMPQLSKN
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
189HTe 84.3 4xw3_B
GNHEA
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
190D b 14.2 4xw3_B
D
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
191TEb 3.9 4xw3_B
VTFI
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
192IEb 0.0 4xw3_B
IVF
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
193GEb 1.2 4xw3_B
GTS
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
194CEb 0.0 4xw3_B
CFSV
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
195YEb 3.9 4xw3_B
YFLCMG
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
196LEb 0.0 4xw3_B
ILVDAFY
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
197DEb 3.7 4xw3_B
DNER
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
198ITb 15.2 4xw3_B
LFVIMPT
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
199DTe 66.0 4xw3_B
DNCIEKPRTV
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
200KTe 64.6 4xw3_B
EDNTCKS
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
201GTb 1.2 4xw3_B
GSNEKQRHVD
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
202HEe 25.7 4xw3_B
TEQHINADGKLPRSV
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
203VEb 0.0 4xw3_B
ILMVCADEGKNPQRST
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
204KEb 10.4 4xw3_B
SFIKMEGWYADLNPQRTV
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
205FEb 0.0 4xw3_B
FYW
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
206SEb 1.6 4xw3_B
TSDFACY
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
207KEb 16.0 4xw3_B
KLSR
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
208NTe 34.5 4xw3_B
NM
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
209GTe 53.6 4xw3_B
GAF
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
210KEe 60.8 4xw3_B
EKVLQAGHN
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
211DEe 39.5 4xw3_B
DWQCSKLNVY
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
212LEb 14.6 4xw3_B
LMQEFSI
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
213GEe 28.6 4xw3_B
GKPNE
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
214LEe 43.3 4xw3_B
LIAVSPTE
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
215AEb 2.7 4xw3_B
AEGDKQL
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
216FEb 10.5 4xw3_B
FPALK
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
217EEe 63.3 4xw3_B
ERKTSDQA
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
218I b 8.2 4xw3_B
ITVFKALDNS
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
219P e 22.5 4xw3_B
PSLKAFDRQEGTV
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
220PGe 94.6 4xw3_B
KSPDHEVAGLT
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
221HGe 41.4 4xw3_B
GESHKANFRDL
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
222MGb 0.5 4xw3_B
LIVGDWTKSYMA
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
223KTe 39.2 4xw3_B
KVTAQSLGPR
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
224NTe 87.9 4xw3_B
GNVSQADKL
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
225QSe 30.1 4xw3_B
QRGMDSTAHEF
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
226A b 12.5 4xw3_B
AGNPFMTCVIRSK
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
227LBb 0.6 4xw3_B
LFTYIKV
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
228FEb 0.5 4xw3_B
FYLRVAI
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
229PEb 0.0 4xw3_B
PEAKSD
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
230AEb 1.8 4xw3_B
ASVFPHT
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
231CEb 0.0 4xw3_B
VCMSITAL
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
232VEb 0.0 4xw3_B
SGVLKNFAE
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
233LEb 0.0 4xw3_B
LMCIAVEGS
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
234KEe 27.8 4xw3_B
KQSGNHAELV
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
235NSe 37.0 4xw3_B
NEGTVYFDQSPAL
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
236AEb 0.9 4xw3_B
APCDSRQKEGFILNTV
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
237EEe 20.1 4xw3_B
ELAQGTSHVDFIKNPR
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
238LEb 1.1 4xw3_B
LVCMADEFGIKNPQRSTY
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
239KEe 21.7 4xw3_B
REPAKDQSHLFGINTVY
MOD_RES /note="N6-acetyllysine" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" MOD_RES /note="N6-acetyllysine" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
240FEb 1.0 4xw3_B
YLFMAVGSDEIKNPQRT
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
241NEb 10.9 4xw3_B
NLASFGDEIKPQRTVY
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
242FSb 1.9 4xw3_B
FLYADEGIKNPQRSTV
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
243GSb 13.1 4xw3_B
GSNVEADFIKLPQRTY
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
244ESe 68.3 4xw3_B
NEQRKSYAFLDGIPTV
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
245ESe 53.3 4xw3_B
ELKQMDRSNPTYAGVFHI
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
246E e 96.5 4xw3_B
PGKRSEDALFINQTVY
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
247F b 19.1 4xw3_B
FPALSKMDEGINQRTVY
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
248KSe 57.1 4xw3_B
KSEIRLVPADFGNQTY
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
249FSe 35.9 4xw3_B
AFIKLNHYDEGPRSTV
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
250P e 78.3 4xw3_B
PDQVIAFEGKLNRST
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
251P e 26.4 4xw3_B
PQEILSCTVAG
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
252K e 39.2 4xw3_B
KSEAGIQVLR
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
253DTe 63.0 4xw3_B
DRKNIAMEGLPQSTV
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
254GTe 71.4 4xw3_B
GQLAKDEFINPRSTVY
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
255F b 7.7 4xw3_B
AFILMPRSY
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
256VEe 47.3 4xw3_B
VLIRDMKQPT
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
257AEb 11.6 4xw3_B
APGMSQVLT
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
258LGb 0.0 4xw3_B
LIQPFAV
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
259SGb 12.5 4xw3_B
SACQDNPTG
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
260KGe 59.0 4xw3_B
QKRDNEHT
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
261ASb 6.2 4xw3_B
APGSIKTV
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
262P e 55.8 4xw3_B
PGLIKQER
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
263DGe 82.1 4xw3_B
DSNTQHREFL
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
264GGe 85.7 4xw3_B
GANHTLRK
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
265YGe 50.0 4xw3_B
YFLHKSIDMVNAEGPT
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
266IEb 15.2 4xw3_B
ILVSTDKAY
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
267VEe 35.3 4xw3_B
AILVMSEGFQ
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
268KEe 52.4 4xw3_B
KAPQERSNMDTV
MOD_RES /note="N6-acetyllysine" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" MOD_RES /note="N6-acetyllysine" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
269S b 4.7 4xw3_B
STAQFKHPMGNYDL
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
270QSe 69.9 4xw3_B
QLRASKTVWEIP
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
271H b 10.5 4xw3_B
ADEGLPRSTVHNQ
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
272SSe 36.7 4xw3_B
SLNTERGFDPQVAIK
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
273GGe 54.8 4xw3_B
GIATELPCKNRVMQ
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
274NGe103.6 4xw3_B
NTKSCGALPRDEI
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
275AGe 36.6 4xw3_B
ASFTGPKDEHLQVR
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
276Q e 57.7 4xw3_B
QKELMRTGASIP
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
277VBe 29.3 4xw3_B
LIAVKSRDGMTHNP
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
278T e 64.9 4xw3_B
STVNQLAKYDERFCIMP
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
279Q e 37.8 4xw3_B
QRLAEKSNDFHIMTVY
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
280T----
STLIVANEKDGQRMPY
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
281K----
KREVQDPNTAILSGHMY
MOD_RES /note="N6-acetyllysine; alternate" CROSSLNK /note="Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternate" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" MOD_RES /note="N6-acetyllysine; alternate" CROSSLNK /note="Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternate" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
282F----
FIEPLVYGAKQRSDMNTWH
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
283L----
LVKRDIAEMNQSTGYCFHP
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
284P----
PDLQKEGAINRSVHMT
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
285N----
NDRGHQSPTEKALYV
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
286ASb 4.5 8tbx_A
AGQVESKCRTHIPYDFLN
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
287P b 1.6 8tbx_A
PTVIFELCSAKMRY
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
288KSb 5.2 8tbx_A
QRSGTIFKLYAEHMNV
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
289AEb 0.0 8tbx_A
AVGRSICTM
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
290LEb 1.1 8tbx_A
LIVAFMC
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
291IEb 1.2 8tbx_A
IVACLFM
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
292VEb 1.3 8tbx_A
LIVMEDFCT
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
293E b 0.0 8tbx_A
ASVTCLQRFEGM
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
294PSb 14.7 8tbx_A
PEHNAS
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
295S e 32.8 8tbx_A
TSNADVI
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
296RHb 19.4 8tbx_A
RKSTHQVAFLNY
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
297EHe 34.7 8tbx_A
EDSTLMP
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
298LHe 25.8 8tbx_A
LWI
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
299AHb 0.0 8tbx_A
AVSCQIGT
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
300EHe 42.7 8tbx_A
LQVDEIANRSHMTYKCFGW
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
301QHe 51.5 8tbx_A compound ADP
QEADT
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
302THb 1.3 8tbx_A
IVTGAELQCNS
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
303LHb 11.2 8tbx_A
YFALQHVKSGETIRCDMN
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
304NHe 69.1 8tbx_A
DKENQSRAGPTHLVIM
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
305NHb 8.5 8tbx_A
VETGKDNSHIAMQRFLCP
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
306IHb 2.3 8tbx_A
LVAIECFYGMSTDK
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
307KHe 20.8 8tbx_A
KELTRNQISAVDGMCFY
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
308QHe 30.1 8tbx_A
KEQRATDLSGVNPCFHIMY
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
309FHb 0.0 8tbx_A
LFIMTAHVCGYEQSW
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
310KTb 18.9 8tbx_A
GASLKTERVCIMPQDHNY
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
311KTe 24.5 8tbx_A
KARSQEHDTGLPYFINV
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
312YTe 43.0 8tbx_A
FYHLAGEPIKTVCRSWDMNQ
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
313I b 5.3 8tbx_A
LTICMVGASNHPDFYEKQRW
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
314D e 44.4 8tbx_A
DGSNAEKPTVFQYHILRCM
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
315NSe 86.1 8tbx_A
GNSALRDHKQEPTVFIMYC
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
316PSe 47.3 8tbx_A
PSTKLVAEGIRDHMNFQYC
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
317K e 55.2 8tbx_A
KGNRDLSEQTAIPVWYCHFM
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
318L b 6.2 8tbx_A
LIVFKACGMTYHNPQRS
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
319R b 14.2 8tbx_A
RKSVTNAQEGDHICFLPY
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
320EEe 33.7 8tbx_A
VSTAPCIEFKNQDGLHMRWY
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
321LEb 12.4 8tbx_A
VALGQCMHITFSEKRYDN
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
322LEb 19.1 8tbx_A
LVACNSTIMYGKPQEFHR
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
323IEb 0.6 8tbx_A
VILAFCSMTWDNPQRY
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
324I b 10.5 8tbx_A
IVYTSLAFGKMPCDNR
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
325GSe 79.8 8tbx_A
GPSAKTNQRDEFLV
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
326GSe102.4 8tbx_A
GADNSKEQTVCILMPR
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
327VSe 28.7 8tbx_A
TVLASMEIDKQRFGHNPCY
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
328A e 46.4 8tbx_A
SPDANGKTRELVQCFHIMY
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
329AHe 36.6 8tbx_A
LIAKVMPRYDSEFTGNHQW
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
330RHe 28.9 8tbx_A
RKEQDGASNVLMPTFHIWY
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
331DHe 66.0 8tbx_A
DEKNQSVARGLPTHIFMY
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
332QHb 5.6 8tbx_A
QDELSIKNRMTAFGHVY
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
333LHe 42.1 8tbx_A
LAIKRVEFSNQDGMTCHPY
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
334SHe 44.5 8tbx_A
RSKEANTDLQGIPVYFHMW
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
335VHe 26.0 8tbx_A
RLAKVEIQDFMSNTPCGHWY
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
336LHb 12.9 8tbx_A
LIMVAFKRSCEGHNPQTY
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
337EHe 45.7 8tbx_A
KERSQADNTMPFGHILVY
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
338NHe 83.0 8tbx_A
KNDREQSTGAHIMPVLYCFW
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
339G e 38.1 8tbx_A
GKNPREASTQCDHILVYMW
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
340V b 2.0 8tbx_A
PVACITGLMQSYEFKNR
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
341DSb 11.7 8tbx_A
DHNQESARTGIKLPV
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
342IEb 2.3 8tbx_A
IVLFMAGS
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
343VEb 0.7 8tbx_A
LVIAMCFGS
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
344VEb 0.7 8tbx_A
VIFSACGLT
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
345GEb 0.0 8tbx_A
AGSTCIL
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
346T b 13.6 8tbx_A
TNSAGLM
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
347PHb 1.6 8tbx_A
PTAVCGILMS
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
348GHe 44.0 8tbx_A
GADSHLCFMNPQTY
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
349RHb 12.6 8tbx_A
RKLTMACGHIQS
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
350LHb 0.0 8tbx_A
LVIFMACGST
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
351DHe 22.2 8tbx_A
LIDVAKFHMQENSWCGPRTY
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
352DHe 64.2 8tbx_A
DHEQSAKGNFILRTVY
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
353LHb 6.7 8tbx_A
LMHIFNVTYACSWEGKQ
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
354VHb 10.0 8tbx_A
LIVADEFKMQTCRSGHNY
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
355STe 67.2 8tbx_A
ENKQSRDAGLTVIFHMY
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
356TTe 62.3 8tbx_A
RSTKENAQDPLGMCFHIV
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
357GTe 88.1 8tbx_A
GKRNESDPQAMTHLVFIY
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
358K b 18.4 8tbx_A
AKSGRVHNPTEILQYDMCF
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
359LSb 4.5 8tbx_A
LIFVTYAMEKNCDGPQRS
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
360N e 48.5 8tbx_A
DSNKRVFEHGITALQCMPY
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
361L b 6.7 8tbx_A
LFTVIMPACDGKNRSY
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
362STe 49.2 8tbx_A
SKDRANEGTHQPFLMV
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
363QTe 32.7 8tbx_A
NSKRQHADTEGFLCIMVY
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
364V b 2.0 8tbx_A
VLICRAMTDFPS
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
365R b 17.4 8tbx_A
KREQTSDNACGHLMPVY
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
366FEb 0.0 8tbx_A
YFVMILHTWASCDGKNQ
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
367LEb 0.6 8tbx_A
LVFITAMCKR
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
368VEb 0.0 8tbx_A
VIDATCGL
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
369LEb 1.1 8tbx_A
LIFMVCY
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
370DTb 0.0 8tbx_A metal MG
DSAEGLV
MOTIF /note="DEAD box" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" MOTIF /note="DEAD box" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
371ETb 13.6 8tbx_A metal MG
EKN
MUTAGEN /note="E->G: Inhibits the transcriptional activity of RELA and attenuates NF-kappa-B-mediated gene expression." ECO:0000269|PubMed:24870230" MUTAGEN /note="E->Q: Abolishes ability to promote guanylylation of RTCB." ECO:0000269|PubMed:24870230" MOTIF /note="DEAD box" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" MUTAGEN /note="E->G: Inhibits the transcriptional activity of RELA and attenuates NF-kappa-B-mediated gene expression." ECO:0000269|PubMed:24870230" MUTAGEN /note="E->Q: Abolishes ability to promote guanylylation of RTCB." ECO:0000269|PubMed:24870230" MOTIF /note="DEAD box" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
372AHb 0.0 8tbx_A
ACIVGFSTL
MOTIF /note="DEAD box" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" MOTIF /note="DEAD box" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
373DHb 14.8 8tbx_A
DHN
MOTIF /note="DEAD box" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" MOTIF /note="DEAD box" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
374GHe 27.4 8tbx_A
RLTKEGQMINSACDFHV
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
375LHb 0.0 8tbx_A
MLFIVCT
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
376LHb 10.7 8tbx_A
LIFMVNTY
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
377SHe 78.9 8tbx_A
DEKMSGTANQLRYC
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
378QTe 49.0 8tbx_A
MQDVLREIFKPSYGAHNT
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
379GTe 54.8 8tbx_A
GESHDQAILNTMPRY
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
380Y e 31.7 8tbx_A
FALYVDHISCEGKMPQRTW
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
381SHe 27.3 8tbx_A
EQAGDKSILRTFNVHMY
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
382DHe 62.3 8tbx_A
DEKPQGSFNALRTVHIY
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
383FHb 1.4 8tbx_A
QDEFMTVNWILSAHKPCGY
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
384IHb 0.0 8tbx_A
ILVMCTESAFKNPR
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
385NHb 20.0 8tbx_A
REDSKNLQTPVYCIAGFHM
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
386RHe 39.1 8tbx_A
RKDEQASTNVFHLCGIMPWY
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
387MHb 1.9 8tbx_A
ILVMDCTAEFGQRS
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
388HHb 14.1 8tbx_A
LVIFRKAEHMDQYGSTCNP
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
389NHe 87.3 8tbx_A
SEKDNQRGATCHLFIMPVY
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
390QHe 51.5 8tbx_A
RHIAELQKVCDFNSTYMGP
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
391ISb 0.6 8tbx_A
LIMTVFACEPRSGHKNQY
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
392P e 48.1 8tbx_A
PADSFNKTEGILQRVHMY
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
393QSe 43.4 8tbx_A
KQRAEDSPGHLNTVIMCFWY
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
394VBe 54.0 8tbx_A
IAVLTSQEGKMYCDFNPRH
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
395T b 14.9 8tbx_A
TRPSAKLEFNDGIVCMQHY
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
396STe 87.5 8tbx_A
SPARGKQTEDLNIMVCFHYW
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
397DTe 45.7 8tbx_A
DTSANPKEIGHLQRVFCMWY
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
398GSe 65.5 8tbx_A
GSANDKLPTERQIVCFHMWY
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
399K e 21.7 8tbx_A
KRESPQADTVLGHIMNCFWY
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
400RBe 47.0 8tbx_A
RKNDEQTLSGPVAHFIYCM
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
401L b 2.2 8tbx_A
RLIVPTACKDGSYEFMNQWH
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
402QEb 5.6 8tbx_A
QRNETDHKLMSVACGI
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
403VEb 0.7 8tbx_A
TVLMIKAFNSGCEHQRY
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
404IEb 0.0 8tbx_A
LVMIFAEKSTYCDG
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
405VEb 0.0 8tbx_A
LMVFSIPACDEKTY
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
406CEb 0.0 8tbx_A
FCVLAMSYEGPWDIKNQT
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
407SEb 0.0 8tbx_A
STNACDEFGKP
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
408ASe 25.0 8tbx_A
AQSEDGIKNTV
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
409TSe 41.6 8tbx_A
TLSADFGIKMNRV
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
410LSe 44.9 8tbx_A
LMFIVWSTADKPYCEGNQR
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
411HSe 37.7 8tbx_A
PTANQSEKDHFGLIRVWYCM
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
412S e 26.6 8tbx_A
SDTKPEARNQVGILFHY
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
413FHe 62.7 8tbx_A
LAEFKSDMQRVYGPTHINWC
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
414DHe 59.9 8tbx_A
DESKNLAGQRPTFIVMY
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
415VHb 2.0 8tbx_A
VILFPAESDMTGKNQRY
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
416KHb 16.5 8tbx_A
EKRQLADNSGHTPFIMVWY
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
417KHb 18.9 8tbx_A
KERQDSAPVNTFGIHLMY
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
418LHb 1.1 8tbx_A
LIFVMATHYCDEGKNPQSW
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
419SHb 5.5 8tbx_A
ASTKCGIPQLMRVHDEFNY
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
420EHe 50.3 8tbx_A
KREDQSNAGLTFMYHIPV
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
421KHe 57.1 8tbx_A
KLQRAETSDFVGINCHMPY
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
422IHb 2.3 8tbx_A
FILSVYGTHNKPADEMQRW
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
423M b 8.7 8tbx_A
LMAFVGIQRCDKNPTESY
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
424HSe 40.3 8tbx_A
NHRKQTGSEPVDFILYAM
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
425FSe 47.8 8tbx_A
NDFKESLRTGQIAHMPVY
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
426P e 23.3 8tbx_A
PAYSETVGIKLDFHMNQR
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
427TEe 40.9 8tbx_A
VTELAIKRNSGYDQFHMP
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
428WEe 21.5 8tbx_A
REYLKTVISWAFMNQDGHCP
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
429VEb 1.3 8tbx_A
IVLEKRTAFMCDGNPQS
REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
430D e 52.5 8tbx_A
DQSTEKNRLAGIYFVHPM
REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
431L e 58.4 8tbx_A
LVIAETKMSGHNQRCDFPY
REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
432K----
GKDLENVARSTMQFIPYH
REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
433G----
GASDEKNRPTVFLHIQMY
REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
434E----
EDKRSNQVIALTGHPCFMY
REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
435D----
DEKSAGNLQTIPRVFHYM
REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
436S e 80.5 8tbx_A
SALTEKVFNQRDGPICHMWY
REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
437V b 17.3 8tbx_A
ALTVIMFSKDEGNQYCPR
REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
438P e 44.2 8tbx_A
PKVASLENGRTHQCDFIMY
REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
439DSb 13.6 8tbx_A
DESKLNPGVATQHIRFY
REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
440TSe 29.9 8tbx_A
TSNGADEIKLRQVYFPCHM
REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
441VEb 2.7 8tbx_A
VILAKTFGMQSDENPRY
REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
442HEe 30.4 8tbx_A
HEKQRTFNYDGILSAMPV
REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
443HEb 14.1 8tbx_A
QYHLEGISKNTVADFPRM
REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
444VEb 18.7 8tbx_A
VILTFYKSAEGMNRCHPQD
REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
445VEb 0.0 8tbx_A
VIAFLYEMSTDGKNPQRCHW
REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
446VEb 11.3 8tbx_A
VILGATEFMSYCDKNQRHP
REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
447PEe 29.5 8tbx_A
PKERSVADNFILTGQHMWYC
REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
448VEb 0.0 8tbx_A
VLAISCEKTFGMPDNRHQY
REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA"
449N e 24.2 8tbx_A
NGEDSKLPTAQRVFHIMYC
REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with RELA"
450PTb 0.0 8tbx_A
PSEKALDNQTFGRVHICMY
REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with RELA"
451KTe 42.9 8tbx_A
KERTDSALQGHNVFIMPYC
REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with RELA"
452TTe 74.0 8tbx_A
TLEKSAVFIDGPNRMQCHY
REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with RELA"
453D b 18.5 8tbx_A
DEKGLHSAINPQVFRTMYC
REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with RELA"
454R e 38.3 8tbx_A
RKNALQSTVEGIPYCDFHMW
REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with RELA"
455LGe 23.6 8tbx_A
LIFVTAGMRSEKDNPQYCH
REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with RELA"
456WGb 5.2 8tbx_A
LVTFSWAKYEGIMPQDNRCH
REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with RELA"
457EGe 34.7 8tbx_A
EQKADLSGNRTIPVFHYCMW
REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with RELA"
458RGe 69.2 8tbx_A
RKLEAFGSTVIDNQYHPCMW
REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with RELA"
459LTe 23.0 8tbx_A
LIVAEFSGKPYDMQRTCHN
REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with RELA"
460GSe 75.0 8tbx_A
GASKQELNTVDFIPRCHMWY
REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA"
461KSe 44.8 8tbx_A
KQELRASDGPVFIMNTYCHW
REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA"
462SSe 53.9 8tbx_A
SLAEKTVIRGNPQYFDMCHW
REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA"
463HSe 27.7 8tbx_A
HYLEKADFGPSNQVRTIMC
REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA"
464I b 9.4 8tbx_A
LIVAEGKSTDFNPQRMYCHW
REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA"
465R e 58.1 8tbx_A
RKLAEIFNQSTGVDPYMCHW
REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA"
466T b 5.8 8tbx_A
TVSLAKEIQRDGNPCFHMWY
REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA"
467D b 5.6 8tbx_A
DEKPSGLAQINTVRFHYCMW
REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA"
468DSe 40.1 8tbx_A
DELNPAGIKSTVFQYRHCMW
REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA"
469VTb 0.0 8tbx_A
VLIAEGKTSYDFPRCMNQHW
REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA"
470HTb 2.6 8tbx_A
HEADLKRSFGIQTVYNPMCW
REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA"
471ASe 71.4 8tbx_A
AVSKLGITREFPCDNQYMHW
REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA"
472KSe 42.9 8tbx_A
KLSNRAEGDTIPQVFHYCMW
REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA"
473DSe 33.3 8tbx_A
DEAGLSVIKNPQRTYFHCMW
REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA"
474N e 61.2 8tbx_A
NSLERGKADIVQTHPFMYCW
REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA"
475T e 26.0 8tbx_A
TLKSVAEDGIFNPQRYCHMW
REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA"
476RSe 31.2 8tbx_A
KRELAVGPQSDINFTYHMCW
REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA"
477PTe 59.7 8tbx_A
PLSEADGIKTVFMQNRYCHW
REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA"
478GTe 70.2 8tbx_A
GALSEFKTVDINPQRYCHMW
REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA"
479A b 19.6 8tbx_A
ALSVGIEKPDFRTCNQHMYW
REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA"
480N e 72.1 8tbx_A
NDEKGLSTAFIQRVPYCHMW
REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA"
481SSe 24.2 8tbx_A
SAELKRVGQTDIPFNCHMYW
MOD_RES /note="Phosphoserine" ECO:0007744|PubMed:21406692, ECO:0007744|PubMed:23186163" REGION /note="Necessary for interaction with RELA" MOD_RES /note="Phosphoserine" ECO:0007744|PubMed:21406692, ECO:0007744|PubMed:23186163" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA"
482PHe 59.7 8tbx_A
PKLSADEVGRTINQCFYHMW
REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA"
483EHe 23.6 8tbx_A
EKADYLNRSTQFGIPVCHMW
REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA"
484MHb 1.4 8tbx_A
LKVIQSEMTADFGNYPRHCW
REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA"
485WHb 14.7 8tbx_A
LFWKVGAEIYTDNQRSCHMP
REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA"
486SHb 0.0 8tbx_A
SKALVEPTFINQCDGRYHM
REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA"
487EHb 7.5 8tbx_A
EKDQLSAIRVGNPTFHYCMW
REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA"
488AHb 0.0 8tbx_A
LAKVSTGIRCEPFNQDMYH
REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA"
489IHb 0.0 8tbx_A
LIVKDAFGSTERYPMNQCH
REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA"
490KHb 7.1 8tbx_A
KADERGQSVCLNPTFHIYM
REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA"
491IHb 7.6 8tbx_A
LIVFTKSARDEGMPCNQYH
REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA"
492LHb 0.0 8tbx_A
LIVAFEKMRSTDGNPQYCHW
REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA"
493KHb 4.2 8tbx_A
KSLRENQVAGPCDITFYHM
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA"
494GHb 1.2 8tbx_A
GSDAKLNFTEPRQVCHIYM
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA"
495EHb 19.6 8tbx_A
ELSKDTAGIQVFHNRPYCM
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA"
496YHb 7.4 8tbx_A
YFLKASVDEGITHNQRPCMW
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA"
497AHb 1.8 8tbx_A
LASGKPETVDIRNQCFMYH
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA"
498VHb 8.0 8tbx_A
VLIAETYKRCDFGPSMNQH
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA"
499RHe 38.7 8tbx_A
RKEFLSYADNVHQTGIMPC
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA"
500AHb 8.0 8tbx_A
LASTVFGIKENPQRDHMYC
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA"
501IHb 0.6 8tbx_A
LIVNSKAFTEGMPCDQRYH
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA"
502KHe 49.1 8tbx_A
KERLSDNTAGQPFHIMVCY
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA"
503EHe 65.3 8tbx_A
EKQRDNSLTACGHPVFIMY
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA"
504HHe 36.1 8tbx_A
HENLGKSADFPQTVYIRMCW
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA"
505KTe 66.0 8tbx_A
KEPQRLSAGTVDINYFHWCM
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA"
506M b 0.5 8tbx_A
FVLGIAPTDKNQSEMRYCHW
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA"
507DSe 43.2 8tbx_A
DNEGKSAPHLQTFMRVYCIW
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA"
508Q e 23.5 8tbx_A
KQRSELPTADGINCFHMVY
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA"
509AEb 0.0 8tbx_A
ATVISCGLEKMDFHPQR
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA"
510IEb 1.8 8tbx_A
ILVAMFDEGKQRT
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA"
511IEb 0.6 8tbx_A
IVLAQYCDFKMPRT
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA"
512FEb 0.5 8tbx_A
FYLDAEHIRSTV
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA"
513C b 1.3 8tbx_A
VCFLTASGIDEMNR
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA"
514RSe 22.9 8tbx_A
NRSKEAPLQTHVDGFIM
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA"
515TSb 18.8 8tbx_A
TSEIRKNHLQVYACDFMP
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA"
516KHe 34.0 8tbx_A
KRATQCIVELNSDGHPY
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA"
517IHe 37.4 8tbx_A
KREIHVADTLNQSFMCGY
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA"
518DHe 21.6 8tbx_A
DREKTSANVHGMPQFILY
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA"
519CHb 0.0 8tbx_A
ACVTLSDEGIKMNPQR
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA"
520DHe 25.9 8tbx_A
DEQHNAKRSTIGLVYFMP
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA"
521NHb 18.8 8tbx_A
SERLYADFKNWTVGHIQCMP
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA"
522LHb 2.8 8tbx_A
LVIFMYARSCEHPQT
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA"
523EHb 5.5 8tbx_A
AESTLYDHRVIKNFGMQWCP
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA"
524QHe 53.1 8tbx_A
KREDSAQTYIGHLNVPCFM
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA"
525YHb 12.2 8tbx_A
LYFKTEIADRVQWGHMNPS
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with RELA"
526FHb 0.0 8tbx_A
LFIMARYKSTVCDEGHNPQ
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
527IHe 41.5 8tbx_A
LTRIVAKSFGMNEQCDHPY
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
528QHe 49.5 8tbx_A
EQLRAKSDNTGMVFHIPYC
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
529QTe 28.6 8tbx_A
LQKERADSFTINPVGHMYCW
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
530GTe 35.7 8tbx_A
GALPSDEFNRTIKQVYCHMW
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
531G b 4.8 8tbx_A
GLADEPSKTINVCFQRHMYW
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
532GBb 1.2 8tbx_A
GALKINSVDPTERFHQYWCM
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
533PTe 22.5 8tbx_A
PLTKSVAEGIDRFNQHMYCW
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
534DTe 91.4 8tbx_A
DELSPAKNQTVGIRFHMYCW
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
535KSe 42.0 8tbx_A
KALVEQRGIPSTDNYFHMCW
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
536KTe 67.9 8tbx_A
KRLEADSFNPGITVQHYCMW
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
537GTe 40.5 8tbx_A
GASELKNQTDRVIPFHYCMW
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
538H e 48.7 8tbx_A
HLKRSNADEGPVTCIMQYFW
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
539QTe 48.0 8tbx_A
QKNDRELSGAPTHIVFYCMW
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
540FTb 2.9 8tbx_A
FYILVAEHMWDPRSCGKNQT
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
541SBb 0.0 8tbx_A
PSKTADNEGRLQVFICHMY
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
542CEb 0.0 8tbx_A
AVCLSITNEFKDGHPQRY
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
543VEb 0.0 8tbx_A
LIVASTFGYEMPRKCDHNQW
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
544CEb 0.0 8tbx_A
ASEYPTCGLRVHIKDFMNQ
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
545LEb 3.9 8tbx_A
LIYVFMSAKDEGNPRT
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
546HSb 1.0 8tbx_A
HYSTENAPFIKLQR
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
547GTe 63.1 8tbx_A
GSAREFHKLQT
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
548DTe 62.3 8tbx_A
DGKSENQRAPVCHLTY
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
549RSb 11.1 8tbx_A
LMKRQVIHSTYADEFN
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
550K e 35.8 8tbx_A
DSKTPAERNQGILHV
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
551PHe 70.5 8tbx_A
QPADGKSVETFILMNRY
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
552HHe 63.4 8tbx_A
QESTKHNRADGLVFIMPY
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
553EHe 29.1 8tbx_A
EAQDKSGRVHINTLMPY
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
554RHe 35.2 8tbx_A
RNSDHKPQTY
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
555KHe 57.1 8tbx_A
EDLKTRNQSAIGMPFVY
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
556QHe 48.5 8tbx_A
KRESAGQNDITWHFLMVY
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
557NHb 10.3 8tbx_A
ITVANSLQRGMDEKP
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
558LHb 15.7 8tbx_A
LIFVMQTYEKPSAGH
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
559EHe 40.2 8tbx_A
KEAQDHNSRTGFLMVWY
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
560RHe 26.9 8tbx_A
DEKRQASGNLTFHMP
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
561FHb 1.4 8tbx_A
FWLDYAGIMPRSV
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
562KHe 57.5 8tbx_A
RKSTGLINPAFQVCEM
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
563KTe 75.5 8tbx_A
NKESATDQRGLCFHIMPV
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
564GTe 60.7 8tbx_A
GSAFNQDTKLRCEHIMPVY
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
565DSb 9.3 8tbx_A
KDEANSLQRVGHTIMPY
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
566VSb 0.7 8tbx_A
SITVKYALNCFPGHRQDEM
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
567RSe 27.3 8tbx_A
RNPDKSEGACLQTVWYFHIM
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
568FEb 0.0 8tbx_A
IVLFACNQYGMSTDEKPR
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
569LEb 1.1 8tbx_A
LIMVGCADEFKPRST
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
570IEb 0.0 8tbx_A
VILFACDEGKMPST
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
571CEb 2.0 8tbx_A
ACTSVGDEIKLPR
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
572T b 8.4 8tbx_A
TSANDEGIKLPQRV
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
573DHe 27.2 8tbx_A
DQNEASTVGKILPR
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
574VHe 84.7 8tbx_A
VLAIMDEGPRSKNQT
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
575AHb 14.3 8tbx_A
ALFTVISGMCWDEKNPQR
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
576AHb 6.2 8tbx_A
ASGTEVDFIKLNPQR
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
577RHe 34.4 8tbx_A
RNLMKADEFGIPQSTV
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
578GHe 85.7 8tbx_A
GCADEFIKLNPQRSTV
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
579I b 8.8 8tbx_A
ILVYMFTADEGKNPQRS
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
580D e 50.0 8tbx_A
DNRHGAEFIKLPQSTV
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
581I b 17.0 8tbx_A
IVFLHKMYQTARSDEGNP
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
582H e 39.3 8tbx_A
PSKAQEYLNDGMRTVHI
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
583G e 26.2 8tbx_A
NGDTASREKQHIVLMPY
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
584VBb 1.3 8tbx_A
VILHAFTCM
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
585PSb 4.7 8tbx_A
DKSENRTAPQHCFGI
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
586YEb 15.7 8tbx_A
LHYVNPAFTWCIMQDEGRS
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
587VEb 0.0 8tbx_A
VRAIM
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
588IEb 1.2 8tbx_A
IVLHFYAM
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
589NEb 0.0 8tbx_A
NQHLEFSCIMTV
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
590VSb 11.3 8tbx_A
YFLVIMAHWC
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
591TSb 5.2 8tbx_A
DGRSNTEHQCFM
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
592L b 0.6 8tbx_A
LFVMPIACSTY
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
593P b 1.6 8tbx_A
PASCLTV
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
594DSe 44.4 8tbx_A
DKNTFSRALQEPGHYIMV
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
595ESe 58.8 8tbx_A
DSTNEHKQAGILMPRV
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
596KTe 35.4 8tbx_A
PAISTVLYFKRCDMGHNW
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
597QHe 44.4 8tbx_A
EDKSARVIQTMLNP
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
598NHb 18.8 8tbx_A
DNTSEIQAVGFKLCHM
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
599YHb 1.3 8tbx_A
YFLHI
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
600VHe 20.7 8tbx_A
VILCTAHMRY
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
601HHe 67.0 8tbx_A
HQSRN
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
602RHb 1.6 8tbx_A
RSEHQAKTV
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
603IHb 1.8 8tbx_A
VISACLMTF
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
604GTe 44.0 8tbx_A
GSA
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
605RTb 17.0 8tbx_A
REQY
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
606VBb 2.7 8tbx_A
TASDVGIL
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
607G b 13.1 8tbx_A
GAS
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
608R e 47.8 8tbx_A
RPHQ
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
609ATe 75.9 8tbx_A
AFRMGHDLYNSCEIKTV
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
610ETe 27.6 8tbx_A
GNWEDSTAKLR
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
611RSe 33.6 8tbx_A
RKANQTEHSFV
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
612M e 31.4 8tbx_A
KESTPRADLNQVGHIMWY
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
613GEb 1.2 8tbx_A
GASCK
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
614LEb 15.7 8tbx_A
LVTRKEIFSHACMNQWDGY
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
615AEb 0.0 8tbx_A
ASGVCKRT
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
616IEb 2.3 8tbx_A
IVLYTFAHCMRW
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
617SEb 0.0 8tbx_A
TSLNVQAIMYCFG
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
618LEb 1.1 8tbx_A
FLIPMVTY
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
619VEb 0.0 8tbx_A
VILFCAMYGT
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
620AEb 0.9 8tbx_A
TSALQDGNCEHVFIPYKMR
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
621TSe 23.4 8tbx_A
PTSEDKNGQLVYAHIMRW
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
622ESe 31.7 8tbx_A
EKDQTCPSGNRHYALMVW
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
623K e 57.5 8tbx_A
EDRKQNSGAPTYH
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
624EEb 6.0 8tbx_A
EDRSKALVTGHIMNPQ
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
625KEb 8.5 8tbx_A
KREADQSNFGYHILMPTV
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
626VEb 2.7 8tbx_A
VILASMTFKDEGNYPHQR
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
627WEb 8.8 8tbx_A
FLWYSVMAGIKPRDEQ
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
628Y e 27.4 8tbx_A
YLVRFHKEADISGMWPQT
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
629H e 30.9 8tbx_A metal ZN
DRKHESANITGLPQYMV
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
630V e 67.3 8tbx_A
ILVAFMKTRSDEGPW
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
631CSe 24.0 8tbx_A metal ZN
LEAICTKVDMSGPQRFNY
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
632STe 85.2 8tbx_A
KSNAEQRLDGTIPVFHY
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
633STe 46.1 8tbx_A
SATEVKDILRGMHNQFPY
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
634RTe 53.0 8tbx_A
RKLIEAVDQSTFGHNMPY
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
635GTe 23.8 8tbx_A
GQSANDLVIKRPTEFHMY
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
636KTe 40.6 8tbx_A
KERSVQAGPTDILNFHY
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
637GTe 72.6 8tbx_A
GKSQAFNRVDEPLTIY
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
638C b 15.3 8tbx_A metal ZN
CLAVFKGSYIMQDHNRTWEP
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
639Y e 80.4 8tbx_A
YELFKIHSQTADGNRVWMP
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
640N e 47.9 8tbx_A
NESKLGVADIMPQRFHT
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
641T e 31.8 8tbx_A
TLSVEIRYDGHANPFKQ
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
642RSb 13.8 8tbx_A
RKQESDTVNLHPAGI
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
643LBe 32.0 8tbx_A
ILVRCDKMSGPTYAEFNQ
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
644KGe 27.8 8tbx_A
EKDINTVHSPRAQGL
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
645EGe 52.8 8tbx_A
EKADSRPVMQTGILNW
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
646DGe 48.1 8tbx_A
DEHANVQPLGKSMFIRTY
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
647GTe 70.2 8tbx_A
GAKSVMDNREPLQTFIY
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
648G b 0.0 8tbx_A
GDESVLKRTAINMFPQY
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
649CSb 3.3 8tbx_A metal ZN
VCEKALNSRTDFPQYIG
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
650TEb 0.0 8tbx_A
TSVDENKQACHLYFGIPR
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
651IEe 32.7 8tbx_A
ILDSVKEFMAGNQRPTY
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
652WEe 29.5 8tbx_A
WFLERDTAQGIKSVPNY
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
653YEb 8.3 8tbx_A
LYPERVFHQAMKSWDGINT
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
654N e 38.8 8tbx_A
NEAKIDHVGLSTFPQR
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
655EHb 2.0 8tbx_A
EQDKSVNFLIRAGPT
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
656MHe 28.0 8tbx_A
MVLKRAIPFSEDQTGN
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
657QHe 48.0 8tbx_A
QEDKRNPAHSTGML
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
658LHb 13.5 8tbx_A
LAIEMKRVNSG
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
659LHb 1.1 8tbx_A
LVIFTYRAMPSDEQ
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
660SHe 38.3 8tbx_A
SATNQDKEMVLPGR
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
661EHe 32.2 8tbx_A
EKQRDPAGLSV
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
662IHb 1.2 8tbx_A
ILVAKEMNRDGPST
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
663EHb 14.1 8tbx_A
EDKQVFLAPRGINST
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
664EHe 69.3 8tbx_A
EDPKARQSNTGLV
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
665HHe 52.9 8tbx_A
HRSPQKNYEIVMADGLT
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
666LTb 11.8 8tbx_A
LVFYICMAKEGST
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
667NTe 80.0 8tbx_A
NDETARSGIKYQLPV
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
668CSb 20.0 8tbx_A
ACISTKQEVDFPGLR
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
669T e 79.2 8tbx_A
TSVAEINRKQGL
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
670I b 3.5 8tbx_A
ILVKQMEFSTAG
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
671S e 46.9 8tbx_A
SEQRKDANVGL
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
672QBe 57.7 8tbx_A
EQRGLPKDAF
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
673V e 78.7 8tbx_A
VLIAMRK
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
674E----
EDRSHPTV
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
675P----
PKESACIDMT
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
676D----
DESKTPNQV
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
677I----
IVSLERAFM
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
678K----
KPQDRL
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
679V----
VKLENTFIA
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
680P----
EPKAVMNGLS
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
681V----
VLNAISKMEG
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK"
682D----
DKNRS
REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK"
683E----
EDFGHSMA
REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK"
684F----
FKHLM
REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK"
685D----
DSKPLQR
REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK"
686G----
GEKL
REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK"
687K----
KQAGN
REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK"
688V----
VQNIKF
REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK"
689T----
TKVELG
REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK"
690Y----
YSHKG
REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK"
691G----
GSADEFIKLNPQRTVY
REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK"
692Q----
QRKTADEFGILNPSVY
REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK"
693K----
KARDEFGILNPQSTVY
REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK"
694R----
RNLADEFGIKPQSTVY
REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK"
695A----
APLTDEGKSVCFHIMNQRY
REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK"
696A----
AVGNRLTDEKSCFHIMPQY
REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK"
697G----
GLNAMT
REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK"
698G----
GS
REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK"
699G----
GAQYST
REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK"
700S----
ATEGDLSIKNPQRV
REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK"
701Y----
YCK
REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK"
702K----
KRLES
REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK"
703G----
GRDP
REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK"
704H----
HQ
REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK"
705V----
VEDTAFGIKLNPQRSY
REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK"
706D----
DERAFGIKLNPQSTVY
REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK"
707I----
AIMQEDFGKLNPRSTVY
REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK"
708L----
LAGDEFIKNPQRSTVY
REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK"
709A----
APRGVLDEFIKNQSTY
REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK"
710P----
PS
REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK"
711T----
TR
REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK"
712V----
VS
REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with HNRNPK"
713Q----
QRL
REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with HNRNPK"
714E----
EAGKQ
REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK"
715L----
LFQ
REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK"
716A----
ADPTS
REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with HNRNPK"
717A----
QAMDE
REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK"
718L----
LTQ
REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK"
719E----
EP
REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with HNRNPK"
720K----
EKPL
REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with HNRNPK"
721E----
QEAT
REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with HNRNPK"
722A----
AIS
REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with HNRNPK"
723Q----
QEN
REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with HNRNPK"
724T----
TSI
REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with HNRNPK"
725S----
LSGD
REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with HNRNPK"
726F----
FYL
REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with HNRNPK"
727L----
LC
REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with HNRNPK"
728H----
HYT
REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with HNRNPK"
729L----
L
REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with HNRNPK"
730G----
GE
REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with HNRNPK"
731Y----
YL
REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with HNRNPK"
732L----
LH
REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with HNRNPK"
733P----
PS
REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with HNRNPK"
734N----
NR
REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with HNRNPK"
735Q----
Q
REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with HNRNPK"
736L----
L
REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with HNRNPK"
737F----
F
REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with HNRNPK"
738R----
R
REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with HNRNPK"
739T----
T
REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with HNRNPK"
740F----
F
REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with HNRNPK"