Contact Molecules for Homologous Proteins | ||||
![]() [Summary Bars] |
![]() [Full Bars] |
|
![]() [Back to Search Page] |
![]() [Back to HOMCOS] |
![]() [Sites by Variants] |
![]() [SupCon3D] |
![]() [help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | ![]() [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
10705 | 740 | 3 | Q92499(DDX1_HUMAN) | RecName: Full=ATP-dependent RNA helicase DDX1; EC=3.6.4.13 ;AltName: Full=DEAD box protein 1;AltName: Full=DEAD box protein retinoblastoma; Short=DBP-RB; |
QUERYSEQ |
MAAFSEMGVMPEIAQAVEEMDWLLPTDIQAESIPLILGGGDVLMAAETGSGKTGAFSIPVIQIVYETLKDQQEGKKGKTTIKTGASVLNKWQMNPYDRGSAFAIGSDGLCCQSREVKEWHGCRATKGLMKGKHYYEVSCHDQGLCRVGWS TMQASLDLGTDKFGFGFGGTGKKSHNKQFDNYGEEFTMHDTIGCYLDIDKGHVKFSKNGKDLGLAFEIPPHMKNQALFPACVLKNAELKFNFGEEEFKFPPKDGFVALSKAPDGYIVKSQHSGNAQVTQTKFLPNAPKALIVEPSRELAE QTLNNIKQFKKYIDNPKLRELLIIGGVAARDQLSVLENGVDIVVGTPGRLDDLVSTGKLNLSQVRFLVLDEADGLLSQGYSDFINRMHNQIPQVTSDGKRLQVIVCSATLHSFDVKKLSEKIMHFPTWVDLKGEDSVPDTVHHVVVPVNP KTDRLWERLGKSHIRTDDVHAKDNTRPGANSPEMWSEAIKILKGEYAVRAIKEHKMDQAIIFCRTKIDCDNLEQYFIQQGGGPDKKGHQFSCVCLHGDRKPHERKQNLERFKKGDVRFLICTDVAARGIDIHGVPYVINVTLPDEKQNYV HRIGRVGRAERMGLAISLVATEKEKVWYHVCSSRGKGCYNTRLKEDGGCTIWYNEMQLLSEIEEHLNCTISQVEPDIKVPVDEFDGKVTYGQKRAAGGGSYKGHVDILAPTVQELAALEKEAQTSFLHLGYLPNQLFRTF |
[n]:site number of query sequence. [a]:amino acid of query sequence. [s]:predicted secondary structure. [e]:predicted exposed/buried. [acc]:predicted relative accesssibility(%). [pdb]:PDB code of homologous structure. [contact_mols]:predicted binding molecules [observed aa]:Observed amino acids among homologous sequences. [feature table]:UniProt Feature Table [variant]:UniProt Human Variant.
n | a | s | e | acc | pdb | contact_mols | observed aa | feature table | variant |
![]() | M | T | e | 28.5 | ![]() |
IMVLF |
REGION /note="Necessary for interaction with HNRNPK" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | A | H | e | 47.3 | ![]() |
STAKRLPQEMGN |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | A | H | b | 11.6 | ![]() |
STAKGREQCDHLN |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | F | H | b | 0.0 | ![]() |
FWIL |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | S | H | e | 28.9 | ![]() |
SEADKQTNHRVGL |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | E | T | e | 82.9 | ![]() |
EDSQANHTGIP |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | M | T | b | 17.9 | ![]() |
LFMCISAYPVT |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | G | T | e | 52.4 | ![]() |
GNPDKQSACEFHLRTY |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | V | b | 3.3 | ![]() |
LIVFCMER |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |||
![]() | M | b | 12.6 | ![]() |
SHKPDGNTVELQRAICM |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |||
![]() | P | H | e | 52.7 | ![]() |
PEDRSKAQTGNVY |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | E | H | e | 41.7 | ![]() |
EPRWDKQSLNTAHFIYGV |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | I | H | b | 0.0 | ![]() |
LIVTMAS |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | A | H | b | 0.0 | ![]() |
LIVMACRSKQTEFGHNY |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | Q | H | e | 35.7 | ![]() |
KREQDSAHMGLNIT |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | A | H | b | 0.0 | ![]() |
AGNSTVELRIKQ |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | V | H | b | 0.0 | ![]() |
LIVCAFKMQ |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | E | H | e | 39.2 | ![]() |
KEYASDNRTQFLGHIMPV |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | E | T | e | 46.2 | ![]() |
EKDARSQNLTGFV |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | M | T | e | 28.0 | ![]() |
LMAKSYIQVFNCEGT |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | D | T | e | 82.7 | ![]() |
compound ADP | GKNEADHRSLPQ |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
![]() | W | e | 27.1 | ![]() |
compound ADP | FYIWLVDKMS |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | L | e | 46.6 | ![]() |
EKTNVDSALQRMPYGHI |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |||
![]() | L | S | e | 66.3 | ![]() |
compound ADP | KRETAVNQHSFLYDIM |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
![]() | P | e | 23.3 | ![]() |
compound ADP | PMLVCATS |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | T | e | 30.5 | ![]() |
compound ADP | TSRAKM |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | D | H | e | 84.6 | ![]() |
PAEDLSTKHQVGR |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | I | H | b | 2.3 | ![]() |
IVT |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | Q | H | b | 3.1 | ![]() |
compound ADP | QN |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
![]() | A | H | e | 39.3 | ![]() |
ASFKREQMCGILNTV |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | E | H | e | 50.8 | ![]() |
ADKREQSYLVGHIMNT |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | S | H | b | 0.0 | ![]() |
ASTNCGMVIL |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | I | H | b | 0.0 | ![]() |
ILVWFM |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | P | H | e | 41.1 | ![]() |
PLMSFGKNRTV |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | L | H | e | 29.8 | ![]() |
LIPVQAEHMSTYFGKR |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | I | H | b | 0.0 | ![]() |
IALYVFSGTCM |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | L | H | e | 24.2 | ![]() |
LIMACFQRSTVY |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | G | T | e | 79.8 | ![]() |
QSKAEDGNTLRCHM |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | G | T | e | 36.9 | ![]() |
GNKREHSDQ |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | G | e | 45.2 | ![]() |
RKHQTEGLNPSVADIY |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |||
![]() | D | b | 4.3 | ![]() |
DNSEHAGIKLPRTV |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |||
![]() | V | E | b | 0.7 | ![]() |
VILCAMTDEGKNPRS |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | L | E | b | 0.0 | ![]() |
ILVMAFCDEGKNPRST |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | M | E | b | 0.0 | ![]() |
GAVILCSDEKMNPRT |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | A | E | b | 2.7 | ![]() |
QACKGIVRELMSDTHNP |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | A | b | 4.5 | ![]() |
ASDGEIKLNPRTV |
BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |||
![]() | E | e | 73.4 | ![]() |
compound ADP | QKERVPSADHFGILNTY |
BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | T | T | e | 70.8 | ![]() |
compound ADP | TSNC |
BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
![]() | G | T | e | 91.7 | ![]() |
compound ADP | GNS |
BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
![]() | S | S | b | 15.6 | ![]() |
compound ADP | STYAM |
BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
![]() | G | S | e | 21.4 | ![]() |
compound ADP | G |
BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
![]() | K | H | b | 2.8 | ![]() |
compound ADP | KE |
MUTAGEN /note="K->N: Abolishes ability to promote guanylylation of RTCB." BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" MUTAGEN /note="K->N: Abolishes ability to promote guanylylation of RTCB." BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
![]() | T | H | b | 7.8 | ![]() |
compound ADP metal MG | TNS |
BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
![]() | G | H | b | 3.6 | ![]() |
compound ADP | ALVGHIMFS |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
![]() | A | H | b | 0.0 | ![]() |
ALSGTVMC |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | F | H | b | 0.0 | ![]() |
FYRI |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | S | H | b | 1.6 | ![]() |
LSAVGICTM |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | I | H | b | 0.0 | ![]() |
ILDVFAGTW |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | P | H | b | 0.8 | ![]() |
PSGATIL |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | V | H | b | 0.7 | ![]() |
IVLMARCTFS |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | I | H | b | 0.6 | ![]() |
LIVWFCMAE |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | Q | H | b | 5.1 | ![]() |
ACDEHIKLMNQRSV |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | I | H | b | 13.5 | ![]() |
YKFLHQANRSEGIMTVC |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | V | H | b | 1.3 | ![]() |
ILVACMSWYEHT |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | Y | H | b | 17.0 | ![]() |
LYFSDWAEHIKMQRVCNPTG |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | E | H | e | 43.2 | ![]() |
EKQDRHSNPTAYIL |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | T | H | b | 10.4 | ![]() |
TSHKLNEQRYACPVDFGIW |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | L | H | b | 17.4 | ![]() |
LRAEIPGKMNSDVYHQ |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | K | T | e | 32.5 | ![]() |
KRPNALSEGQYDFHIMV |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | D | T | e | 88.3 | ![]() |
DEASKNPQTHLRVGIM |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | Q | e | 58.7 | ![]() |
QKSPRLTDEINAVCFMY |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |||
![]() | Q | - | - | - | - | QRETDNAKSPCFHILMV |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | E | - | - | - | - | EPKTQLNDAMSVYHIRG |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | G | - | - | - | - | GLASENTDHKPFMQR |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | K | - | - | - | - | KRAIEPNLQCGSVY |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | K | - | - | - | - | KREAIQDLPSYFGNT |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | G | - | - | - | - | GPNTAKSDEFIR |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | K | - | - | - | - | KPEARLNQSTHDMCGV |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | T | - | - | - | - | TSARGVLEDKPIMQ |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | T | - | - | - | - | TASPVIKERYGL |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | I | - | - | - | - | IVATLREGSFMDN |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | K | - | - | - | - | KRGPQENAYCLSIV |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | T | - | - | - | - | TPALIEDGSKQRV |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | G | - | - | - | - | GAILNPSTFVEK |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | A | - | - | - | - | AIVKGQTEHLS |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | S | e | 89.1 | ![]() |
SLRVPQAGT |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |||
![]() | V | G | e | 22.7 | ![]() |
IPVATEGLY |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | L | G | b | 7.9 | ![]() |
LTVIPGK |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | N | G | e | 57.0 | ![]() |
SRNDQTHLY |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | K | S | e | 51.9 | ![]() |
ESIGKHRTPADLV |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | W | S | b | 9.6 | ![]() |
LWYIFADEGKNPQRSTV |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | Q | S | b | 12.8 | ![]() |
AQGETHIKDFLNPRSV |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | M | E | b | 0.0 | ![]() |
LMYVAGS |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | N | E | b | 0.0 | ![]() |
NQDEGSAV |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | P | E | e | 22.5 | ![]() |
PILADFQKST |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | Y | E | e | 36.5 | ![]() |
YNMEHPLIFQ |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | D | E | b | 0.0 | ![]() |
DANKMTCE |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | R | E | e | 31.6 | ![]() |
QRKPENV |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | G | b | 1.2 | ![]() |
DGSILYV |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |||
![]() | S | T | e | 69.5 | ![]() |
STQKLNVEHD |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | A | T | e | 28.6 | ![]() |
KANDISYGHR |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | F | E | b | 0.5 | ![]() |
FLYMHADEGIKNPQRSTV |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | A | E | e | 38.4 | ![]() |
AKPESTGNDFILQRV |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | I | E | e | 20.5 | ![]() |
LAIKPSVDEGNQRT |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | G | e | 38.1 | ![]() |
ADGNRSTMEIKLPV |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |||
![]() | S | T | e | 107.8 | ![]() |
SGENIPARTVM |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | D | T | e | 35.8 | ![]() |
DETGNVAHKL |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | G | S | b | 1.2 | ![]() |
GANEKRLSV |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | L | b | 12.4 | ![]() |
LVMTCIF |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |||
![]() | C | E | e | 21.3 | ![]() |
CAGLSEITR |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | C | E | b | 0.0 | ![]() |
CSAVKYIL |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | Q | E | e | 35.7 | ![]() |
QDGELKS |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | S | E | b | 0.0 | ![]() |
SATRDKEGLV |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | R | e | 37.9 | ![]() |
RLGQAESKTV |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |||
![]() | E | e | 39.2 | ![]() |
ESKVDRATFGILNPQ |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |||
![]() | V | T | e | 67.3 | ![]() |
VKLRAIMFDEGNPQSTY |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | K | T | e | 84.4 | ![]() |
KSFMERAL |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | E | e | 47.7 | ![]() |
RSAEQGNDKFILPTV |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |||
![]() | W | e | 26.7 | ![]() |
WFDIAKY |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |||
![]() | H | E | b | 1.6 | ![]() |
HSAFELRC |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | G | E | b | 0.0 | ![]() |
GARSVM |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | C | E | b | 0.7 | ![]() |
AIVCFG |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | R | E | b | 1.6 | ![]() |
REQPIVK |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | A | E | b | 0.0 | ![]() |
ASKTCG |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | T | S | b | 0.0 | ![]() |
TNVYES |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | K | E | b | 10.4 | ![]() |
YTKRAPSF |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | G | E | b | 0.0 | ![]() |
GACS |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | L | E | b | 0.0 | ![]() |
VILR |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | M | S | e | 25.1 | ![]() |
LTYKSDQRMWVNAEG |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | K | S | e | 44.3 | ![]() |
KSANERDGLTV |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | G | S | b | 13.1 | ![]() |
GDAEKLSTV |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | K | E | e | 33.5 | ![]() |
KFRILAVEGST |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | H | E | b | 4.7 | ![]() |
HWYVF |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | Y | E | b | 0.9 | ![]() |
YLSCMV |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | Y | E | b | 0.0 | ![]() |
YFDW |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | E | E | b | 1.0 | ![]() |
ED |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | V | E | b | 0.0 | ![]() |
VIFSAM |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | S | E | b | 9.4 | ![]() |
SKETDLQAI |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | C | E | b | 4.7 | ![]() |
IVCALK |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | H | e | 40.3 | ![]() |
VGHTLSYENR |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |||
![]() | D | S | b | 17.3 | ![]() |
DTESR |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | Q | S | e | 78.1 | ![]() |
SQKTEDRPVANL |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | G | S | e | 32.1 | ![]() |
GPHSAL |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | L | E | e | 43.3 | ![]() |
LVYDFHEIPA |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | C | E | b | 4.0 | ![]() |
MCVITLQ |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | R | E | b | 6.7 | ![]() |
RQGS |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | V | E | b | 0.0 | ![]() |
IVL |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | G | E | b | 0.0 | ![]() |
GL |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | W | E | b | 0.0 | ![]() |
WLVF |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | S | E | b | 0.8 | ![]() |
SACKT |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | T | b | 2.6 | ![]() |
TRLASV |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |||
![]() | M | T | b | 13.5 | ![]() |
LDQMKCITRA |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | Q | T | e | 67.9 | ![]() |
QDGKSPTAFRN |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | A | S | b | 6.2 | ![]() |
CSAPGYTVF |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | S | e | 38.3 | ![]() |
SDNPGRKC |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |||
![]() | L | S | b | 6.2 | ![]() |
LFMRASTVQ |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | D | S | e | 25.9 | ![]() |
NQDLEFGMT |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | L | T | b | 0.6 | ![]() |
LRVIP |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | G | T | b | 0.0 | ![]() |
G |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | T | S | b | 16.9 | ![]() |
DWETSCYAK |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | D | S | b | 19.8 | ![]() |
DETHACG |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | K | T | e | 46.7 | ![]() |
KEDHAGPLR |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | F | T | b | 16.3 | ![]() |
FYNDREHLTMQ |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | G | E | b | 0.0 | ![]() |
SGA |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | F | E | b | 0.5 | ![]() |
YFWVC |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | G | E | b | 0.0 | ![]() |
GAV |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | F | E | b | 0.0 | ![]() |
YFL |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | G | E | b | 6.0 | ![]() |
DGAHRSTN |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | G | T | b | 17.9 | ![]() |
GPDLS |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | T | T | e | 51.9 | ![]() |
TENDHCRFIK |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | G | T | b | 10.7 | ![]() |
GRDKNSAL |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | K | E | e | 33.0 | ![]() |
KGSVAHCITLM |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | K | E | e | 20.3 | ![]() |
KQRHENSAL |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | S | E | b | 0.0 | ![]() |
SRKFITAML |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | H | E | b | 18.8 | ![]() |
HWDTFYCSENAL |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | N | T | e | 59.4 | ![]() |
NHDSKAEL |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | K | T | e | 68.4 | ![]() |
KGQRSACVL |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | Q | E | e | 59.2 | ![]() |
QTGESKLPR |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | F | E | e | 37.8 | ![]() |
FGTYLNRAIS |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | D | E | e | 40.7 | ![]() |
EDISTQN |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | N | E | e | 79.4 | ![]() |
DNPKHTWGAES |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | Y | b | 10.0 | ![]() |
YFK |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |||
![]() | G | S | e | 50.0 | ![]() |
GMNA |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | E | e | 35.2 | ![]() |
EQPRKADLV |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |||
![]() | E | e | 73.4 | ![]() |
EPTRSAKQ |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |||
![]() | F | b | 5.7 | ![]() |
FWYIS |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |||
![]() | T | e | 39.6 | ![]() |
TKLQAGVDE |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |||
![]() | M | T | e | 29.0 | ![]() |
TAEMPQLSKN |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | H | T | e | 84.3 | ![]() |
GNHEA |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | D | b | 14.2 | ![]() |
D |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |||
![]() | T | E | b | 3.9 | ![]() |
VTFI |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | I | E | b | 0.0 | ![]() |
IVF |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | G | E | b | 1.2 | ![]() |
GTS |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | C | E | b | 0.0 | ![]() |
CFSV |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | Y | E | b | 3.9 | ![]() |
YFLCMG |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | L | E | b | 0.0 | ![]() |
ILVDAFY |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | D | E | b | 3.7 | ![]() |
DNER |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | I | T | b | 15.2 | ![]() |
LFVIMPT |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | D | T | e | 66.0 | ![]() |
DNCIEKPRTV |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | K | T | e | 64.6 | ![]() |
EDNTCKS |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | G | T | b | 1.2 | ![]() |
GSNEKQRHVD |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | H | E | e | 25.7 | ![]() |
TEQHINADGKLPRSV |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | V | E | b | 0.0 | ![]() |
ILMVCADEGKNPQRST |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | K | E | b | 10.4 | ![]() |
SFIKMEGWYADLNPQRTV |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | F | E | b | 0.0 | ![]() |
FYW |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | S | E | b | 1.6 | ![]() |
TSDFACY |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | K | E | b | 16.0 | ![]() |
KLSR |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | N | T | e | 34.5 | ![]() |
NM |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | G | T | e | 53.6 | ![]() |
GAF |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | K | E | e | 60.8 | ![]() |
EKVLQAGHN |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | D | E | e | 39.5 | ![]() |
DWQCSKLNVY |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | L | E | b | 14.6 | ![]() |
LMQEFSI |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | G | E | e | 28.6 | ![]() |
GKPNE |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | L | E | e | 43.3 | ![]() |
LIAVSPTE |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | A | E | b | 2.7 | ![]() |
AEGDKQL |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | F | E | b | 10.5 | ![]() |
FPALK |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | E | E | e | 63.3 | ![]() |
ERKTSDQA |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | I | b | 8.2 | ![]() |
ITVFKALDNS |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |||
![]() | P | e | 22.5 | ![]() |
PSLKAFDRQEGTV |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |||
![]() | P | G | e | 94.6 | ![]() |
KSPDHEVAGLT |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | H | G | e | 41.4 | ![]() |
GESHKANFRDL |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | M | G | b | 0.5 | ![]() |
LIVGDWTKSYMA |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | K | T | e | 39.2 | ![]() |
KVTAQSLGPR |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | N | T | e | 87.9 | ![]() |
GNVSQADKL |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | Q | S | e | 30.1 | ![]() |
QRGMDSTAHEF |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | A | b | 12.5 | ![]() |
AGNPFMTCVIRSK |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |||
![]() | L | B | b | 0.6 | ![]() |
LFTYIKV |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | F | E | b | 0.5 | ![]() |
FYLRVAI |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | P | E | b | 0.0 | ![]() |
PEAKSD |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | A | E | b | 1.8 | ![]() |
ASVFPHT |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | C | E | b | 0.0 | ![]() |
VCMSITAL |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | V | E | b | 0.0 | ![]() |
SGVLKNFAE |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | L | E | b | 0.0 | ![]() |
LMCIAVEGS |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | K | E | e | 27.8 | ![]() |
KQSGNHAELV |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | N | S | e | 37.0 | ![]() |
NEGTVYFDQSPAL |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | A | E | b | 0.9 | ![]() |
APCDSRQKEGFILNTV |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | E | E | e | 20.1 | ![]() |
ELAQGTSHVDFIKNPR |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | L | E | b | 1.1 | ![]() |
LVCMADEFGIKNPQRSTY |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | K | E | e | 21.7 | ![]() |
REPAKDQSHLFGINTVY |
MOD_RES /note="N6-acetyllysine" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" MOD_RES /note="N6-acetyllysine" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | F | E | b | 1.0 | ![]() |
YLFMAVGSDEIKNPQRT |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | N | E | b | 10.9 | ![]() |
NLASFGDEIKPQRTVY |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | F | S | b | 1.9 | ![]() |
FLYADEGIKNPQRSTV |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | G | S | b | 13.1 | ![]() |
GSNVEADFIKLPQRTY |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | E | S | e | 68.3 | ![]() |
NEQRKSYAFLDGIPTV |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | E | S | e | 53.3 | ![]() |
ELKQMDRSNPTYAGVFHI |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | E | e | 96.5 | ![]() |
PGKRSEDALFINQTVY |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |||
![]() | F | b | 19.1 | ![]() |
FPALSKMDEGINQRTVY |
DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="B30.2/SPRY" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |||
![]() | K | S | e | 57.1 | ![]() |
KSEIRLVPADFGNQTY |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | F | S | e | 35.9 | ![]() |
AFIKLNHYDEGPRSTV |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | P | e | 78.3 | ![]() |
PDQVIAFEGKLNRST |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |||
![]() | P | e | 26.4 | ![]() |
PQEILSCTVAG |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |||
![]() | K | e | 39.2 | ![]() |
KSEAGIQVLR |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |||
![]() | D | T | e | 63.0 | ![]() |
DRKNIAMEGLPQSTV |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | G | T | e | 71.4 | ![]() |
GQLAKDEFINPRSTVY |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | F | b | 7.7 | ![]() |
AFILMPRSY |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |||
![]() | V | E | e | 47.3 | ![]() |
VLIRDMKQPT |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | A | E | b | 11.6 | ![]() |
APGMSQVLT |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | L | G | b | 0.0 | ![]() |
LIQPFAV |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | S | G | b | 12.5 | ![]() |
SACQDNPTG |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | K | G | e | 59.0 | ![]() |
QKRDNEHT |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | A | S | b | 6.2 | ![]() |
APGSIKTV |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | P | e | 55.8 | ![]() |
PGLIKQER |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |||
![]() | D | G | e | 82.1 | ![]() |
DSNTQHREFL |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | G | G | e | 85.7 | ![]() |
GANHTLRK |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | Y | G | e | 50.0 | ![]() |
YFLHKSIDMVNAEGPT |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | I | E | b | 15.2 | ![]() |
ILVSTDKAY |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | V | E | e | 35.3 | ![]() |
AILVMSEGFQ |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | K | E | e | 52.4 | ![]() |
KAPQERSNMDTV |
MOD_RES /note="N6-acetyllysine" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" MOD_RES /note="N6-acetyllysine" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | S | b | 4.7 | ![]() |
STAQFKHPMGNYDL |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |||
![]() | Q | S | e | 69.9 | ![]() |
QLRASKTVWEIP |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | H | b | 10.5 | ![]() |
ADEGLPRSTVHNQ |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |||
![]() | S | S | e | 36.7 | ![]() |
SLNTERGFDPQVAIK |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | G | G | e | 54.8 | ![]() |
GIATELPCKNRVMQ |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | N | G | e | 103.6 | ![]() |
NTKSCGALPRDEI |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | A | G | e | 36.6 | ![]() |
ASFTGPKDEHLQVR |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | Q | e | 57.7 | ![]() |
QKELMRTGASIP |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |||
![]() | V | B | e | 29.3 | ![]() |
LIAVKSRDGMTHNP |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | T | e | 64.9 | ![]() |
STVNQLAKYDERFCIMP |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |||
![]() | Q | e | 37.8 | ![]() |
QRLAEKSNDFHIMTVY |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |||
![]() | T | - | - | - | - | STLIVANEKDGQRMPY |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | K | - | - | - | - | KREVQDPNTAILSGHMY |
MOD_RES /note="N6-acetyllysine; alternate" CROSSLNK /note="Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternate" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" MOD_RES /note="N6-acetyllysine; alternate" CROSSLNK /note="Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternate" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | F | - | - | - | - | FIEPLVYGAKQRSDMNTWH |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | L | - | - | - | - | LVKRDIAEMNQSTGYCFHP |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | P | - | - | - | - | PDLQKEGAINRSVHMT |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | N | - | - | - | - | NDRGHQSPTEKALYV |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | A | S | b | 4.5 | ![]() |
AGQVESKCRTHIPYDFLN |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | P | b | 1.6 | ![]() |
PTVIFELCSAKMRY |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |||
![]() | K | S | b | 5.2 | ![]() |
QRSGTIFKLYAEHMNV |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | A | E | b | 0.0 | ![]() |
AVGRSICTM |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | L | E | b | 1.1 | ![]() |
LIVAFMC |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | I | E | b | 1.2 | ![]() |
IVACLFM |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | V | E | b | 1.3 | ![]() |
LIVMEDFCT |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | E | b | 0.0 | ![]() |
ASVTCLQRFEGM |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |||
![]() | P | S | b | 14.7 | ![]() |
PEHNAS |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | S | e | 32.8 | ![]() |
TSNADVI |
REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |||
![]() | R | H | b | 19.4 | ![]() |
RKSTHQVAFLNY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | E | H | e | 34.7 | ![]() |
EDSTLMP |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | L | H | e | 25.8 | ![]() |
LWI |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | A | H | b | 0.0 | ![]() |
AVSCQIGT |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | E | H | e | 42.7 | ![]() |
LQVDEIANRSHMTYKCFGW |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | Q | H | e | 51.5 | ![]() |
compound ADP | QEADT |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
![]() | T | H | b | 1.3 | ![]() |
IVTGAELQCNS |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | L | H | b | 11.2 | ![]() |
YFALQHVKSGETIRCDMN |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | N | H | e | 69.1 | ![]() |
DKENQSRAGPTHLVIM |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | N | H | b | 8.5 | ![]() |
VETGKDNSHIAMQRFLCP |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | I | H | b | 2.3 | ![]() |
LVAIECFYGMSTDK |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | K | H | e | 20.8 | ![]() |
KELTRNQISAVDGMCFY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | Q | H | e | 30.1 | ![]() |
KEQRATDLSGVNPCFHIMY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | F | H | b | 0.0 | ![]() |
LFIMTAHVCGYEQSW |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | K | T | b | 18.9 | ![]() |
GASLKTERVCIMPQDHNY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | K | T | e | 24.5 | ![]() |
KARSQEHDTGLPYFINV |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | Y | T | e | 43.0 | ![]() |
FYHLAGEPIKTVCRSWDMNQ |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | I | b | 5.3 | ![]() |
LTICMVGASNHPDFYEKQRW |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |||
![]() | D | e | 44.4 | ![]() |
DGSNAEKPTVFQYHILRCM |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |||
![]() | N | S | e | 86.1 | ![]() |
GNSALRDHKQEPTVFIMYC |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | P | S | e | 47.3 | ![]() |
PSTKLVAEGIRDHMNFQYC |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | K | e | 55.2 | ![]() |
KGNRDLSEQTAIPVWYCHFM |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |||
![]() | L | b | 6.2 | ![]() |
LIVFKACGMTYHNPQRS |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |||
![]() | R | b | 14.2 | ![]() |
RKSVTNAQEGDHICFLPY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |||
![]() | E | E | e | 33.7 | ![]() |
VSTAPCIEFKNQDGLHMRWY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | L | E | b | 12.4 | ![]() |
VALGQCMHITFSEKRYDN |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | L | E | b | 19.1 | ![]() |
LVACNSTIMYGKPQEFHR |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | I | E | b | 0.6 | ![]() |
VILAFCSMTWDNPQRY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | I | b | 10.5 | ![]() |
IVYTSLAFGKMPCDNR |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |||
![]() | G | S | e | 79.8 | ![]() |
GPSAKTNQRDEFLV |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | G | S | e | 102.4 | ![]() |
GADNSKEQTVCILMPR |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | V | S | e | 28.7 | ![]() |
TVLASMEIDKQRFGHNPCY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | A | e | 46.4 | ![]() |
SPDANGKTRELVQCFHIMY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |||
![]() | A | H | e | 36.6 | ![]() |
LIAKVMPRYDSEFTGNHQW |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | R | H | e | 28.9 | ![]() |
RKEQDGASNVLMPTFHIWY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | D | H | e | 66.0 | ![]() |
DEKNQSVARGLPTHIFMY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | Q | H | b | 5.6 | ![]() |
QDELSIKNRMTAFGHVY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | L | H | e | 42.1 | ![]() |
LAIKRVEFSNQDGMTCHPY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | S | H | e | 44.5 | ![]() |
RSKEANTDLQGIPVYFHMW |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | V | H | e | 26.0 | ![]() |
RLAKVEIQDFMSNTPCGHWY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | L | H | b | 12.9 | ![]() |
LIMVAFKRSCEGHNPQTY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | E | H | e | 45.7 | ![]() |
KERSQADNTMPFGHILVY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | N | H | e | 83.0 | ![]() |
KNDREQSTGAHIMPVLYCFW |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | G | e | 38.1 | ![]() |
GKNPREASTQCDHILVYMW |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |||
![]() | V | b | 2.0 | ![]() |
PVACITGLMQSYEFKNR |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |||
![]() | D | S | b | 11.7 | ![]() |
DHNQESARTGIKLPV |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | I | E | b | 2.3 | ![]() |
IVLFMAGS |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | V | E | b | 0.7 | ![]() |
LVIAMCFGS |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | V | E | b | 0.7 | ![]() |
VIFSACGLT |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | G | E | b | 0.0 | ![]() |
AGSTCIL |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | T | b | 13.6 | ![]() |
TNSAGLM |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |||
![]() | P | H | b | 1.6 | ![]() |
PTAVCGILMS |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | G | H | e | 44.0 | ![]() |
GADSHLCFMNPQTY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | R | H | b | 12.6 | ![]() |
RKLTMACGHIQS |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | L | H | b | 0.0 | ![]() |
LVIFMACGST |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | D | H | e | 22.2 | ![]() |
LIDVAKFHMQENSWCGPRTY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | D | H | e | 64.2 | ![]() |
DHEQSAKGNFILRTVY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | L | H | b | 6.7 | ![]() |
LMHIFNVTYACSWEGKQ |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | V | H | b | 10.0 | ![]() |
LIVADEFKMQTCRSGHNY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | S | T | e | 67.2 | ![]() |
ENKQSRDAGLTVIFHMY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | T | T | e | 62.3 | ![]() |
RSTKENAQDPLGMCFHIV |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | G | T | e | 88.1 | ![]() |
GKRNESDPQAMTHLVFIY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | K | b | 18.4 | ![]() |
AKSGRVHNPTEILQYDMCF |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |||
![]() | L | S | b | 4.5 | ![]() |
LIFVTYAMEKNCDGPQRS |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | N | e | 48.5 | ![]() |
DSNKRVFEHGITALQCMPY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |||
![]() | L | b | 6.7 | ![]() |
LFTVIMPACDGKNRSY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |||
![]() | S | T | e | 49.2 | ![]() |
SKDRANEGTHQPFLMV |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | Q | T | e | 32.7 | ![]() |
NSKRQHADTEGFLCIMVY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | V | b | 2.0 | ![]() |
VLICRAMTDFPS |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |||
![]() | R | b | 17.4 | ![]() |
KREQTSDNACGHLMPVY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |||
![]() | F | E | b | 0.0 | ![]() |
YFVMILHTWASCDGKNQ |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | L | E | b | 0.6 | ![]() |
LVFITAMCKR |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | V | E | b | 0.0 | ![]() |
VIDATCGL |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | L | E | b | 1.1 | ![]() |
LIFMVCY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | D | T | b | 0.0 | ![]() |
metal MG | DSAEGLV |
MOTIF /note="DEAD box" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" MOTIF /note="DEAD box" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
![]() | E | T | b | 13.6 | ![]() |
metal MG | EKN |
MUTAGEN /note="E->G: Inhibits the transcriptional activity of RELA and attenuates NF-kappa-B-mediated gene expression." ECO:0000269|PubMed:24870230" MUTAGEN /note="E->Q: Abolishes ability to promote guanylylation of RTCB." ECO:0000269|PubMed:24870230" MOTIF /note="DEAD box" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" MUTAGEN /note="E->G: Inhibits the transcriptional activity of RELA and attenuates NF-kappa-B-mediated gene expression." ECO:0000269|PubMed:24870230" MUTAGEN /note="E->Q: Abolishes ability to promote guanylylation of RTCB." ECO:0000269|PubMed:24870230" MOTIF /note="DEAD box" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |
![]() | A | H | b | 0.0 | ![]() |
ACIVGFSTL |
MOTIF /note="DEAD box" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" MOTIF /note="DEAD box" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | D | H | b | 14.8 | ![]() |
DHN |
MOTIF /note="DEAD box" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" MOTIF /note="DEAD box" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | G | H | e | 27.4 | ![]() |
RLTKEGQMINSACDFHV |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | L | H | b | 0.0 | ![]() |
MLFIVCT |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | L | H | b | 10.7 | ![]() |
LIFMVNTY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | S | H | e | 78.9 | ![]() |
DEKMSGTANQLRYC |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | Q | T | e | 49.0 | ![]() |
MQDVLREIFKPSYGAHNT |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | G | T | e | 54.8 | ![]() |
GESHDQAILNTMPRY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | Y | e | 31.7 | ![]() |
FALYVDHISCEGKMPQRTW |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |||
![]() | S | H | e | 27.3 | ![]() |
EQAGDKSILRTFNVHMY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | D | H | e | 62.3 | ![]() |
DEKPQGSFNALRTVHIY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | F | H | b | 1.4 | ![]() |
QDEFMTVNWILSAHKPCGY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | I | H | b | 0.0 | ![]() |
ILVMCTESAFKNPR |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | N | H | b | 20.0 | ![]() |
REDSKNLQTPVYCIAGFHM |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | R | H | e | 39.1 | ![]() |
RKDEQASTNVFHLCGIMPWY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | M | H | b | 1.9 | ![]() |
ILVMDCTAEFGQRS |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | H | H | b | 14.1 | ![]() |
LVIFRKAEHMDQYGSTCNP |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | N | H | e | 87.3 | ![]() |
SEKDNQRGATCHLFIMPVY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | Q | H | e | 51.5 | ![]() |
RHIAELQKVCDFNSTYMGP |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | I | S | b | 0.6 | ![]() |
LIMTVFACEPRSGHKNQY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | P | e | 48.1 | ![]() |
PADSFNKTEGILQRVHMY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |||
![]() | Q | S | e | 43.4 | ![]() |
KQRAEDSPGHLNTVIMCFWY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | V | B | e | 54.0 | ![]() |
IAVLTSQEGKMYCDFNPRH |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | T | b | 14.9 | ![]() |
TRPSAKLEFNDGIVCMQHY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |||
![]() | S | T | e | 87.5 | ![]() |
SPARGKQTEDLNIMVCFHYW |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | D | T | e | 45.7 | ![]() |
DTSANPKEIGHLQRVFCMWY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | G | S | e | 65.5 | ![]() |
GSANDKLPTERQIVCFHMWY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | K | e | 21.7 | ![]() |
KRESPQADTVLGHIMNCFWY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |||
![]() | R | B | e | 47.0 | ![]() |
RKNDEQTLSGPVAHFIYCM |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | L | b | 2.2 | ![]() |
RLIVPTACKDGSYEFMNQWH |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |||
![]() | Q | E | b | 5.6 | ![]() |
QRNETDHKLMSVACGI |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | V | E | b | 0.7 | ![]() |
TVLMIKAFNSGCEHQRY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | I | E | b | 0.0 | ![]() |
LVMIFAEKSTYCDG |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | V | E | b | 0.0 | ![]() |
LMVFSIPACDEKTY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | C | E | b | 0.0 | ![]() |
FCVLAMSYEGPWDIKNQT |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | S | E | b | 0.0 | ![]() |
STNACDEFGKP |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | A | S | e | 25.0 | ![]() |
AQSEDGIKNTV |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | T | S | e | 41.6 | ![]() |
TLSADFGIKMNRV |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | L | S | e | 44.9 | ![]() |
LMFIVWSTADKPYCEGNQR |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | H | S | e | 37.7 | ![]() |
PTANQSEKDHFGLIRVWYCM |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | S | e | 26.6 | ![]() |
SDTKPEARNQVGILFHY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |||
![]() | F | H | e | 62.7 | ![]() |
LAEFKSDMQRVYGPTHINWC |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | D | H | e | 59.9 | ![]() |
DESKNLAGQRPTFIVMY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | V | H | b | 2.0 | ![]() |
VILFPAESDMTGKNQRY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | K | H | b | 16.5 | ![]() |
EKRQLADNSGHTPFIMVWY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | K | H | b | 18.9 | ![]() |
KERQDSAPVNTFGIHLMY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | L | H | b | 1.1 | ![]() |
LIFVMATHYCDEGKNPQSW |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | S | H | b | 5.5 | ![]() |
ASTKCGIPQLMRVHDEFNY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | E | H | e | 50.3 | ![]() |
KREDQSNAGLTFMYHIPV |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | K | H | e | 57.1 | ![]() |
KLQRAETSDFVGINCHMPY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | I | H | b | 2.3 | ![]() |
FILSVYGTHNKPADEMQRW |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | M | b | 8.7 | ![]() |
LMAFVGIQRCDKNPTESY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |||
![]() | H | S | e | 40.3 | ![]() |
NHRKQTGSEPVDFILYAM |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | F | S | e | 47.8 | ![]() |
NDFKESLRTGQIAHMPVY |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | P | e | 23.3 | ![]() |
PAYSETVGIKLDFHMNQR |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |||
![]() | T | E | e | 40.9 | ![]() |
VTELAIKRNSGYDQFHMP |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | W | E | e | 21.5 | ![]() |
REYLKTVISWAFMNQDGHCP |
DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase ATP-binding" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | V | E | b | 1.3 | ![]() |
IVLEKRTAFMCDGNPQS |
REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | D | e | 52.5 | ![]() |
DQSTEKNRLAGIYFVHPM |
REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |||
![]() | L | e | 58.4 | ![]() |
LVIAETKMSGHNQRCDFPY |
REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |||
![]() | K | - | - | - | - | GKDLENVARSTMQFIPYH |
REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | G | - | - | - | - | GASDEKNRPTVFLHIQMY |
REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | E | - | - | - | - | EDKRSNQVIALTGHPCFMY |
REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | D | - | - | - | - | DEKSAGNLQTIPRVFHYM |
REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | S | e | 80.5 | ![]() |
SALTEKVFNQRDGPICHMWY |
REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |||
![]() | V | b | 17.3 | ![]() |
ALTVIMFSKDEGNQYCPR |
REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |||
![]() | P | e | 44.2 | ![]() |
PKVASLENGRTHQCDFIMY |
REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | |||
![]() | D | S | b | 13.6 | ![]() |
DESKLNPGVATQHIRFY |
REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | T | S | e | 29.9 | ![]() |
TSNGADEIKLRQVYFPCHM |
REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | V | E | b | 2.7 | ![]() |
VILAKTFGMQSDENPRY |
REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | H | E | e | 30.4 | ![]() |
HEKQRTFNYDGILSAMPV |
REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | H | E | b | 14.1 | ![]() |
QYHLEGISKNTVADFPRM |
REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | V | E | b | 18.7 | ![]() |
VILTFYKSAEGMNRCHPQD |
REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | V | E | b | 0.0 | ![]() |
VIAFLYEMSTDGKNPQRCHW |
REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | V | E | b | 11.3 | ![]() |
VILGATEFMSYCDKNQRHP |
REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | P | E | e | 29.5 | ![]() |
PKERSVADNFILTGQHMWYC |
REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | V | E | b | 0.0 | ![]() |
VLAISCEKTFGMPDNRHQY |
REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" REGION /note="Interaction with dsRNA" REGION /note="Necessary for interaction with RELA" | ||
![]() | N | e | 24.2 | ![]() |
NGEDSKLPTAQRVFHIMYC |
REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with RELA" | |||
![]() | P | T | b | 0.0 | ![]() |
PSEKALDNQTFGRVHICMY |
REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with RELA" | ||
![]() | K | T | e | 42.9 | ![]() |
KERTDSALQGHNVFIMPYC |
REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with RELA" | ||
![]() | T | T | e | 74.0 | ![]() |
TLEKSAVFIDGPNRMQCHY |
REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with RELA" | ||
![]() | D | b | 18.5 | ![]() |
DEKGLHSAINPQVFRTMYC |
REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with RELA" | |||
![]() | R | e | 38.3 | ![]() |
RKNALQSTVEGIPYCDFHMW |
REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with RELA" | |||
![]() | L | G | e | 23.6 | ![]() |
LIFVTAGMRSEKDNPQYCH |
REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with RELA" | ||
![]() | W | G | b | 5.2 | ![]() |
LVTFSWAKYEGIMPQDNRCH |
REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with RELA" | ||
![]() | E | G | e | 34.7 | ![]() |
EQKADLSGNRTIPVFHYCMW |
REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with RELA" | ||
![]() | R | G | e | 69.2 | ![]() |
RKLEAFGSTVIDNQYHPCMW |
REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with RELA" | ||
![]() | L | T | e | 23.0 | ![]() |
LIVAEFSGKPYDMQRTCHN |
REGION /note="Necessary for interaction with RELA" REGION /note="Necessary for interaction with RELA" | ||
![]() | G | S | e | 75.0 | ![]() |
GASKQELNTVDFIPRCHMWY |
REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA" | ||
![]() | K | S | e | 44.8 | ![]() |
KQELRASDGPVFIMNTYCHW |
REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA" | ||
![]() | S | S | e | 53.9 | ![]() |
SLAEKTVIRGNPQYFDMCHW |
REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA" | ||
![]() | H | S | e | 27.7 | ![]() |
HYLEKADFGPSNQVRTIMC |
REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA" | ||
![]() | I | b | 9.4 | ![]() |
LIVAEGKSTDFNPQRMYCHW |
REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA" | |||
![]() | R | e | 58.1 | ![]() |
RKLAEIFNQSTGVDPYMCHW |
REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA" | |||
![]() | T | b | 5.8 | ![]() |
TVSLAKEIQRDGNPCFHMWY |
REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA" | |||
![]() | D | b | 5.6 | ![]() |
DEKPSGLAQINTVRFHYCMW |
REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA" | |||
![]() | D | S | e | 40.1 | ![]() |
DELNPAGIKSTVFQYRHCMW |
REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA" | ||
![]() | V | T | b | 0.0 | ![]() |
VLIAEGKTSYDFPRCMNQHW |
REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA" | ||
![]() | H | T | b | 2.6 | ![]() |
HEADLKRSFGIQTVYNPMCW |
REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA" | ||
![]() | A | S | e | 71.4 | ![]() |
AVSKLGITREFPCDNQYMHW |
REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA" | ||
![]() | K | S | e | 42.9 | ![]() |
KLSNRAEGDTIPQVFHYCMW |
REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA" | ||
![]() | D | S | e | 33.3 | ![]() |
DEAGLSVIKNPQRTYFHCMW |
REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA" | ||
![]() | N | e | 61.2 | ![]() |
NSLERGKADIVQTHPFMYCW |
REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA" | |||
![]() | T | e | 26.0 | ![]() |
TLKSVAEDGIFNPQRYCHMW |
REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA" | |||
![]() | R | S | e | 31.2 | ![]() |
KRELAVGPQSDINFTYHMCW |
REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA" | ||
![]() | P | T | e | 59.7 | ![]() |
PLSEADGIKTVFMQNRYCHW |
REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA" | ||
![]() | G | T | e | 70.2 | ![]() |
GALSEFKTVDINPQRYCHMW |
REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA" | ||
![]() | A | b | 19.6 | ![]() |
ALSVGIEKPDFRTCNQHMYW |
REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA" | |||
![]() | N | e | 72.1 | ![]() |
NDEKGLSTAFIQRVPYCHMW |
REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA" | |||
![]() | S | S | e | 24.2 | ![]() |
SAELKRVGQTDIPFNCHMYW |
MOD_RES /note="Phosphoserine" ECO:0007744|PubMed:21406692, ECO:0007744|PubMed:23186163" REGION /note="Necessary for interaction with RELA" MOD_RES /note="Phosphoserine" ECO:0007744|PubMed:21406692, ECO:0007744|PubMed:23186163" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA" | ||
![]() | P | H | e | 59.7 | ![]() |
PKLSADEVGRTINQCFYHMW |
REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA" | ||
![]() | E | H | e | 23.6 | ![]() |
EKADYLNRSTQFGIPVCHMW |
REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA" | ||
![]() | M | H | b | 1.4 | ![]() |
LKVIQSEMTADFGNYPRHCW |
REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA" | ||
![]() | W | H | b | 14.7 | ![]() |
LFWKVGAEIYTDNQRSCHMP |
REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA" | ||
![]() | S | H | b | 0.0 | ![]() |
SKALVEPTFINQCDGRYHM |
REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA" | ||
![]() | E | H | b | 7.5 | ![]() |
EKDQLSAIRVGNPTFHYCMW |
REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA" | ||
![]() | A | H | b | 0.0 | ![]() |
LAKVSTGIRCEPFNQDMYH |
REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA" | ||
![]() | I | H | b | 0.0 | ![]() |
LIVKDAFGSTERYPMNQCH |
REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA" | ||
![]() | K | H | b | 7.1 | ![]() |
KADERGQSVCLNPTFHIYM |
REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA" | ||
![]() | I | H | b | 7.6 | ![]() |
LIVFTKSARDEGMPCNQYH |
REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA" | ||
![]() | L | H | b | 0.0 | ![]() |
LIVAFEKMRSTDGNPQYCHW |
REGION /note="Necessary for interaction with RELA" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with RELA" | ||
![]() | K | H | b | 4.2 | ![]() |
KSLRENQVAGPCDITFYHM |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" | ||
![]() | G | H | b | 1.2 | ![]() |
GSDAKLNFTEPRQVCHIYM |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" | ||
![]() | E | H | b | 19.6 | ![]() |
ELSKDTAGIQVFHNRPYCM |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" | ||
![]() | Y | H | b | 7.4 | ![]() |
YFLKASVDEGITHNQRPCMW |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" | ||
![]() | A | H | b | 1.8 | ![]() |
LASGKPETVDIRNQCFMYH |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" | ||
![]() | V | H | b | 8.0 | ![]() |
VLIAETYKRCDFGPSMNQH |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" | ||
![]() | R | H | e | 38.7 | ![]() |
RKEFLSYADNVHQTGIMPC |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" | ||
![]() | A | H | b | 8.0 | ![]() |
LASTVFGIKENPQRDHMYC |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" | ||
![]() | I | H | b | 0.6 | ![]() |
LIVNSKAFTEGMPCDQRYH |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" | ||
![]() | K | H | e | 49.1 | ![]() |
KERLSDNTAGQPFHIMVCY |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" | ||
![]() | E | H | e | 65.3 | ![]() |
EKQRDNSLTACGHPVFIMY |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" | ||
![]() | H | H | e | 36.1 | ![]() |
HENLGKSADFPQTVYIRMCW |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" | ||
![]() | K | T | e | 66.0 | ![]() |
KEPQRLSAGTVDINYFHWCM |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" | ||
![]() | M | b | 0.5 | ![]() |
FVLGIAPTDKNQSEMRYCHW |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" | |||
![]() | D | S | e | 43.2 | ![]() |
DNEGKSAPHLQTFMRVYCIW |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" | ||
![]() | Q | e | 23.5 | ![]() |
KQRSELPTADGINCFHMVY |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" | |||
![]() | A | E | b | 0.0 | ![]() |
ATVISCGLEKMDFHPQR |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" | ||
![]() | I | E | b | 1.8 | ![]() |
ILVAMFDEGKQRT |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" | ||
![]() | I | E | b | 0.6 | ![]() |
IVLAQYCDFKMPRT |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" | ||
![]() | F | E | b | 0.5 | ![]() |
FYLDAEHIRSTV |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" | ||
![]() | C | b | 1.3 | ![]() |
VCFLTASGIDEMNR |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" | |||
![]() | R | S | e | 22.9 | ![]() |
NRSKEAPLQTHVDGFIM |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" | ||
![]() | T | S | b | 18.8 | ![]() |
TSEIRKNHLQVYACDFMP |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" | ||
![]() | K | H | e | 34.0 | ![]() |
KRATQCIVELNSDGHPY |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" | ||
![]() | I | H | e | 37.4 | ![]() |
KREIHVADTLNQSFMCGY |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" | ||
![]() | D | H | e | 21.6 | ![]() |
DREKTSANVHGMPQFILY |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" | ||
![]() | C | H | b | 0.0 | ![]() |
ACVTLSDEGIKMNPQR |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" | ||
![]() | D | H | e | 25.9 | ![]() |
DEQHNAKRSTIGLVYFMP |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" | ||
![]() | N | H | b | 18.8 | ![]() |
SERLYADFKNWTVGHIQCMP |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" | ||
![]() | L | H | b | 2.8 | ![]() |
LVIFMYARSCEHPQT |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" | ||
![]() | E | H | b | 5.5 | ![]() |
AESTLYDHRVIKNFGMQWCP |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" | ||
![]() | Q | H | e | 53.1 | ![]() |
KREDSAQTYIGHLNVPCFM |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with RELA" | ||
![]() | Y | H | b | 12.2 | ![]() |
LYFKTEIADRVQWGHMNPS |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with RELA" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with RELA" | ||
![]() | F | H | b | 0.0 | ![]() |
LFIMARYKSTVCDEGHNPQ |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | I | H | e | 41.5 | ![]() |
LTRIVAKSFGMNEQCDHPY |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | Q | H | e | 49.5 | ![]() |
EQLRAKSDNTGMVFHIPYC |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | Q | T | e | 28.6 | ![]() |
LQKERADSFTINPVGHMYCW |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | G | T | e | 35.7 | ![]() |
GALPSDEFNRTIKQVYCHMW |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | G | b | 4.8 | ![]() |
GLADEPSKTINVCFQRHMYW |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |||
![]() | G | B | b | 1.2 | ![]() |
GALKINSVDPTERFHQYWCM |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | P | T | e | 22.5 | ![]() |
PLTKSVAEGIDRFNQHMYCW |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | D | T | e | 91.4 | ![]() |
DELSPAKNQTVGIRFHMYCW |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | K | S | e | 42.0 | ![]() |
KALVEQRGIPSTDNYFHMCW |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | K | T | e | 67.9 | ![]() |
KRLEADSFNPGITVQHYCMW |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | G | T | e | 40.5 | ![]() |
GASELKNQTDRVIPFHYCMW |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | H | e | 48.7 | ![]() |
HLKRSNADEGPVTCIMQYFW |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |||
![]() | Q | T | e | 48.0 | ![]() |
QKNDRELSGAPTHIVFYCMW |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | F | T | b | 2.9 | ![]() |
FYILVAEHMWDPRSCGKNQT |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | S | B | b | 0.0 | ![]() |
PSKTADNEGRLQVFICHMY |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | C | E | b | 0.0 | ![]() |
AVCLSITNEFKDGHPQRY |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | V | E | b | 0.0 | ![]() |
LIVASTFGYEMPRKCDHNQW |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | C | E | b | 0.0 | ![]() |
ASEYPTCGLRVHIKDFMNQ |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | L | E | b | 3.9 | ![]() |
LIYVFMSAKDEGNPRT |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | H | S | b | 1.0 | ![]() |
HYSTENAPFIKLQR |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | G | T | e | 63.1 | ![]() |
GSAREFHKLQT |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | D | T | e | 62.3 | ![]() |
DGKSENQRAPVCHLTY |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | R | S | b | 11.1 | ![]() |
LMKRQVIHSTYADEFN |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | K | e | 35.8 | ![]() |
DSKTPAERNQGILHV |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |||
![]() | P | H | e | 70.5 | ![]() |
QPADGKSVETFILMNRY |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | H | H | e | 63.4 | ![]() |
QESTKHNRADGLVFIMPY |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | E | H | e | 29.1 | ![]() |
EAQDKSGRVHINTLMPY |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | R | H | e | 35.2 | ![]() |
RNSDHKPQTY |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | K | H | e | 57.1 | ![]() |
EDLKTRNQSAIGMPFVY |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | Q | H | e | 48.5 | ![]() |
KRESAGQNDITWHFLMVY |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | N | H | b | 10.3 | ![]() |
ITVANSLQRGMDEKP |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | L | H | b | 15.7 | ![]() |
LIFVMQTYEKPSAGH |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | E | H | e | 40.2 | ![]() |
KEAQDHNSRTGFLMVWY |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | R | H | e | 26.9 | ![]() |
DEKRQASGNLTFHMP |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | F | H | b | 1.4 | ![]() |
FWLDYAGIMPRSV |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | K | H | e | 57.5 | ![]() |
RKSTGLINPAFQVCEM |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | K | T | e | 75.5 | ![]() |
NKESATDQRGLCFHIMPV |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | G | T | e | 60.7 | ![]() |
GSAFNQDTKLRCEHIMPVY |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | D | S | b | 9.3 | ![]() |
KDEANSLQRVGHTIMPY |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | V | S | b | 0.7 | ![]() |
SITVKYALNCFPGHRQDEM |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | R | S | e | 27.3 | ![]() |
RNPDKSEGACLQTVWYFHIM |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | F | E | b | 0.0 | ![]() |
IVLFACNQYGMSTDEKPR |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | L | E | b | 1.1 | ![]() |
LIMVGCADEFKPRST |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | I | E | b | 0.0 | ![]() |
VILFACDEGKMPST |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | C | E | b | 2.0 | ![]() |
ACTSVGDEIKLPR |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | T | b | 8.4 | ![]() |
TSANDEGIKLPQRV |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |||
![]() | D | H | e | 27.2 | ![]() |
DQNEASTVGKILPR |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | V | H | e | 84.7 | ![]() |
VLAIMDEGPRSKNQT |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | A | H | b | 14.3 | ![]() |
ALFTVISGMCWDEKNPQR |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | A | H | b | 6.2 | ![]() |
ASGTEVDFIKLNPQR |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | R | H | e | 34.4 | ![]() |
RNLMKADEFGIPQSTV |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | G | H | e | 85.7 | ![]() |
GCADEFIKLNPQRSTV |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | I | b | 8.8 | ![]() |
ILVYMFTADEGKNPQRS |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |||
![]() | D | e | 50.0 | ![]() |
DNRHGAEFIKLPQSTV |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |||
![]() | I | b | 17.0 | ![]() |
IVFLHKMYQTARSDEGNP |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |||
![]() | H | e | 39.3 | ![]() |
PSKAQEYLNDGMRTVHI |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |||
![]() | G | e | 26.2 | ![]() |
NGDTASREKQHIVLMPY |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |||
![]() | V | B | b | 1.3 | ![]() |
VILHAFTCM |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | P | S | b | 4.7 | ![]() |
DKSENRTAPQHCFGI |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | Y | E | b | 15.7 | ![]() |
LHYVNPAFTWCIMQDEGRS |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | V | E | b | 0.0 | ![]() |
VRAIM |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | I | E | b | 1.2 | ![]() |
IVLHFYAM |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | N | E | b | 0.0 | ![]() |
NQHLEFSCIMTV |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | V | S | b | 11.3 | ![]() |
YFLVIMAHWC |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | T | S | b | 5.2 | ![]() |
DGRSNTEHQCFM |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | L | b | 0.6 | ![]() |
LFVMPIACSTY |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |||
![]() | P | b | 1.6 | ![]() |
PASCLTV |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |||
![]() | D | S | e | 44.4 | ![]() |
DKNTFSRALQEPGHYIMV |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | E | S | e | 58.8 | ![]() |
DSTNEHKQAGILMPRV |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | K | T | e | 35.4 | ![]() |
PAISTVLYFKRCDMGHNW |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | Q | H | e | 44.4 | ![]() |
EDKSARVIQTMLNP |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | N | H | b | 18.8 | ![]() |
DNTSEIQAVGFKLCHM |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | Y | H | b | 1.3 | ![]() |
YFLHI |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | V | H | e | 20.7 | ![]() |
VILCTAHMRY |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | H | H | e | 67.0 | ![]() |
HQSRN |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | R | H | b | 1.6 | ![]() |
RSEHQAKTV |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | I | H | b | 1.8 | ![]() |
VISACLMTF |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | G | T | e | 44.0 | ![]() |
GSA |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | R | T | b | 17.0 | ![]() |
REQY |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | V | B | b | 2.7 | ![]() |
TASDVGIL |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | G | b | 13.1 | ![]() |
GAS |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |||
![]() | R | e | 47.8 | ![]() |
RPHQ |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |||
![]() | A | T | e | 75.9 | ![]() |
AFRMGHDLYNSCEIKTV |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | E | T | e | 27.6 | ![]() |
GNWEDSTAKLR |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | R | S | e | 33.6 | ![]() |
RKANQTEHSFV |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | M | e | 31.4 | ![]() |
KESTPRADLNQVGHIMWY |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |||
![]() | G | E | b | 1.2 | ![]() |
GASCK |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | L | E | b | 15.7 | ![]() |
LVTRKEIFSHACMNQWDGY |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | A | E | b | 0.0 | ![]() |
ASGVCKRT |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | I | E | b | 2.3 | ![]() |
IVLYTFAHCMRW |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | S | E | b | 0.0 | ![]() |
TSLNVQAIMYCFG |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | L | E | b | 1.1 | ![]() |
FLIPMVTY |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | V | E | b | 0.0 | ![]() |
VILFCAMYGT |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | A | E | b | 0.9 | ![]() |
TSALQDGNCEHVFIPYKMR |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | T | S | e | 23.4 | ![]() |
PTSEDKNGQLVYAHIMRW |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | E | S | e | 31.7 | ![]() |
EKDQTCPSGNRHYALMVW |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | K | e | 57.5 | ![]() |
EDRKQNSGAPTYH |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |||
![]() | E | E | b | 6.0 | ![]() |
EDRSKALVTGHIMNPQ |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | K | E | b | 8.5 | ![]() |
KREADQSNFGYHILMPTV |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | V | E | b | 2.7 | ![]() |
VILASMTFKDEGNYPHQR |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | W | E | b | 8.8 | ![]() |
FLWYSVMAGIKPRDEQ |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | Y | e | 27.4 | ![]() |
YLVRFHKEADISGMWPQT |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |||
![]() | H | e | 30.9 | ![]() |
metal ZN | DRKHESANITGLPQYMV |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | V | e | 67.3 | ![]() |
ILVAFMKTRSDEGPW |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |||
![]() | C | S | e | 24.0 | ![]() |
metal ZN | LEAICTKVDMSGPQRFNY |
REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |
![]() | S | T | e | 85.2 | ![]() |
KSNAEQRLDGTIPVFHY |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | S | T | e | 46.1 | ![]() |
SATEVKDILRGMHNQFPY |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | R | T | e | 53.0 | ![]() |
RKLIEAVDQSTFGHNMPY |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | G | T | e | 23.8 | ![]() |
GQSANDLVIKRPTEFHMY |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | K | T | e | 40.6 | ![]() |
KERSVQAGPTDILNFHY |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | G | T | e | 72.6 | ![]() |
GKSQAFNRVDEPLTIY |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | C | b | 15.3 | ![]() |
metal ZN | CLAVFKGSYIMQDHNRTWEP |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | Y | e | 80.4 | ![]() |
YELFKIHSQTADGNRVWMP |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |||
![]() | N | e | 47.9 | ![]() |
NESKLGVADIMPQRFHT |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |||
![]() | T | e | 31.8 | ![]() |
TLSVEIRYDGHANPFKQ |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |||
![]() | R | S | b | 13.8 | ![]() |
RKQESDTVNLHPAGI |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | L | B | e | 32.0 | ![]() |
ILVRCDKMSGPTYAEFNQ |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | K | G | e | 27.8 | ![]() |
EKDINTVHSPRAQGL |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | E | G | e | 52.8 | ![]() |
EKADSRPVMQTGILNW |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | D | G | e | 48.1 | ![]() |
DEHANVQPLGKSMFIRTY |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | G | T | e | 70.2 | ![]() |
GAKSVMDNREPLQTFIY |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | G | b | 0.0 | ![]() |
GDESVLKRTAINMFPQY |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |||
![]() | C | S | b | 3.3 | ![]() |
metal ZN | VCEKALNSRTDFPQYIG |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |
![]() | T | E | b | 0.0 | ![]() |
TSVDENKQACHLYFGIPR |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | I | E | e | 32.7 | ![]() |
ILDSVKEFMAGNQRPTY |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | W | E | e | 29.5 | ![]() |
WFLERDTAQGIKSVPNY |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | Y | E | b | 8.3 | ![]() |
LYPERVFHQAMKSWDGINT |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | N | e | 38.8 | ![]() |
NEAKIDHVGLSTFPQR |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |||
![]() | E | H | b | 2.0 | ![]() |
EQDKSVNFLIRAGPT |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | M | H | e | 28.0 | ![]() |
MVLKRAIPFSEDQTGN |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | Q | H | e | 48.0 | ![]() |
QEDKRNPAHSTGML |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | L | H | b | 13.5 | ![]() |
LAIEMKRVNSG |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | L | H | b | 1.1 | ![]() |
LVIFTYRAMPSDEQ |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | S | H | e | 38.3 | ![]() |
SATNQDKEMVLPGR |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | E | H | e | 32.2 | ![]() |
EKQRDPAGLSV |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | I | H | b | 1.2 | ![]() |
ILVAKEMNRDGPST |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | E | H | b | 14.1 | ![]() |
EDKQVFLAPRGINST |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | E | H | e | 69.3 | ![]() |
EDPKARQSNTGLV |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | H | H | e | 52.9 | ![]() |
HRSPQKNYEIVMADGLT |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | L | T | b | 11.8 | ![]() |
LVFYICMAKEGST |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | N | T | e | 80.0 | ![]() |
NDETARSGIKYQLPV |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | C | S | b | 20.0 | ![]() |
ACISTKQEVDFPGLR |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | T | e | 79.2 | ![]() |
TSVAEINRKQGL |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |||
![]() | I | b | 3.5 | ![]() |
ILVKQMEFSTAG |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |||
![]() | S | e | 46.9 | ![]() |
SEQRKDANVGL |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |||
![]() | Q | B | e | 57.7 | ![]() |
EQRGLPKDAF |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | V | e | 78.7 | ![]() |
VLIAMRK |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | |||
![]() | E | - | - | - | - | EDRSHPTV |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | P | - | - | - | - | PKESACIDMT |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | D | - | - | - | - | DESKTPNQV |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | I | - | - | - | - | IVSLERAFM |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | K | - | - | - | - | KPQDRL |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | V | - | - | - | - | VKLENTFIA |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | P | - | - | - | - | EPKAVMNGLS |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | V | - | - | - | - | VLNAISKMEG |
DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED DOMAIN /note="Helicase C-terminal" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | D | - | - | - | - | DKNRS |
REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | E | - | - | - | - | EDFGHSMA |
REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | F | - | - | - | - | FKHLM |
REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | D | - | - | - | - | DSKPLQR |
REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | G | - | - | - | - | GEKL |
REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | K | - | - | - | - | KQAGN |
REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | V | - | - | - | - | VQNIKF |
REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | T | - | - | - | - | TKVELG |
REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | Y | - | - | - | - | YSHKG |
REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | G | - | - | - | - | GSADEFIKLNPQRTVY |
REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | Q | - | - | - | - | QRKTADEFGILNPSVY |
REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | K | - | - | - | - | KARDEFGILNPQSTVY |
REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | R | - | - | - | - | RNLADEFGIKPQSTVY |
REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | A | - | - | - | - | APLTDEGKSVCFHIMNQRY |
REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | A | - | - | - | - | AVGNRLTDEKSCFHIMPQY |
REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | G | - | - | - | - | GLNAMT |
REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | G | - | - | - | - | GS |
REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | G | - | - | - | - | GAQYST |
REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | S | - | - | - | - | ATEGDLSIKNPQRV |
REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | Y | - | - | - | - | YCK |
REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | K | - | - | - | - | KRLES |
REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | G | - | - | - | - | GRDP |
REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | H | - | - | - | - | HQ |
REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | V | - | - | - | - | VEDTAFGIKLNPQRSY |
REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | D | - | - | - | - | DERAFGIKLNPQSTVY |
REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | I | - | - | - | - | AIMQEDFGKLNPRSTVY |
REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | L | - | - | - | - | LAGDEFIKNPQRSTVY |
REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | A | - | - | - | - | APRGVLDEFIKNQSTY |
REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | P | - | - | - | - | PS |
REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | T | - | - | - | - | TR |
REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | V | - | - | - | - | VS |
REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | Q | - | - | - | - | QRL |
REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | E | - | - | - | - | EAGKQ |
REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | L | - | - | - | - | LFQ |
REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | A | - | - | - | - | ADPTS |
REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | A | - | - | - | - | QAMDE |
REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | L | - | - | - | - | LTQ |
REGION /note="Necessary for interaction with HNRNPK" DISORDER predicted by DISOPRED REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | E | - | - | - | - | EP |
REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | K | - | - | - | - | EKPL |
REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | E | - | - | - | - | QEAT |
REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | A | - | - | - | - | AIS |
REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | Q | - | - | - | - | QEN |
REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | T | - | - | - | - | TSI |
REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | S | - | - | - | - | LSGD |
REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | F | - | - | - | - | FYL |
REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | L | - | - | - | - | LC |
REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | H | - | - | - | - | HYT |
REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | L | - | - | - | - | L |
REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | G | - | - | - | - | GE |
REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | Y | - | - | - | - | YL |
REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | L | - | - | - | - | LH |
REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | P | - | - | - | - | PS |
REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | N | - | - | - | - | NR |
REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | Q | - | - | - | - | Q |
REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | L | - | - | - | - | L |
REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | F | - | - | - | - | F |
REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | R | - | - | - | - | R |
REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | T | - | - | - | - | T |
REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with HNRNPK" | ||
![]() | F | - | - | - | - | F |
REGION /note="Necessary for interaction with HNRNPK" REGION /note="Necessary for interaction with HNRNPK" |