Contact Molecules for Homologous Proteins


[Summary Bars]

[SiteTable]


Full Bars[0.0 %]


[Back to Search Page]

[Back to HOMCOS]

[SupCon3D]

[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
4021742 631 35 P17405(ASM_HUMAN) RecName: Full=Sphingomyelin phosphodiesterase ; EC=3.1.4.12 ; EC=3.1.4.3 ;AltName: Full=Acid sphingomyelinase ; Short=aSMase;Contains: RecName: Full=Sphingomyelin phosphodiesterase, processed form ;Flags: Precursor;
QUERYSEQ
MPRYGASLRQSCPRSGREQGQDGTAGAPGLLWMGLVLALALALALALALSDSRVLWAPAEAHPLSPQGHPARLHRIVPRLRDVFGWGNLTCPICKGLFTAINLGLKKEPNVARVGSVAIKLCNLLKIAPPAVCQSIVHLFEDDMVEVWRR
SVLSPSEACGLLLGSTCGHWDIFSSWNISLPTVPKPPPKPPSPPAPGAPVSRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGEYSKCDLPLRTLESLLSGLGPAGPFDMVYWTGDIPAHDVWHQTRQDQLRALTT
VTALVRKFLGPVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGGFYALSPYPGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGDKVHIIGHIPPGHCLKSWSWNYYRIVARYEN
TLAAQFFGHTHVDEFEVFYDEETLSRPLAVAFLAPSATTYIGLNPGYRVYQIDGNYSGSSHVVLDHETYILNLTQANIPGAIPHWQLLYRARETYGLPNTLPTAWHNLVYRMRGDMQLFQTFWFLYHKGHPPSEPCGTPCRLATLCAQLS
ARADSPALCRHLMPDGSLPEAQSLWPRPLFC
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [P17405(ASM_HUMAN)]

631
region name description
1-46 SIGNAL
47-631 CHAIN /note="Sphingomyelin phosphodiesterase" /id="PRO_0000002323"
254-631 CHAIN /note="Sphingomyelin phosphodiesterase, processed form" /id="PRO_0000456684"
87-171 DOMAIN /note="Saposin B-type"
1-23 REGION /note="Disordered"
208-208 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="1" ECO:0007744|PDB:5I81, ECO:0007744|PDB:5I85, ECO:0007744|PDB:5I8R, ECO:0007744|PDB:5JG8"
210-210 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="1" ECO:0007744|PDB:5I81, ECO:0007744|PDB:5I85, ECO:0007744|PDB:5I8R, ECO:0007744|PDB:5JG8"
280-280 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="1" ECO:0007744|PDB:5I81, ECO:0007744|PDB:5I85, ECO:0007744|PDB:5I8R, ECO:0007744|PDB:5JG8"
280-280 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="2" ECO:0007744|PDB:5I81, ECO:0007744|PDB:5I85, ECO:0007744|PDB:5I8R, ECO:0007744|PDB:5JG8"
320-320 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="2" ECO:0007744|PDB:5I81, ECO:0007744|PDB:5I85, ECO:0007744|PDB:5I8R, ECO:0007744|PDB:5JG8"
427-427 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="2" ECO:0007744|PDB:5I81, ECO:0007744|PDB:5I85, ECO:0007744|PDB:5I8R, ECO:0007744|PDB:5JG8"
459-459 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="2" ECO:0007744|PDB:5I81, ECO:0007744|PDB:5I85, ECO:0007744|PDB:5I8R, ECO:0007744|PDB:5JG8"
461-461 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="1" ECO:0007744|PDB:5I81, ECO:0007744|PDB:5I85, ECO:0007744|PDB:5I8R, ECO:0007744|PDB:5JG8"
1-196 DISORDER predicted by DISOPRED

MONOMER
631
pdb_id a1 identity[%]2 description
5jg8 B 100.0 ASM_HUMAN Sphingomyelin phosphodiesterase
5jg8 A 100.0 ASM_HUMAN Sphingomyelin phosphodiesterase
5i8r B 100.0 ASM_HUMAN Sphingomyelin phosphodiesterase
5i81 A 100.0 ASM_HUMAN Sphingomyelin phosphodiesterase
5i85 A 100.0 ASM_HUMAN Sphingomyelin phosphodiesterase
5i8r A 100.0 ASM_HUMAN Sphingomyelin phosphodiesterase
5i8r C 100.0 ASM_HUMAN Sphingomyelin phosphodiesterase
5fic B 88.4 ASM_MOUSE Sphingomyelin phosphodiesterase
5fic A 88.4 ASM_MOUSE Sphingomyelin phosphodiesterase
5fic C 88.4 ASM_MOUSE Sphingomyelin phosphodiesterase
5fic D 88.4 ASM_MOUSE Sphingomyelin phosphodiesterase
5fi9 B 88.4 ASM_MOUSE Sphingomyelin phosphodiesterase
5fib B 88.4 ASM_MOUSE Sphingomyelin phosphodiesterase
5fib A 88.4 ASM_MOUSE Sphingomyelin phosphodiesterase
5fi9 A 88.3 ASM_MOUSE Sphingomyelin phosphodiesterase
5hqn A 89.4 ASM_MOUSE Sphingomyelin phosphodiesterase
5hqn B 89.4 ASM_MOUSE Sphingomyelin phosphodiesterase
5fc5 A 35.1 ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fca A 35.1 ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fc6 A 35.1 ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fcb A 35.1 ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fca B 35.1 ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fc1 A 35.1 ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fc7 A 35.1 ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
8w6p A 34.6 ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
8w6p B 34.6 ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
8w6r A 34.4 ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5ebb B 34.6 ASM3A_HUMAN Acid sphingomyelinase-like phosphodiesterase 3a
5ebb C 34.6 ASM3A_HUMAN Acid sphingomyelinase-like phosphodiesterase 3a
5ebb A 34.6 ASM3A_HUMAN Acid sphingomyelinase-like phosphodiesterase 3a
5ebe B 34.6 ASM3A_HUMAN Acid sphingomyelinase-like phosphodiesterase 3a
5ebe C 34.6 ASM3A_HUMAN Acid sphingomyelinase-like phosphodiesterase 3a
5ebe A 34.6 ASM3A_HUMAN Acid sphingomyelinase-like phosphodiesterase 3a
5kas A 33.2 ASM3B_MOUSE Acid sphingomyelinase-like phosphodiesterase 3b
5kar A 33.2 ASM3B_MOUSE Acid sphingomyelinase-like phosphodiesterase 3b
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
COMPOUND
631 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
5fi9 N NT8
(1-azanyl-1-phosphono-decyl)phosphonic acid[19 ato..
A 100.0
/88.3
12
/12
ASM_MOUSE Sphingomyelin phosphodiesterase
5fi9 Q NT8
(1-azanyl-1-phosphono-decyl)phosphonic acid[19 ato..
B 100.0
/88.4
13
/13
ASM_MOUSE Sphingomyelin phosphodiesterase
5fic R 6E0
octadecylphosphonic acid[22 atoms]
A 83.3
/88.4
6
/6
ASM_MOUSE Sphingomyelin phosphodiesterase
5fic HA 6E0
octadecylphosphonic acid[22 atoms]
D 80.0
/88.4
5
/5
ASM_MOUSE Sphingomyelin phosphodiesterase
5fc6 L AP2
PHOSPHOMETHYLPHOSPHONIC ACID ADENOSYL ESTER[27 ato..
A 81.8
/35.1
11
/13
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fcb H AMP
ADENOSINE MONOPHOSPHATE[23 atoms]
A 87.5
/35.1
8
/10
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5ebe K C5P
CYTIDINE-5'-MONOPHOSPHATE[21 atoms]
A 69.2
/34.6
13
/14
ASM3A_HUMAN Acid sphingomyelinase-like phosphodiesterase 3a
5ebe AA C5P
CYTIDINE-5'-MONOPHOSPHATE[21 atoms]
C 83.3
/34.6
12
/13
ASM3A_HUMAN Acid sphingomyelinase-like phosphodiesterase 3a
5ebe T RP5
5-O-phosphono-beta-D-ribofuranose[14 atoms]
B 88.9
/34.6
9
/9
ASM3A_HUMAN Acid sphingomyelinase-like phosphodiesterase 3a
8w6p G YA4
[(2~{R},3~{S},4~{S})-3,4-bis(oxidanyl)oxolan-2-yl]..
A 100.0
/34.6
8
/8
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
8w6p M FUC
alpha-L-fucopyranose[10 atoms]
B 0.0
/34.6
2
/2
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5ebb F NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 33.3
/34.6
3
/3
ASM3A_HUMAN Acid sphingomyelinase-like phosphodiesterase 3a
5ebb G NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 0.0
/34.6
5
/5
ASM3A_HUMAN Acid sphingomyelinase-like phosphodiesterase 3a
5ebb H NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 20.0
/34.6
5
/5
ASM3A_HUMAN Acid sphingomyelinase-like phosphodiesterase 3a
5ebb L NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 33.3
/34.6
3
/3
ASM3A_HUMAN Acid sphingomyelinase-like phosphodiesterase 3a
5ebb M NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 0.0
/34.6
5
/5
ASM3A_HUMAN Acid sphingomyelinase-like phosphodiesterase 3a
5ebb N NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 25.0
/34.6
4
/4
ASM3A_HUMAN Acid sphingomyelinase-like phosphodiesterase 3a
5ebb S NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 33.3
/34.6
3
/3
ASM3A_HUMAN Acid sphingomyelinase-like phosphodiesterase 3a
5ebb T NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 0.0
/34.6
3
/3
ASM3A_HUMAN Acid sphingomyelinase-like phosphodiesterase 3a
5ebb U NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 50.0
/34.6
4
/4
ASM3A_HUMAN Acid sphingomyelinase-like phosphodiesterase 3a
5ebe E NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 0.0
/34.6
2
/2
ASM3A_HUMAN Acid sphingomyelinase-like phosphodiesterase 3a
5ebe F NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 0.0
/34.6
3
/3
ASM3A_HUMAN Acid sphingomyelinase-like phosphodiesterase 3a
5ebe G NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 0.0
/34.6
1
/1
ASM3A_HUMAN Acid sphingomyelinase-like phosphodiesterase 3a
5ebe H NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[13 atoms]..
A 33.3
/34.6
3
/3
ASM3A_HUMAN Acid sphingomyelinase-like phosphodiesterase 3a
5ebe L NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 0.0
/34.6
2
/2
ASM3A_HUMAN Acid sphingomyelinase-like phosphodiesterase 3a
5ebe M NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 0.0
/34.6
1
/1
ASM3A_HUMAN Acid sphingomyelinase-like phosphodiesterase 3a
5ebe N NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 20.0
/34.6
5
/5
ASM3A_HUMAN Acid sphingomyelinase-like phosphodiesterase 3a
5ebe U NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 0.0
/34.6
2
/2
ASM3A_HUMAN Acid sphingomyelinase-like phosphodiesterase 3a
5ebe V NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 0.0
/34.6
3
/3
ASM3A_HUMAN Acid sphingomyelinase-like phosphodiesterase 3a
5ebe W NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 0.0
/34.6
1
/1
ASM3A_HUMAN Acid sphingomyelinase-like phosphodiesterase 3a
5ebe X NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 33.3
/34.6
6
/6
ASM3A_HUMAN Acid sphingomyelinase-like phosphodiesterase 3a
5fc1 H NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 0.0
/35.1
2
/2
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fc7 G NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 0.0
/35.1
1
/1
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fc7 H NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 33.3
/35.1
3
/3
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fib AA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 100.0
/88.4
1
/1
ASM_MOUSE Sphingomyelin phosphodiesterase
5fic U NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 100.0
/88.4
3
/3
ASM_MOUSE Sphingomyelin phosphodiesterase
5fic AA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 100.0
/88.4
1
/1
ASM_MOUSE Sphingomyelin phosphodiesterase
5hqn N NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 100.0
/89.4
1
/1
ASM_MOUSE Sphingomyelin phosphodiesterase
5i81 E NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/100.0
1
/1
ASM_HUMAN Sphingomyelin phosphodiesterase
5i81 E NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/100.0
2
/2
ASM_HUMAN Sphingomyelin phosphodiesterase
5i81 E NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/100.0
2
/2
ASM_HUMAN Sphingomyelin phosphodiesterase
5i81 E NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/100.0
1
/1
ASM_HUMAN Sphingomyelin phosphodiesterase
5i81 F NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/100.0
3
/3
ASM_HUMAN Sphingomyelin phosphodiesterase
5i81 F NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/100.0
3
/3
ASM_HUMAN Sphingomyelin phosphodiesterase
5i81 H NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/100.0
2
/2
ASM_HUMAN Sphingomyelin phosphodiesterase
5i81 H NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/100.0
2
/2
ASM_HUMAN Sphingomyelin phosphodiesterase
5i81 J NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/100.0
6
/6
ASM_HUMAN Sphingomyelin phosphodiesterase
5i81 J NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/100.0
6
/6
ASM_HUMAN Sphingomyelin phosphodiesterase
5i85 E NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/100.0
1
/1
ASM_HUMAN Sphingomyelin phosphodiesterase
5i85 E NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/100.0
1
/1
ASM_HUMAN Sphingomyelin phosphodiesterase
5i85 E NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/100.0
1
/1
ASM_HUMAN Sphingomyelin phosphodiesterase
5i85 E NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/100.0
1
/1
ASM_HUMAN Sphingomyelin phosphodiesterase
5i85 F NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/100.0
2
/2
ASM_HUMAN Sphingomyelin phosphodiesterase
5i85 F NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/100.0
2
/2
ASM_HUMAN Sphingomyelin phosphodiesterase
5i85 F NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/100.0
2
/2
ASM_HUMAN Sphingomyelin phosphodiesterase
5i85 F NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/100.0
2
/2
ASM_HUMAN Sphingomyelin phosphodiesterase
5i85 G NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/100.0
4
/4
ASM_HUMAN Sphingomyelin phosphodiesterase
5i85 G NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/100.0
4
/4
ASM_HUMAN Sphingomyelin phosphodiesterase
5i85 G NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/100.0
4
/4
ASM_HUMAN Sphingomyelin phosphodiesterase
5i85 G NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/100.0
4
/4
ASM_HUMAN Sphingomyelin phosphodiesterase
5i8r J NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/100.0
2
/2
ASM_HUMAN Sphingomyelin phosphodiesterase
5i8r K NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/100.0
1
/1
ASM_HUMAN Sphingomyelin phosphodiesterase
5i8r M NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/100.0
2
/2
ASM_HUMAN Sphingomyelin phosphodiesterase
5i8r N NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/100.0
5
/5
ASM_HUMAN Sphingomyelin phosphodiesterase
5i8r S NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 100.0
/100.0
2
/2
ASM_HUMAN Sphingomyelin phosphodiesterase
5i8r T NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 100.0
/100.0
1
/1
ASM_HUMAN Sphingomyelin phosphodiesterase
5i8r U NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 100.0
/100.0
2
/2
ASM_HUMAN Sphingomyelin phosphodiesterase
5i8r AA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 100.0
/100.0
1
/1
ASM_HUMAN Sphingomyelin phosphodiesterase
5i8r BA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 100.0
/100.0
1
/1
ASM_HUMAN Sphingomyelin phosphodiesterase
5i8r CA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 100.0
/100.0
3
/3
ASM_HUMAN Sphingomyelin phosphodiesterase
5i8r Z NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 100.0
/100.0
1
/1
ASM_HUMAN Sphingomyelin phosphodiesterase
5jg8 M NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/100.0
2
/2
ASM_HUMAN Sphingomyelin phosphodiesterase
5jg8 N NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/100.0
5
/5
ASM_HUMAN Sphingomyelin phosphodiesterase
5jg8 O NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/100.0
2
/2
ASM_HUMAN Sphingomyelin phosphodiesterase
5jg8 S NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/100.0
1
/1
ASM_HUMAN Sphingomyelin phosphodiesterase
5jg8 M NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 100.0
/100.0
1
/1
ASM_HUMAN Sphingomyelin phosphodiesterase
5jg8 S NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 100.0
/100.0
2
/2
ASM_HUMAN Sphingomyelin phosphodiesterase
5jg8 T NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 100.0
/100.0
2
/2
ASM_HUMAN Sphingomyelin phosphodiesterase
8w6p H NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 33.3
/34.6
3
/3
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
8w6p I NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 0.0
/34.6
3
/3
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
8w6p N NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 33.3
/34.6
3
/3
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
8w6p O NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 0.0
/34.6
3
/3
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
8w6p P NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 0.0
/34.6
3
/3
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
8w6r C NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 50.0
/34.4
2
/2
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
8w6r D NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 0.0
/34.4
2
/2
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
8w6r E NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 0.0
/34.4
3
/3
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fc5 H PC
PHOSPHOCHOLINE[11 atoms]
A 100.0
/35.1
7
/8
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5i85 U PC
PHOSPHOCHOLINE[11 atoms]
A 100.0
/100.0
9
/9
ASM_HUMAN Sphingomyelin phosphodiesterase
5i85 U PC
PHOSPHOCHOLINE[11 atoms]
A 100.0
/100.0
9
/9
ASM_HUMAN Sphingomyelin phosphodiesterase
5i85 U PC
PHOSPHOCHOLINE[11 atoms]
A 100.0
/100.0
9
/9
ASM_HUMAN Sphingomyelin phosphodiesterase
5i85 U PC
PHOSPHOCHOLINE[11 atoms]
A 100.0
/100.0
9
/9
ASM_HUMAN Sphingomyelin phosphodiesterase
5kas L PC
PHOSPHOCHOLINE[11 atoms]
A 80.0
/33.2
10
/11
ASM3B_MOUSE Acid sphingomyelinase-like phosphodiesterase 3b
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
METAL
631 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
5fic P CL
CHLORIDE ION[1 atoms]
A 100.0
/88.4
1
/1
ASM_MOUSE Sphingomyelin phosphodiesterase
5fic Q CL
CHLORIDE ION[1 atoms]
A 100.0
/88.4
4
/4
ASM_MOUSE Sphingomyelin phosphodiesterase
5fic X CL
CHLORIDE ION[1 atoms]
B 100.0
/88.4
5
/5
ASM_MOUSE Sphingomyelin phosphodiesterase
5fic CA CL
CHLORIDE ION[1 atoms]
C 100.0
/88.4
4
/4
ASM_MOUSE Sphingomyelin phosphodiesterase
5fic GA CL
CHLORIDE ION[1 atoms]
D 100.0
/88.4
3
/3
ASM_MOUSE Sphingomyelin phosphodiesterase
5ebb D ZN
ZINC ION[1 atoms]
A 100.0
/34.6
5
/5
ASM3A_HUMAN Acid sphingomyelinase-like phosphodiesterase 3a
5ebb E ZN
ZINC ION[1 atoms]
A 100.0
/34.6
5
/5
ASM3A_HUMAN Acid sphingomyelinase-like phosphodiesterase 3a
5ebb J ZN
ZINC ION[1 atoms]
B 100.0
/34.6
4
/4
ASM3A_HUMAN Acid sphingomyelinase-like phosphodiesterase 3a
5ebb K ZN
ZINC ION[1 atoms]
B 100.0
/34.6
5
/5
ASM3A_HUMAN Acid sphingomyelinase-like phosphodiesterase 3a
5ebb Q ZN
ZINC ION[1 atoms]
C 100.0
/34.6
5
/5
ASM3A_HUMAN Acid sphingomyelinase-like phosphodiesterase 3a
5ebb R ZN
ZINC ION[1 atoms]
C 100.0
/34.6
5
/5
ASM3A_HUMAN Acid sphingomyelinase-like phosphodiesterase 3a
5ebe I ZN
ZINC ION[1 atoms]
A 100.0
/34.6
5
/5
ASM3A_HUMAN Acid sphingomyelinase-like phosphodiesterase 3a
5ebe J ZN
ZINC ION[1 atoms]
A 100.0
/34.6
5
/5
ASM3A_HUMAN Acid sphingomyelinase-like phosphodiesterase 3a
5ebe O ZN
ZINC ION[1 atoms]
B 100.0
/34.6
4
/4
ASM3A_HUMAN Acid sphingomyelinase-like phosphodiesterase 3a
5ebe P ZN
ZINC ION[1 atoms]
B 100.0
/34.6
4
/4
ASM3A_HUMAN Acid sphingomyelinase-like phosphodiesterase 3a
5ebe Y ZN
ZINC ION[1 atoms]
C 100.0
/34.6
4
/4
ASM3A_HUMAN Acid sphingomyelinase-like phosphodiesterase 3a
5ebe Z ZN
ZINC ION[1 atoms]
C 100.0
/34.6
5
/5
ASM3A_HUMAN Acid sphingomyelinase-like phosphodiesterase 3a
5fc1 F ZN
ZINC ION[1 atoms]
A 100.0
/35.1
4
/4
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fc1 G ZN
ZINC ION[1 atoms]
A 100.0
/35.1
4
/4
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fc5 F ZN
ZINC ION[1 atoms]
A 100.0
/35.1
4
/4
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fc5 G ZN
ZINC ION[1 atoms]
A 100.0
/35.1
4
/4
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fc6 F ZN
ZINC ION[1 atoms]
A 100.0
/35.1
4
/4
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fc6 G ZN
ZINC ION[1 atoms]
A 100.0
/35.1
4
/4
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fc7 E ZN
ZINC ION[1 atoms]
A 100.0
/35.1
4
/4
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fc7 F ZN
ZINC ION[1 atoms]
A 100.0
/35.1
4
/4
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fca K ZN
ZINC ION[1 atoms]
A 100.0
/35.1
4
/4
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fca L ZN
ZINC ION[1 atoms]
A 100.0
/35.1
5
/5
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fca M ZN
ZINC ION[1 atoms]
A 100.0
/35.1
2
/2
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fca N ZN
ZINC ION[1 atoms]
A 0.0
/35.1
1
/2
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fca U ZN
ZINC ION[1 atoms]
A 0.0
/35.1
1
/1
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fca V ZN
ZINC ION[1 atoms]
B 100.0
/35.1
4
/4
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fca W ZN
ZINC ION[1 atoms]
B 100.0
/35.1
4
/4
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fca X ZN
ZINC ION[1 atoms]
B 100.0
/35.1
2
/2
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fcb F ZN
ZINC ION[1 atoms]
A 100.0
/35.1
4
/4
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fcb G ZN
ZINC ION[1 atoms]
A 100.0
/35.1
4
/4
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fi9 L ZN
ZINC ION[1 atoms]
A 100.0
/88.3
4
/4
ASM_MOUSE Sphingomyelin phosphodiesterase
5fi9 M ZN
ZINC ION[1 atoms]
A 100.0
/88.3
4
/4
ASM_MOUSE Sphingomyelin phosphodiesterase
5fi9 O ZN
ZINC ION[1 atoms]
B 100.0
/88.4
4
/4
ASM_MOUSE Sphingomyelin phosphodiesterase
5fi9 P ZN
ZINC ION[1 atoms]
B 100.0
/88.4
5
/5
ASM_MOUSE Sphingomyelin phosphodiesterase
5fib K ZN
ZINC ION[1 atoms]
A 100.0
/88.4
4
/4
ASM_MOUSE Sphingomyelin phosphodiesterase
5fib L ZN
ZINC ION[1 atoms]
A 100.0
/88.4
5
/5
ASM_MOUSE Sphingomyelin phosphodiesterase
5fib X ZN
ZINC ION[1 atoms]
B 100.0
/88.4
4
/4
ASM_MOUSE Sphingomyelin phosphodiesterase
5fib Y ZN
ZINC ION[1 atoms]
B 100.0
/88.4
5
/5
ASM_MOUSE Sphingomyelin phosphodiesterase
5fic K ZN
ZINC ION[1 atoms]
A 100.0
/88.4
4
/4
ASM_MOUSE Sphingomyelin phosphodiesterase
5fic L ZN
ZINC ION[1 atoms]
A 100.0
/88.4
5
/5
ASM_MOUSE Sphingomyelin phosphodiesterase
5fic S ZN
ZINC ION[1 atoms]
B 100.0
/88.4
5
/5
ASM_MOUSE Sphingomyelin phosphodiesterase
5fic T ZN
ZINC ION[1 atoms]
B 100.0
/88.4
6
/6
ASM_MOUSE Sphingomyelin phosphodiesterase
5fic Y ZN
ZINC ION[1 atoms]
C 100.0
/88.4
5
/5
ASM_MOUSE Sphingomyelin phosphodiesterase
5fic Z ZN
ZINC ION[1 atoms]
C 100.0
/88.4
5
/5
ASM_MOUSE Sphingomyelin phosphodiesterase
5fic DA ZN
ZINC ION[1 atoms]
D 100.0
/88.4
5
/5
ASM_MOUSE Sphingomyelin phosphodiesterase
5fic EA ZN
ZINC ION[1 atoms]
D 100.0
/88.4
5
/5
ASM_MOUSE Sphingomyelin phosphodiesterase
5hqn I ZN
ZINC ION[1 atoms]
A 100.0
/89.4
4
/4
ASM_MOUSE Sphingomyelin phosphodiesterase
5hqn J ZN
ZINC ION[1 atoms]
A 100.0
/89.4
5
/5
ASM_MOUSE Sphingomyelin phosphodiesterase
5hqn L ZN
ZINC ION[1 atoms]
B 100.0
/89.4
4
/4
ASM_MOUSE Sphingomyelin phosphodiesterase
5hqn M ZN
ZINC ION[1 atoms]
B 100.0
/89.4
5
/5
ASM_MOUSE Sphingomyelin phosphodiesterase
5i81 L ZN
ZINC ION[1 atoms]
A 100.0
/100.0
5
/5
ASM_HUMAN Sphingomyelin phosphodiesterase
5i81 L ZN
ZINC ION[1 atoms]
A 100.0
/100.0
5
/5
ASM_HUMAN Sphingomyelin phosphodiesterase
5i81 M ZN
ZINC ION[1 atoms]
A 100.0
/100.0
4
/4
ASM_HUMAN Sphingomyelin phosphodiesterase
5i81 M ZN
ZINC ION[1 atoms]
A 100.0
/100.0
4
/4
ASM_HUMAN Sphingomyelin phosphodiesterase
5i85 H ZN
ZINC ION[1 atoms]
A 100.0
/100.0
5
/5
ASM_HUMAN Sphingomyelin phosphodiesterase
5i85 H ZN
ZINC ION[1 atoms]
A 100.0
/100.0
5
/5
ASM_HUMAN Sphingomyelin phosphodiesterase
5i85 H ZN
ZINC ION[1 atoms]
A 100.0
/100.0
5
/5
ASM_HUMAN Sphingomyelin phosphodiesterase
5i85 H ZN
ZINC ION[1 atoms]
A 100.0
/100.0
5
/5
ASM_HUMAN Sphingomyelin phosphodiesterase
5i85 I ZN
ZINC ION[1 atoms]
A 100.0
/100.0
4
/4
ASM_HUMAN Sphingomyelin phosphodiesterase
5i85 I ZN
ZINC ION[1 atoms]
A 100.0
/100.0
4
/4
ASM_HUMAN Sphingomyelin phosphodiesterase
5i85 I ZN
ZINC ION[1 atoms]
A 100.0
/100.0
4
/4
ASM_HUMAN Sphingomyelin phosphodiesterase
5i85 I ZN
ZINC ION[1 atoms]
A 100.0
/100.0
4
/4
ASM_HUMAN Sphingomyelin phosphodiesterase
5i8r Q ZN
ZINC ION[1 atoms]
A 100.0
/100.0
5
/5
ASM_HUMAN Sphingomyelin phosphodiesterase
5i8r R ZN
ZINC ION[1 atoms]
A 100.0
/100.0
4
/4
ASM_HUMAN Sphingomyelin phosphodiesterase
5i8r X ZN
ZINC ION[1 atoms]
B 100.0
/100.0
5
/5
ASM_HUMAN Sphingomyelin phosphodiesterase
5i8r Y ZN
ZINC ION[1 atoms]
B 100.0
/100.0
5
/5
ASM_HUMAN Sphingomyelin phosphodiesterase
5i8r DA ZN
ZINC ION[1 atoms]
C 100.0
/100.0
5
/5
ASM_HUMAN Sphingomyelin phosphodiesterase
5i8r EA ZN
ZINC ION[1 atoms]
C 100.0
/100.0
5
/5
ASM_HUMAN Sphingomyelin phosphodiesterase
5jg8 J ZN
ZINC ION[1 atoms]
A 100.0
/100.0
4
/4
ASM_HUMAN Sphingomyelin phosphodiesterase
5jg8 K ZN
ZINC ION[1 atoms]
A 100.0
/100.0
5
/5
ASM_HUMAN Sphingomyelin phosphodiesterase
5jg8 P ZN
ZINC ION[1 atoms]
B 100.0
/100.0
4
/4
ASM_HUMAN Sphingomyelin phosphodiesterase
5jg8 Q ZN
ZINC ION[1 atoms]
B 100.0
/100.0
5
/5
ASM_HUMAN Sphingomyelin phosphodiesterase
5kar E ZN
ZINC ION[1 atoms]
A 100.0
/33.2
5
/5
ASM3B_MOUSE Acid sphingomyelinase-like phosphodiesterase 3b
5kar F ZN
ZINC ION[1 atoms]
A 100.0
/33.2
5
/5
ASM3B_MOUSE Acid sphingomyelinase-like phosphodiesterase 3b
5kas E ZN
ZINC ION[1 atoms]
A 100.0
/33.2
5
/5
ASM3B_MOUSE Acid sphingomyelinase-like phosphodiesterase 3b
5kas F ZN
ZINC ION[1 atoms]
A 100.0
/33.2
4
/4
ASM3B_MOUSE Acid sphingomyelinase-like phosphodiesterase 3b
5kas G ZN
ZINC ION[1 atoms]
A 100.0
/33.2
3
/3
ASM3B_MOUSE Acid sphingomyelinase-like phosphodiesterase 3b
5kas H ZN
ZINC ION[1 atoms]
A 0.0
/33.2
1
/1
ASM3B_MOUSE Acid sphingomyelinase-like phosphodiesterase 3b
5kas I ZN
ZINC ION[1 atoms]
A 0.0
/33.2
2
/2
ASM3B_MOUSE Acid sphingomyelinase-like phosphodiesterase 3b
8w6p J ZN
ZINC ION[1 atoms]
A 100.0
/34.6
4
/4
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
8w6p K ZN
ZINC ION[1 atoms]
A 100.0
/34.6
4
/4
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
8w6p R ZN
ZINC ION[1 atoms]
B 100.0
/34.6
4
/4
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
8w6p S ZN
ZINC ION[1 atoms]
B 100.0
/34.6
5
/5
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
8w6r F ZN
ZINC ION[1 atoms]
A 100.0
/34.4
4
/4
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
8w6r G ZN
ZINC ION[1 atoms]
A 100.0
/34.4
4
/4
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
OTHERPOLY
631 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
5i81 D beta-D-mannopyranose-(1-3)-alpha-D-mannopyranose A 100.0
/100.0
3
/3
ASM_HUMAN Sphingomyelin phosphodiesterase
5i81 D beta-D-mannopyranose-(1-3)-alpha-D-mannopyranose A 100.0
/100.0
3
/3
ASM_HUMAN Sphingomyelin phosphodiesterase
5i85 C alpha-D-mannopyranose-(1-3)-alpha-D-mannopyranose-.. A 100.0
/100.0
7
/7
ASM_HUMAN Sphingomyelin phosphodiesterase
5i85 C alpha-D-mannopyranose-(1-3)-alpha-D-mannopyranose-.. A 100.0
/100.0
7
/7
ASM_HUMAN Sphingomyelin phosphodiesterase
5i85 C alpha-D-mannopyranose-(1-3)-alpha-D-mannopyranose-.. A 100.0
/100.0
7
/7
ASM_HUMAN Sphingomyelin phosphodiesterase
5i85 C alpha-D-mannopyranose-(1-3)-alpha-D-mannopyranose-.. A 100.0
/100.0
7
/7
ASM_HUMAN Sphingomyelin phosphodiesterase
5jg8 E 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-3)-2-a.. A 100.0
/100.0
4
/4
ASM_HUMAN Sphingomyelin phosphodiesterase
5jg8 F alpha-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-be.. B 100.0
/100.0
6
/6
ASM_HUMAN Sphingomyelin phosphodiesterase
5jg8 G alpha-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-be.. B 100.0
/100.0
5
/5
ASM_HUMAN Sphingomyelin phosphodiesterase
5fi9 K alpha-D-mannopyranose-(1-6)-beta-D-mannopyranose-(.. B 75.0
/88.4
4
/4
ASM_MOUSE Sphingomyelin phosphodiesterase
5fi9 F alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose.. A 75.0
/88.3
4
/4
ASM_MOUSE Sphingomyelin phosphodiesterase
5fib E alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose.. A 87.5
/88.4
8
/8
ASM_MOUSE Sphingomyelin phosphodiesterase
5fib H alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose.. B 90.0
/88.4
10
/10
ASM_MOUSE Sphingomyelin phosphodiesterase
5fi9 H beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. B 66.7
/88.4
6
/6
ASM_MOUSE Sphingomyelin phosphodiesterase
5fib G beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 100.0
/88.4
3
/3
ASM_MOUSE Sphingomyelin phosphodiesterase
5fib J alpha-D-mannopyranose-(1-3)-beta-D-mannopyranose-(.. B 100.0
/88.4
3
/3
ASM_MOUSE Sphingomyelin phosphodiesterase
5fcb E alpha-L-fucopyranose-(1-6)-2-acetamido-2-deoxy-bet.. A 0.0
/35.1
3
/3
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
8w6p D alpha-L-fucopyranose-(1-6)-2-acetamido-2-deoxy-bet.. A 0.0
/34.6
5
/5
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fic E beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 85.7
/88.4
7
/7
ASM_MOUSE Sphingomyelin phosphodiesterase
5fic I beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. D 83.3
/88.4
6
/6
ASM_MOUSE Sphingomyelin phosphodiesterase
5i81 C beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 100.0
/100.0
3
/3
ASM_HUMAN Sphingomyelin phosphodiesterase
5i81 C beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 100.0
/100.0
3
/3
ASM_HUMAN Sphingomyelin phosphodiesterase
5i85 B beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 100.0
/100.0
3
/3
ASM_HUMAN Sphingomyelin phosphodiesterase
5i85 B beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 100.0
/100.0
3
/3
ASM_HUMAN Sphingomyelin phosphodiesterase
5i85 B beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 100.0
/100.0
3
/3
ASM_HUMAN Sphingomyelin phosphodiesterase
5i85 B beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 100.0
/100.0
3
/3
ASM_HUMAN Sphingomyelin phosphodiesterase
5i8r H beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. B 100.0
/100.0
4
/4
ASM_HUMAN Sphingomyelin phosphodiesterase
8w6p F beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. B 40.0
/34.6
5
/5
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5ebe D 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 0.0
/34.6
3
/3
ASM3A_HUMAN Acid sphingomyelinase-like phosphodiesterase 3a
5fc1 C 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 0.0
/35.1
3
/3
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fc5 C 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 0.0
/35.1
3
/3
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fc6 C 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 0.0
/35.1
3
/3
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fc7 B 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 0.0
/35.1
3
/3
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fc7 D 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 33.3
/35.1
6
/6
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fca D 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 0.0
/35.1
3
/3
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fca H 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 0.0
/35.1
3
/3
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fi9 C 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 66.7
/88.3
3
/3
ASM_MOUSE Sphingomyelin phosphodiesterase
5fi9 E 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 83.3
/88.3
6
/6
ASM_MOUSE Sphingomyelin phosphodiesterase
5fi9 G 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/88.3
3
/3
ASM_MOUSE Sphingomyelin phosphodiesterase
5fi9 J 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 80.0
/88.4
5
/5
ASM_MOUSE Sphingomyelin phosphodiesterase
5fib F 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 80.0
/88.4
5
/5
ASM_MOUSE Sphingomyelin phosphodiesterase
5fic G 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 83.3
/88.4
6
/6
ASM_MOUSE Sphingomyelin phosphodiesterase
5fic H 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. C 83.3
/88.4
6
/6
ASM_MOUSE Sphingomyelin phosphodiesterase
5hqn C 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 66.7
/89.4
3
/3
ASM_MOUSE Sphingomyelin phosphodiesterase
5hqn E 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/89.4
4
/4
ASM_MOUSE Sphingomyelin phosphodiesterase
5hqn H 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 100.0
/89.4
5
/5
ASM_MOUSE Sphingomyelin phosphodiesterase
5i81 B 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/100.0
5
/5
ASM_HUMAN Sphingomyelin phosphodiesterase
5i81 B 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/100.0
5
/5
ASM_HUMAN Sphingomyelin phosphodiesterase
5i85 D 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/100.0
7
/7
ASM_HUMAN Sphingomyelin phosphodiesterase
5i85 D 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/100.0
7
/7
ASM_HUMAN Sphingomyelin phosphodiesterase
5i85 D 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/100.0
7
/7
ASM_HUMAN Sphingomyelin phosphodiesterase
5i85 D 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/100.0
7
/7
ASM_HUMAN Sphingomyelin phosphodiesterase
5i8r D 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/100.0
3
/3
ASM_HUMAN Sphingomyelin phosphodiesterase
5i8r E 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/100.0
2
/2
ASM_HUMAN Sphingomyelin phosphodiesterase
5i8r F 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 100.0
/100.0
3
/3
ASM_HUMAN Sphingomyelin phosphodiesterase
5i8r G 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 100.0
/100.0
2
/2
ASM_HUMAN Sphingomyelin phosphodiesterase
5i8r I 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. C 100.0
/100.0
5
/5
ASM_HUMAN Sphingomyelin phosphodiesterase
5jg8 C 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/100.0
5
/5
ASM_HUMAN Sphingomyelin phosphodiesterase
5jg8 D 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/100.0
3
/3
ASM_HUMAN Sphingomyelin phosphodiesterase
5jg8 H 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 100.0
/100.0
2
/2
ASM_HUMAN Sphingomyelin phosphodiesterase
5jg8 I 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 100.0
/100.0
3
/3
ASM_HUMAN Sphingomyelin phosphodiesterase
5kar B 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 0.0
/33.2
3
/3
ASM3B_MOUSE Acid sphingomyelinase-like phosphodiesterase 3b
5kas B 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 0.0
/33.2
3
/3
ASM3B_MOUSE Acid sphingomyelinase-like phosphodiesterase 3b
8w6p C 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 0.0
/34.6
4
/4
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
8w6p E 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 40.0
/34.6
5
/5
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
8w6p C 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 20.0
/34.6
5
/5
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
8w6p E 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 0.0
/34.6
1
/1
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
8w6r B 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 40.0
/34.4
5
/5
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fc1 B 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[al.. A 50.0
/35.1
2
/2
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fc1 E 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[al.. A 0.0
/35.1
2
/2
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fc5 B 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[al.. A 33.3
/35.1
3
/3
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fc5 E 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[al.. A 0.0
/35.1
2
/2
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fc6 B 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[al.. A 50.0
/35.1
2
/2
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fc6 E 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[al.. A 0.0
/35.1
3
/3
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fc7 C 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[al.. A 0.0
/35.1
4
/4
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fca C 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[al.. A 33.3
/35.1
3
/3
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fca F 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[al.. A 0.0
/35.1
3
/3
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fca G 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[al.. B 33.3
/35.1
3
/3
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fca J 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[al.. B 0.0
/35.1
2
/2
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fcb B 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[al.. A 33.3
/35.1
3
/3
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fcb C 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[al.. A 0.0
/35.1
6
/6
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fi9 D 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[al.. A 100.0
/88.3
8
/8
ASM_MOUSE Sphingomyelin phosphodiesterase
5fi9 I 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[al.. B 100.0
/88.4
4
/4
ASM_MOUSE Sphingomyelin phosphodiesterase
5fib C 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[al.. A 33.3
/88.4
3
/3
ASM_MOUSE Sphingomyelin phosphodiesterase
5fib D 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[al.. A 85.7
/88.4
7
/7
ASM_MOUSE Sphingomyelin phosphodiesterase
5fic F 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[al.. A 100.0
/88.4
6
/6
ASM_MOUSE Sphingomyelin phosphodiesterase
5fic J 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[al.. D 100.0
/88.4
4
/4
ASM_MOUSE Sphingomyelin phosphodiesterase
5hqn D 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[al.. A 100.0
/89.4
5
/5
ASM_MOUSE Sphingomyelin phosphodiesterase
5hqn F 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[al.. B 66.7
/89.4
3
/3
ASM_MOUSE Sphingomyelin phosphodiesterase
5hqn G 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[al.. B 100.0
/89.4
6
/6
ASM_MOUSE Sphingomyelin phosphodiesterase
5kar D 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[al.. A 16.7
/33.2
6
/6
ASM3B_MOUSE Acid sphingomyelinase-like phosphodiesterase 3b
5kas D 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[al.. A 16.7
/33.2
6
/6
ASM3B_MOUSE Acid sphingomyelinase-like phosphodiesterase 3b
5fc1 D alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose.. A 40.0
/35.1
5
/5
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fc5 D alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose.. A 40.0
/35.1
5
/5
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fc6 D alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose.. A 40.0
/35.1
5
/5
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fca E alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose.. A 40.0
/35.1
5
/5
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fca I alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose.. B 40.0
/35.1
5
/5
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fcb D alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose.. A 40.0
/35.1
5
/5
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fib I alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose.. B 83.3
/88.4
6
/6
ASM_MOUSE Sphingomyelin phosphodiesterase
5kar C alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose.. A 28.6
/33.2
7
/7
ASM3B_MOUSE Acid sphingomyelinase-like phosphodiesterase 3b
5kas C alpha-D-mannopyranose-(1-3)-beta-D-mannopyranose-(.. A 33.3
/33.2
6
/6
ASM3B_MOUSE Acid sphingomyelinase-like phosphodiesterase 3b
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
HOMO
631 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
5i81 A ASM_HUMAN Sphingomyelin phosphodiesterase[528 aa] A 100.0
/100.0
28
/28
ASM_HUMAN Sphingomyelin phosphodiesterase
5i81 A ASM_HUMAN Sphingomyelin phosphodiesterase[528 aa] A 100.0
/100.0
28
/28
ASM_HUMAN Sphingomyelin phosphodiesterase
5i85 A ASM_HUMAN Sphingomyelin phosphodiesterase[528 aa] A 100.0
/100.0
9
/9
ASM_HUMAN Sphingomyelin phosphodiesterase
5i85 A ASM_HUMAN Sphingomyelin phosphodiesterase[528 aa] A 100.0
/100.0
11
/11
ASM_HUMAN Sphingomyelin phosphodiesterase
5i85 A ASM_HUMAN Sphingomyelin phosphodiesterase[528 aa] A 100.0
/100.0
11
/11
ASM_HUMAN Sphingomyelin phosphodiesterase
5i85 A ASM_HUMAN Sphingomyelin phosphodiesterase[528 aa] A 100.0
/100.0
9
/9
ASM_HUMAN Sphingomyelin phosphodiesterase
5i85 A ASM_HUMAN Sphingomyelin phosphodiesterase[528 aa] A 100.0
/100.0
9
/9
ASM_HUMAN Sphingomyelin phosphodiesterase
5i85 A ASM_HUMAN Sphingomyelin phosphodiesterase[528 aa] A 100.0
/100.0
11
/11
ASM_HUMAN Sphingomyelin phosphodiesterase
5i85 A ASM_HUMAN Sphingomyelin phosphodiesterase[528 aa] A 100.0
/100.0
11
/11
ASM_HUMAN Sphingomyelin phosphodiesterase
5i85 A ASM_HUMAN Sphingomyelin phosphodiesterase[528 aa] A 100.0
/100.0
9
/9
ASM_HUMAN Sphingomyelin phosphodiesterase
5jg8 B ASM_HUMAN Sphingomyelin phosphodiesterase[530 aa] A 100.0
/100.0
29
/29
ASM_HUMAN Sphingomyelin phosphodiesterase
5jg8 A ASM_HUMAN Sphingomyelin phosphodiesterase[529 aa] B 100.0
/100.0
25
/25
ASM_HUMAN Sphingomyelin phosphodiesterase
8w6p B ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a[41.. A 33.3
/34.6
9
/9
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
8w6p A ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a[41.. B 27.3
/34.6
11
/14
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
631 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
5jg8 L ACT
ACETATE ION[4 atoms]
A 100.0
/100.0
7
/7
ASM_HUMAN Sphingomyelin phosphodiesterase
5jg8 R ACT
ACETATE ION[4 atoms]
B 100.0
/100.0
9
/9
ASM_HUMAN Sphingomyelin phosphodiesterase
5ebb I MLI
MALONATE ION[7 atoms]
A 90.0
/34.6
10
/10
ASM3A_HUMAN Acid sphingomyelinase-like phosphodiesterase 3a
5ebb O MLI
MALONATE ION[7 atoms]
B 90.0
/34.6
10
/10
ASM3A_HUMAN Acid sphingomyelinase-like phosphodiesterase 3a
5ebb V MLI
MALONATE ION[7 atoms]
C 90.0
/34.6
10
/10
ASM3A_HUMAN Acid sphingomyelinase-like phosphodiesterase 3a
5ebe S MLI
MALONATE ION[7 atoms]
B 0.0
/34.6
3
/3
ASM3A_HUMAN Acid sphingomyelinase-like phosphodiesterase 3a
5ebe BA SCN
THIOCYANATE ION[3 atoms]
C 0.0
/34.6
1
/1
ASM3A_HUMAN Acid sphingomyelinase-like phosphodiesterase 3a
5ebe CA SCN
THIOCYANATE ION[3 atoms]
C 0.0
/34.6
2
/2
ASM3A_HUMAN Acid sphingomyelinase-like phosphodiesterase 3a
5fic M PO4
PHOSPHATE ION[5 atoms]
A 100.0
/88.4
8
/8
ASM_MOUSE Sphingomyelin phosphodiesterase
5fic N PO4
PHOSPHATE ION[5 atoms]
A 100.0
/88.4
4
/4
ASM_MOUSE Sphingomyelin phosphodiesterase
5fic O PO4
PHOSPHATE ION[5 atoms]
A 100.0
/88.4
6
/6
ASM_MOUSE Sphingomyelin phosphodiesterase
5fic V PO4
PHOSPHATE ION[5 atoms]
B 100.0
/88.4
7
/7
ASM_MOUSE Sphingomyelin phosphodiesterase
5fic W PO4
PHOSPHATE ION[5 atoms]
B 100.0
/88.4
2
/2
ASM_MOUSE Sphingomyelin phosphodiesterase
5fic BA PO4
PHOSPHATE ION[5 atoms]
C 100.0
/88.4
8
/8
ASM_MOUSE Sphingomyelin phosphodiesterase
5fic FA PO4
PHOSPHATE ION[5 atoms]
D 100.0
/88.4
9
/9
ASM_MOUSE Sphingomyelin phosphodiesterase
5hqn K PO4
PHOSPHATE ION[5 atoms]
A 100.0
/89.4
9
/9
ASM_MOUSE Sphingomyelin phosphodiesterase
5hqn O PO4
PHOSPHATE ION[5 atoms]
B 100.0
/89.4
8
/8
ASM_MOUSE Sphingomyelin phosphodiesterase
8w6p Q PO4
PHOSPHATE ION[5 atoms]
B 100.0
/34.6
7
/7
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fc1 I SO4
SULFATE ION[5 atoms]
A 100.0
/35.1
7
/7
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fc7 I SO4
SULFATE ION[5 atoms]
A 100.0
/35.1
7
/7
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fc7 J SO4
SULFATE ION[5 atoms]
A 0.0
/35.1
2
/2
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fc7 K SO4
SULFATE ION[5 atoms]
A 25.0
/35.1
4
/4
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fc7 L SO4
SULFATE ION[5 atoms]
A 100.0
/35.1
2
/3
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fc7 M SO4
SULFATE ION[5 atoms]
A 66.7
/35.1
3
/3
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fc7 N SO4
SULFATE ION[5 atoms]
A 0.0
/35.1
3
/3
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fib N SO4
SULFATE ION[5 atoms]
A 100.0
/88.4
2
/2
ASM_MOUSE Sphingomyelin phosphodiesterase
5fib O SO4
SULFATE ION[5 atoms]
A 100.0
/88.4
1
/1
ASM_MOUSE Sphingomyelin phosphodiesterase
5fib P SO4
SULFATE ION[5 atoms]
A 100.0
/88.4
3
/3
ASM_MOUSE Sphingomyelin phosphodiesterase
5fib Q SO4
SULFATE ION[5 atoms]
A 100.0
/88.4
5
/5
ASM_MOUSE Sphingomyelin phosphodiesterase
5fib R SO4
SULFATE ION[5 atoms]
A 100.0
/88.4
6
/6
ASM_MOUSE Sphingomyelin phosphodiesterase
5fib S SO4
SULFATE ION[5 atoms]
A 100.0
/88.4
2
/2
ASM_MOUSE Sphingomyelin phosphodiesterase
5fib T SO4
SULFATE ION[5 atoms]
A 66.7
/88.4
3
/3
ASM_MOUSE Sphingomyelin phosphodiesterase
5fib U SO4
SULFATE ION[5 atoms]
A 83.3
/88.4
6
/6
ASM_MOUSE Sphingomyelin phosphodiesterase
5fib V SO4
SULFATE ION[5 atoms]
A 100.0
/88.4
4
/4
ASM_MOUSE Sphingomyelin phosphodiesterase
5fib W SO4
SULFATE ION[5 atoms]
A 100.0
/88.4
3
/3
ASM_MOUSE Sphingomyelin phosphodiesterase
5fib BA SO4
SULFATE ION[5 atoms]
B 100.0
/88.4
3
/3
ASM_MOUSE Sphingomyelin phosphodiesterase
5fib CA SO4
SULFATE ION[5 atoms]
B 100.0
/88.4
4
/4
ASM_MOUSE Sphingomyelin phosphodiesterase
5fib DA SO4
SULFATE ION[5 atoms]
B 100.0
/88.4
6
/6
ASM_MOUSE Sphingomyelin phosphodiesterase
5fib EA SO4
SULFATE ION[5 atoms]
B 100.0
/88.4
3
/3
ASM_MOUSE Sphingomyelin phosphodiesterase
5fib FA SO4
SULFATE ION[5 atoms]
B 66.7
/88.4
3
/3
ASM_MOUSE Sphingomyelin phosphodiesterase
5fib GA SO4
SULFATE ION[5 atoms]
B 100.0
/88.4
5
/5
ASM_MOUSE Sphingomyelin phosphodiesterase
5fib HA SO4
SULFATE ION[5 atoms]
B 100.0
/88.4
5
/5
ASM_MOUSE Sphingomyelin phosphodiesterase
5i81 N SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
2
/2
ASM_HUMAN Sphingomyelin phosphodiesterase
5i81 N SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
2
/2
ASM_HUMAN Sphingomyelin phosphodiesterase
5i81 O SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
2
/2
ASM_HUMAN Sphingomyelin phosphodiesterase
5i81 O SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
2
/2
ASM_HUMAN Sphingomyelin phosphodiesterase
5i81 O SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
2
/2
ASM_HUMAN Sphingomyelin phosphodiesterase
5i81 O SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
2
/2
ASM_HUMAN Sphingomyelin phosphodiesterase
5i81 P SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
3
/3
ASM_HUMAN Sphingomyelin phosphodiesterase
5i81 P SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
3
/3
ASM_HUMAN Sphingomyelin phosphodiesterase
5i81 Q SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
2
/2
ASM_HUMAN Sphingomyelin phosphodiesterase
5i81 Q SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
2
/2
ASM_HUMAN Sphingomyelin phosphodiesterase
5i81 R SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
5
/5
ASM_HUMAN Sphingomyelin phosphodiesterase
5i81 R SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
5
/5
ASM_HUMAN Sphingomyelin phosphodiesterase
5i81 S SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
2
/2
ASM_HUMAN Sphingomyelin phosphodiesterase
5i81 S SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
2
/2
ASM_HUMAN Sphingomyelin phosphodiesterase
5i81 T SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
6
/6
ASM_HUMAN Sphingomyelin phosphodiesterase
5i81 T SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
6
/6
ASM_HUMAN Sphingomyelin phosphodiesterase
5i81 U SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
3
/3
ASM_HUMAN Sphingomyelin phosphodiesterase
5i81 U SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
3
/3
ASM_HUMAN Sphingomyelin phosphodiesterase
5i81 V SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
3
/3
ASM_HUMAN Sphingomyelin phosphodiesterase
5i81 V SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
3
/3
ASM_HUMAN Sphingomyelin phosphodiesterase
5i81 W SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
4
/4
ASM_HUMAN Sphingomyelin phosphodiesterase
5i81 W SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
4
/4
ASM_HUMAN Sphingomyelin phosphodiesterase
5i81 X SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
2
/2
ASM_HUMAN Sphingomyelin phosphodiesterase
5i81 X SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
2
/2
ASM_HUMAN Sphingomyelin phosphodiesterase
5i85 J SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
2
/2
ASM_HUMAN Sphingomyelin phosphodiesterase
5i85 J SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
2
/2
ASM_HUMAN Sphingomyelin phosphodiesterase
5i85 J SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
2
/2
ASM_HUMAN Sphingomyelin phosphodiesterase
5i85 J SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
2
/2
ASM_HUMAN Sphingomyelin phosphodiesterase
5i85 K SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
2
/2
ASM_HUMAN Sphingomyelin phosphodiesterase
5i85 K SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
2
/2
ASM_HUMAN Sphingomyelin phosphodiesterase
5i85 K SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
2
/2
ASM_HUMAN Sphingomyelin phosphodiesterase
5i85 K SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
2
/2
ASM_HUMAN Sphingomyelin phosphodiesterase
5i85 L SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
3
/3
ASM_HUMAN Sphingomyelin phosphodiesterase
5i85 L SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
3
/3
ASM_HUMAN Sphingomyelin phosphodiesterase
5i85 L SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
3
/3
ASM_HUMAN Sphingomyelin phosphodiesterase
5i85 L SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
3
/3
ASM_HUMAN Sphingomyelin phosphodiesterase
5i85 M SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
2
/2
ASM_HUMAN Sphingomyelin phosphodiesterase
5i85 M SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
2
/2
ASM_HUMAN Sphingomyelin phosphodiesterase
5i85 M SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
2
/2
ASM_HUMAN Sphingomyelin phosphodiesterase
5i85 M SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
2
/2
ASM_HUMAN Sphingomyelin phosphodiesterase
5i85 N SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
4
/4
ASM_HUMAN Sphingomyelin phosphodiesterase
5i85 N SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
4
/4
ASM_HUMAN Sphingomyelin phosphodiesterase
5i85 N SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
4
/4
ASM_HUMAN Sphingomyelin phosphodiesterase
5i85 N SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
4
/4
ASM_HUMAN Sphingomyelin phosphodiesterase
5i85 O SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
6
/6
ASM_HUMAN Sphingomyelin phosphodiesterase
5i85 O SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
6
/6
ASM_HUMAN Sphingomyelin phosphodiesterase
5i85 O SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
6
/6
ASM_HUMAN Sphingomyelin phosphodiesterase
5i85 O SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
6
/6
ASM_HUMAN Sphingomyelin phosphodiesterase
5i85 P SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
3
/3
ASM_HUMAN Sphingomyelin phosphodiesterase
5i85 P SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
2
/2
ASM_HUMAN Sphingomyelin phosphodiesterase
5i85 P SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
3
/3
ASM_HUMAN Sphingomyelin phosphodiesterase
5i85 P SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
2
/2
ASM_HUMAN Sphingomyelin phosphodiesterase
5i85 P SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
2
/2
ASM_HUMAN Sphingomyelin phosphodiesterase
5i85 P SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
3
/3
ASM_HUMAN Sphingomyelin phosphodiesterase
5i85 P SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
2
/2
ASM_HUMAN Sphingomyelin phosphodiesterase
5i85 P SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
3
/3
ASM_HUMAN Sphingomyelin phosphodiesterase
5i85 Q SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
4
/4
ASM_HUMAN Sphingomyelin phosphodiesterase
5i85 Q SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
4
/4
ASM_HUMAN Sphingomyelin phosphodiesterase
5i85 Q SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
4
/4
ASM_HUMAN Sphingomyelin phosphodiesterase
5i85 Q SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
4
/4
ASM_HUMAN Sphingomyelin phosphodiesterase
5i85 R SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
2
/2
ASM_HUMAN Sphingomyelin phosphodiesterase
5i85 R SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
2
/2
ASM_HUMAN Sphingomyelin phosphodiesterase
5i85 R SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
2
/2
ASM_HUMAN Sphingomyelin phosphodiesterase
5i85 R SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
2
/2
ASM_HUMAN Sphingomyelin phosphodiesterase
5i85 S SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
1
/1
ASM_HUMAN Sphingomyelin phosphodiesterase
5i85 S SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
1
/1
ASM_HUMAN Sphingomyelin phosphodiesterase
5i85 S SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
1
/1
ASM_HUMAN Sphingomyelin phosphodiesterase
5i85 S SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
1
/1
ASM_HUMAN Sphingomyelin phosphodiesterase
5i85 T SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
3
/3
ASM_HUMAN Sphingomyelin phosphodiesterase
5i85 T SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
3
/3
ASM_HUMAN Sphingomyelin phosphodiesterase
5i85 T SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
3
/3
ASM_HUMAN Sphingomyelin phosphodiesterase
5i85 T SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
3
/3
ASM_HUMAN Sphingomyelin phosphodiesterase
8w6r H SO4
SULFATE ION[5 atoms]
A 100.0
/34.4
7
/7
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5ebb W GOL
GLYCEROL[6 atoms]
C 0.0
/34.6
1
/1
ASM3A_HUMAN Acid sphingomyelinase-like phosphodiesterase 3a
5ebe R GOL
GLYCEROL[6 atoms]
B 100.0
/34.6
1
/1
ASM3A_HUMAN Acid sphingomyelinase-like phosphodiesterase 3a
5fc1 J GOL
GLYCEROL[6 atoms]
A 0.0
/35.1
5
/6
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fc1 L GOL
GLYCEROL[6 atoms]
A 33.3
/35.1
6
/7
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fc1 M GOL
GLYCEROL[6 atoms]
A 0.0
/35.1
3
/3
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fc1 N GOL
GLYCEROL[6 atoms]
A 66.7
/35.1
6
/7
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fc1 O GOL
GLYCEROL[6 atoms]
A 16.7
/35.1
6
/6
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fc1 P GOL
GLYCEROL[6 atoms]
A 0.0
/35.1
1
/1
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fc1 Q GOL
GLYCEROL[6 atoms]
A 33.3
/35.1
3
/4
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fc1 R GOL
GLYCEROL[6 atoms]
A 50.0
/35.1
4
/4
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fc1 S GOL
GLYCEROL[6 atoms]
A 33.3
/35.1
6
/7
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fc1 T GOL
GLYCEROL[6 atoms]
A 0.0
/35.1
2
/2
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fc1 U GOL
GLYCEROL[6 atoms]
A 0.0
/35.1
4
/4
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fc5 I GOL
GLYCEROL[6 atoms]
A 33.3
/35.1
6
/7
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fc5 K GOL
GLYCEROL[6 atoms]
A 0.0
/35.1
4
/4
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fc5 L GOL
GLYCEROL[6 atoms]
A 25.0
/35.1
4
/5
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fc5 M GOL
GLYCEROL[6 atoms]
A 0.0
/35.1
2
/2
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fc5 O GOL
GLYCEROL[6 atoms]
A 50.0
/35.1
4
/4
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fc6 H GOL
GLYCEROL[6 atoms]
A 20.0
/35.1
5
/5
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fc6 I GOL
GLYCEROL[6 atoms]
A 0.0
/35.1
6
/7
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fc6 J GOL
GLYCEROL[6 atoms]
A 25.0
/35.1
4
/4
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fc6 K GOL
GLYCEROL[6 atoms]
A 40.0
/35.1
5
/6
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fc7 O GOL
GLYCEROL[6 atoms]
A 0.0
/35.1
2
/2
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fc7 P GOL
GLYCEROL[6 atoms]
A 0.0
/35.1
4
/5
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fc7 Q GOL
GLYCEROL[6 atoms]
A 16.7
/35.1
6
/7
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fca O GOL
GLYCEROL[6 atoms]
A 20.0
/35.1
5
/5
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fca P GOL
GLYCEROL[6 atoms]
A 0.0
/35.1
1
/1
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fca Q GOL
GLYCEROL[6 atoms]
A 50.0
/35.1
4
/5
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fca R GOL
GLYCEROL[6 atoms]
A 80.0
/35.1
5
/5
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fca S GOL
GLYCEROL[6 atoms]
A 0.0
/35.1
5
/6
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fca T GOL
GLYCEROL[6 atoms]
A 40.0
/35.1
5
/5
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fca AA GOL
GLYCEROL[6 atoms]
B 60.0
/35.1
5
/5
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fca BA GOL
GLYCEROL[6 atoms]
B 16.7
/35.1
6
/7
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fca CA GOL
GLYCEROL[6 atoms]
B 66.7
/35.1
6
/7
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fca DA GOL
GLYCEROL[6 atoms]
B 0.0
/35.1
3
/3
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fca EA GOL
GLYCEROL[6 atoms]
B 0.0
/35.1
4
/5
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fca Y GOL
GLYCEROL[6 atoms]
B 20.0
/35.1
5
/5
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fca Z GOL
GLYCEROL[6 atoms]
B 50.0
/35.1
4
/5
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fcb I GOL
GLYCEROL[6 atoms]
A 20.0
/35.1
5
/5
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fcb J GOL
GLYCEROL[6 atoms]
A 40.0
/35.1
5
/7
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fcb K GOL
GLYCEROL[6 atoms]
A 0.0
/35.1
5
/6
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fcb L GOL
GLYCEROL[6 atoms]
A 25.0
/35.1
4
/4
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fcb M GOL
GLYCEROL[6 atoms]
A 33.3
/35.1
3
/4
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fcb N GOL
GLYCEROL[6 atoms]
A 50.0
/35.1
2
/2
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fcb O GOL
GLYCEROL[6 atoms]
A 16.7
/35.1
6
/6
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fcb P GOL
GLYCEROL[6 atoms]
A 0.0
/35.1
2
/2
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fcb Q GOL
GLYCEROL[6 atoms]
A 25.0
/35.1
4
/4
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fcb R GOL
GLYCEROL[6 atoms]
A 100.0
/35.1
3
/3
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5kar I GOL
GLYCEROL[6 atoms]
A 50.0
/33.2
6
/7
ASM3B_MOUSE Acid sphingomyelinase-like phosphodiesterase 3b
5kar G NO3
NITRATE ION[4 atoms]
A 50.0
/33.2
4
/4
ASM3B_MOUSE Acid sphingomyelinase-like phosphodiesterase 3b
5kar H NO3
NITRATE ION[4 atoms]
A 0.0
/33.2
6
/6
ASM3B_MOUSE Acid sphingomyelinase-like phosphodiesterase 3b
5kas J NO3
NITRATE ION[4 atoms]
A 50.0
/33.2
4
/4
ASM3B_MOUSE Acid sphingomyelinase-like phosphodiesterase 3b
5kas K NO3
NITRATE ION[4 atoms]
A 0.0
/33.2
6
/6
ASM3B_MOUSE Acid sphingomyelinase-like phosphodiesterase 3b
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.