[Multiple Alignment(many alignments)] [Alignment Bar(many alignments)] [show plain BLAST file]
BLASTP 2.11.0+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: unitmol_20240403.fasta
           829,018 sequences; 237,935,689 total letters



Query= sp|P17405|ASM_HUMAN Sphingomyelin phosphodiesterase OS=Homo sapiens
OX=9606 GN=SMPD1 PE=1 SV=5

Length=631
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

5jg8_B B Sphingomyelin phosphodiesterase                              1092    0.0  
5jg8_A A Sphingomyelin phosphodiesterase                              1090    0.0  
5i8r_B B Sphingomyelin phosphodiesterase                              1087    0.0  
5i81_A A Sphingomyelin phosphodiesterase                              1087    0.0  
5i85_A A Sphingomyelin phosphodiesterase                              1087    0.0  
5i8r_A A Sphingomyelin phosphodiesterase                              1087    0.0  
5i8r_C C Sphingomyelin phosphodiesterase                              1087    0.0  
5fic_B B Sphingomyelin phosphodiesterase                              933     0.0  
5fic_A A Sphingomyelin phosphodiesterase                              933     0.0  
5fic_C C Sphingomyelin phosphodiesterase                              933     0.0  
5fic_D D Sphingomyelin phosphodiesterase                              933     0.0  
5fi9_B B Sphingomyelin phosphodiesterase                              932     0.0  
5fib_B B Sphingomyelin phosphodiesterase                              931     0.0  
5fib_A A Sphingomyelin phosphodiesterase                              931     0.0  
5fi9_A A Sphingomyelin phosphodiesterase                              916     0.0  
5hqn_A A Sphingomyelin phosphodiesterase                              785     0.0  
5hqn_B B Sphingomyelin phosphodiesterase                              785     0.0  
5fc5_A A Acid sphingomyelinase-like phosphodiesterase 3a              181     2e-49
5fca_A A Acid sphingomyelinase-like phosphodiesterase 3a              181     2e-49
5fc6_A A Acid sphingomyelinase-like phosphodiesterase 3a              181     2e-49
5fcb_A A Acid sphingomyelinase-like phosphodiesterase 3a              181     2e-49
5fca_B B Acid sphingomyelinase-like phosphodiesterase 3a              181     2e-49
5fc1_A A Acid sphingomyelinase-like phosphodiesterase 3a              181     2e-49
5fc7_A A Acid sphingomyelinase-like phosphodiesterase 3a              180     6e-49
8w6p_A A Acid sphingomyelinase-like phosphodiesterase 3a              178     2e-48
8w6p_B B Acid sphingomyelinase-like phosphodiesterase 3a              178     2e-48
8w6r_A A Acid sphingomyelinase-like phosphodiesterase 3a              177     3e-48
5ebb_B B Acid sphingomyelinase-like phosphodiesterase 3a              177     5e-48
5ebb_C C Acid sphingomyelinase-like phosphodiesterase 3a              177     5e-48
5ebb_A A Acid sphingomyelinase-like phosphodiesterase 3a              177     5e-48
5ebe_B B Acid sphingomyelinase-like phosphodiesterase 3a              177     5e-48
5ebe_C C Acid sphingomyelinase-like phosphodiesterase 3a              177     5e-48
5ebe_A A Acid sphingomyelinase-like phosphodiesterase 3a              176     7e-48
5kas_A A Acid sphingomyelinase-like phosphodiesterase 3b              173     2e-46
5kar_A A Acid sphingomyelinase-like phosphodiesterase 3b              173     2e-46


>5jg8_B B Sphingomyelin phosphodiesterase
Length=586 Score = 1092 bits (2824), Expect = 0.0, Method: Compositional matrix adjust. Identities = 530/530 (100%), Positives = 530/530 (100%), Gaps = 0/530 (0%) Query 84 FGWGNLTCPICKGLFTAINLGLKKEPNVARVGSVAIKLCNLLKIAPPAVCQSIVHLFEDD 143 FGWGNLTCPICKGLFTAINLGLKKEPNVARVGSVAIKLCNLLKIAPPAVCQSIVHLFEDD Sbjct 39 FGWGNLTCPICKGLFTAINLGLKKEPNVARVGSVAIKLCNLLKIAPPAVCQSIVHLFEDD 98 Query 144 MVEVWRRSVLSPSEACGLLLGSTCGHWDIFSSWNISLPTVPKPPPKPPSPPAPGAPVSRI 203 MVEVWRRSVLSPSEACGLLLGSTCGHWDIFSSWNISLPTVPKPPPKPPSPPAPGAPVSRI Sbjct 99 MVEVWRRSVLSPSEACGLLLGSTCGHWDIFSSWNISLPTVPKPPPKPPSPPAPGAPVSRI 158 Query 204 LFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGEYSKCDLPLRTLESLL 263 LFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGEYSKCDLPLRTLESLL Sbjct 159 LFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGEYSKCDLPLRTLESLL 218 Query 264 SGLGPAGPFDMVYWTGDIPAHDVWHQTRQDQLRALTTVTALVRKFLGPVPVYPAVGNHES 323 SGLGPAGPFDMVYWTGDIPAHDVWHQTRQDQLRALTTVTALVRKFLGPVPVYPAVGNHES Sbjct 219 SGLGPAGPFDMVYWTGDIPAHDVWHQTRQDQLRALTTVTALVRKFLGPVPVYPAVGNHES 278 Query 324 TPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGGFYALSPYPGLRLISLN 383 TPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGGFYALSPYPGLRLISLN Sbjct 279 TPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGGFYALSPYPGLRLISLN 338 Query 384 MNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGDKVHIIGHIPPGHCLKSWSWNYYR 443 MNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGDKVHIIGHIPPGHCLKSWSWNYYR Sbjct 339 MNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGDKVHIIGHIPPGHCLKSWSWNYYR 398 Query 444 IVARYENTLAAQFFGHTHVDEFEVFYDEETLSRPLAVAFLAPSATTYIGLNPGYRVYQID 503 IVARYENTLAAQFFGHTHVDEFEVFYDEETLSRPLAVAFLAPSATTYIGLNPGYRVYQID Sbjct 399 IVARYENTLAAQFFGHTHVDEFEVFYDEETLSRPLAVAFLAPSATTYIGLNPGYRVYQID 458 Query 504 GNYSGSSHVVLDHETYILNLTQANIPGAIPHWQLLYRARETYGLPNTLPTAWHNLVYRMR 563 GNYSGSSHVVLDHETYILNLTQANIPGAIPHWQLLYRARETYGLPNTLPTAWHNLVYRMR Sbjct 459 GNYSGSSHVVLDHETYILNLTQANIPGAIPHWQLLYRARETYGLPNTLPTAWHNLVYRMR 518 Query 564 GDMQLFQTFWFLYHKGHPPSEPCGTPCRLATLCAQLSARADSPALCRHLM 613 GDMQLFQTFWFLYHKGHPPSEPCGTPCRLATLCAQLSARADSPALCRHLM Sbjct 519 GDMQLFQTFWFLYHKGHPPSEPCGTPCRLATLCAQLSARADSPALCRHLM 568
>5jg8_A A Sphingomyelin phosphodiesterase
Length=586 Score = 1090 bits (2819), Expect = 0.0, Method: Compositional matrix adjust. Identities = 529/529 (100%), Positives = 529/529 (100%), Gaps = 0/529 (0%) Query 85 GWGNLTCPICKGLFTAINLGLKKEPNVARVGSVAIKLCNLLKIAPPAVCQSIVHLFEDDM 144 GWGNLTCPICKGLFTAINLGLKKEPNVARVGSVAIKLCNLLKIAPPAVCQSIVHLFEDDM Sbjct 40 GWGNLTCPICKGLFTAINLGLKKEPNVARVGSVAIKLCNLLKIAPPAVCQSIVHLFEDDM 99 Query 145 VEVWRRSVLSPSEACGLLLGSTCGHWDIFSSWNISLPTVPKPPPKPPSPPAPGAPVSRIL 204 VEVWRRSVLSPSEACGLLLGSTCGHWDIFSSWNISLPTVPKPPPKPPSPPAPGAPVSRIL Sbjct 100 VEVWRRSVLSPSEACGLLLGSTCGHWDIFSSWNISLPTVPKPPPKPPSPPAPGAPVSRIL 159 Query 205 FLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGEYSKCDLPLRTLESLLS 264 FLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGEYSKCDLPLRTLESLLS Sbjct 160 FLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGEYSKCDLPLRTLESLLS 219 Query 265 GLGPAGPFDMVYWTGDIPAHDVWHQTRQDQLRALTTVTALVRKFLGPVPVYPAVGNHEST 324 GLGPAGPFDMVYWTGDIPAHDVWHQTRQDQLRALTTVTALVRKFLGPVPVYPAVGNHEST Sbjct 220 GLGPAGPFDMVYWTGDIPAHDVWHQTRQDQLRALTTVTALVRKFLGPVPVYPAVGNHEST 279 Query 325 PVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGGFYALSPYPGLRLISLNM 384 PVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGGFYALSPYPGLRLISLNM Sbjct 280 PVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGGFYALSPYPGLRLISLNM 339 Query 385 NFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGDKVHIIGHIPPGHCLKSWSWNYYRI 444 NFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGDKVHIIGHIPPGHCLKSWSWNYYRI Sbjct 340 NFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGDKVHIIGHIPPGHCLKSWSWNYYRI 399 Query 445 VARYENTLAAQFFGHTHVDEFEVFYDEETLSRPLAVAFLAPSATTYIGLNPGYRVYQIDG 504 VARYENTLAAQFFGHTHVDEFEVFYDEETLSRPLAVAFLAPSATTYIGLNPGYRVYQIDG Sbjct 400 VARYENTLAAQFFGHTHVDEFEVFYDEETLSRPLAVAFLAPSATTYIGLNPGYRVYQIDG 459 Query 505 NYSGSSHVVLDHETYILNLTQANIPGAIPHWQLLYRARETYGLPNTLPTAWHNLVYRMRG 564 NYSGSSHVVLDHETYILNLTQANIPGAIPHWQLLYRARETYGLPNTLPTAWHNLVYRMRG Sbjct 460 NYSGSSHVVLDHETYILNLTQANIPGAIPHWQLLYRARETYGLPNTLPTAWHNLVYRMRG 519 Query 565 DMQLFQTFWFLYHKGHPPSEPCGTPCRLATLCAQLSARADSPALCRHLM 613 DMQLFQTFWFLYHKGHPPSEPCGTPCRLATLCAQLSARADSPALCRHLM Sbjct 520 DMQLFQTFWFLYHKGHPPSEPCGTPCRLATLCAQLSARADSPALCRHLM 568
>5i8r_B B Sphingomyelin phosphodiesterase
Length=583 Score = 1087 bits (2812), Expect = 0.0, Method: Compositional matrix adjust. Identities = 528/528 (100%), Positives = 528/528 (100%), Gaps = 0/528 (0%) Query 86 WGNLTCPICKGLFTAINLGLKKEPNVARVGSVAIKLCNLLKIAPPAVCQSIVHLFEDDMV 145 WGNLTCPICKGLFTAINLGLKKEPNVARVGSVAIKLCNLLKIAPPAVCQSIVHLFEDDMV Sbjct 38 WGNLTCPICKGLFTAINLGLKKEPNVARVGSVAIKLCNLLKIAPPAVCQSIVHLFEDDMV 97 Query 146 EVWRRSVLSPSEACGLLLGSTCGHWDIFSSWNISLPTVPKPPPKPPSPPAPGAPVSRILF 205 EVWRRSVLSPSEACGLLLGSTCGHWDIFSSWNISLPTVPKPPPKPPSPPAPGAPVSRILF Sbjct 98 EVWRRSVLSPSEACGLLLGSTCGHWDIFSSWNISLPTVPKPPPKPPSPPAPGAPVSRILF 157 Query 206 LTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGEYSKCDLPLRTLESLLSG 265 LTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGEYSKCDLPLRTLESLLSG Sbjct 158 LTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGEYSKCDLPLRTLESLLSG 217 Query 266 LGPAGPFDMVYWTGDIPAHDVWHQTRQDQLRALTTVTALVRKFLGPVPVYPAVGNHESTP 325 LGPAGPFDMVYWTGDIPAHDVWHQTRQDQLRALTTVTALVRKFLGPVPVYPAVGNHESTP Sbjct 218 LGPAGPFDMVYWTGDIPAHDVWHQTRQDQLRALTTVTALVRKFLGPVPVYPAVGNHESTP 277 Query 326 VNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGGFYALSPYPGLRLISLNMN 385 VNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGGFYALSPYPGLRLISLNMN Sbjct 278 VNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGGFYALSPYPGLRLISLNMN 337 Query 386 FCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGDKVHIIGHIPPGHCLKSWSWNYYRIV 445 FCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGDKVHIIGHIPPGHCLKSWSWNYYRIV Sbjct 338 FCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGDKVHIIGHIPPGHCLKSWSWNYYRIV 397 Query 446 ARYENTLAAQFFGHTHVDEFEVFYDEETLSRPLAVAFLAPSATTYIGLNPGYRVYQIDGN 505 ARYENTLAAQFFGHTHVDEFEVFYDEETLSRPLAVAFLAPSATTYIGLNPGYRVYQIDGN Sbjct 398 ARYENTLAAQFFGHTHVDEFEVFYDEETLSRPLAVAFLAPSATTYIGLNPGYRVYQIDGN 457 Query 506 YSGSSHVVLDHETYILNLTQANIPGAIPHWQLLYRARETYGLPNTLPTAWHNLVYRMRGD 565 YSGSSHVVLDHETYILNLTQANIPGAIPHWQLLYRARETYGLPNTLPTAWHNLVYRMRGD Sbjct 458 YSGSSHVVLDHETYILNLTQANIPGAIPHWQLLYRARETYGLPNTLPTAWHNLVYRMRGD 517 Query 566 MQLFQTFWFLYHKGHPPSEPCGTPCRLATLCAQLSARADSPALCRHLM 613 MQLFQTFWFLYHKGHPPSEPCGTPCRLATLCAQLSARADSPALCRHLM Sbjct 518 MQLFQTFWFLYHKGHPPSEPCGTPCRLATLCAQLSARADSPALCRHLM 565
>5i81_A A Sphingomyelin phosphodiesterase
Length=583 Score = 1087 bits (2812), Expect = 0.0, Method: Compositional matrix adjust. Identities = 528/528 (100%), Positives = 528/528 (100%), Gaps = 0/528 (0%) Query 86 WGNLTCPICKGLFTAINLGLKKEPNVARVGSVAIKLCNLLKIAPPAVCQSIVHLFEDDMV 145 WGNLTCPICKGLFTAINLGLKKEPNVARVGSVAIKLCNLLKIAPPAVCQSIVHLFEDDMV Sbjct 38 WGNLTCPICKGLFTAINLGLKKEPNVARVGSVAIKLCNLLKIAPPAVCQSIVHLFEDDMV 97 Query 146 EVWRRSVLSPSEACGLLLGSTCGHWDIFSSWNISLPTVPKPPPKPPSPPAPGAPVSRILF 205 EVWRRSVLSPSEACGLLLGSTCGHWDIFSSWNISLPTVPKPPPKPPSPPAPGAPVSRILF Sbjct 98 EVWRRSVLSPSEACGLLLGSTCGHWDIFSSWNISLPTVPKPPPKPPSPPAPGAPVSRILF 157 Query 206 LTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGEYSKCDLPLRTLESLLSG 265 LTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGEYSKCDLPLRTLESLLSG Sbjct 158 LTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGEYSKCDLPLRTLESLLSG 217 Query 266 LGPAGPFDMVYWTGDIPAHDVWHQTRQDQLRALTTVTALVRKFLGPVPVYPAVGNHESTP 325 LGPAGPFDMVYWTGDIPAHDVWHQTRQDQLRALTTVTALVRKFLGPVPVYPAVGNHESTP Sbjct 218 LGPAGPFDMVYWTGDIPAHDVWHQTRQDQLRALTTVTALVRKFLGPVPVYPAVGNHESTP 277 Query 326 VNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGGFYALSPYPGLRLISLNMN 385 VNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGGFYALSPYPGLRLISLNMN Sbjct 278 VNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGGFYALSPYPGLRLISLNMN 337 Query 386 FCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGDKVHIIGHIPPGHCLKSWSWNYYRIV 445 FCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGDKVHIIGHIPPGHCLKSWSWNYYRIV Sbjct 338 FCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGDKVHIIGHIPPGHCLKSWSWNYYRIV 397 Query 446 ARYENTLAAQFFGHTHVDEFEVFYDEETLSRPLAVAFLAPSATTYIGLNPGYRVYQIDGN 505 ARYENTLAAQFFGHTHVDEFEVFYDEETLSRPLAVAFLAPSATTYIGLNPGYRVYQIDGN Sbjct 398 ARYENTLAAQFFGHTHVDEFEVFYDEETLSRPLAVAFLAPSATTYIGLNPGYRVYQIDGN 457 Query 506 YSGSSHVVLDHETYILNLTQANIPGAIPHWQLLYRARETYGLPNTLPTAWHNLVYRMRGD 565 YSGSSHVVLDHETYILNLTQANIPGAIPHWQLLYRARETYGLPNTLPTAWHNLVYRMRGD Sbjct 458 YSGSSHVVLDHETYILNLTQANIPGAIPHWQLLYRARETYGLPNTLPTAWHNLVYRMRGD 517 Query 566 MQLFQTFWFLYHKGHPPSEPCGTPCRLATLCAQLSARADSPALCRHLM 613 MQLFQTFWFLYHKGHPPSEPCGTPCRLATLCAQLSARADSPALCRHLM Sbjct 518 MQLFQTFWFLYHKGHPPSEPCGTPCRLATLCAQLSARADSPALCRHLM 565
>5i85_A A Sphingomyelin phosphodiesterase
Length=583 Score = 1087 bits (2812), Expect = 0.0, Method: Compositional matrix adjust. Identities = 528/528 (100%), Positives = 528/528 (100%), Gaps = 0/528 (0%) Query 86 WGNLTCPICKGLFTAINLGLKKEPNVARVGSVAIKLCNLLKIAPPAVCQSIVHLFEDDMV 145 WGNLTCPICKGLFTAINLGLKKEPNVARVGSVAIKLCNLLKIAPPAVCQSIVHLFEDDMV Sbjct 38 WGNLTCPICKGLFTAINLGLKKEPNVARVGSVAIKLCNLLKIAPPAVCQSIVHLFEDDMV 97 Query 146 EVWRRSVLSPSEACGLLLGSTCGHWDIFSSWNISLPTVPKPPPKPPSPPAPGAPVSRILF 205 EVWRRSVLSPSEACGLLLGSTCGHWDIFSSWNISLPTVPKPPPKPPSPPAPGAPVSRILF Sbjct 98 EVWRRSVLSPSEACGLLLGSTCGHWDIFSSWNISLPTVPKPPPKPPSPPAPGAPVSRILF 157 Query 206 LTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGEYSKCDLPLRTLESLLSG 265 LTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGEYSKCDLPLRTLESLLSG Sbjct 158 LTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGEYSKCDLPLRTLESLLSG 217 Query 266 LGPAGPFDMVYWTGDIPAHDVWHQTRQDQLRALTTVTALVRKFLGPVPVYPAVGNHESTP 325 LGPAGPFDMVYWTGDIPAHDVWHQTRQDQLRALTTVTALVRKFLGPVPVYPAVGNHESTP Sbjct 218 LGPAGPFDMVYWTGDIPAHDVWHQTRQDQLRALTTVTALVRKFLGPVPVYPAVGNHESTP 277 Query 326 VNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGGFYALSPYPGLRLISLNMN 385 VNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGGFYALSPYPGLRLISLNMN Sbjct 278 VNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGGFYALSPYPGLRLISLNMN 337 Query 386 FCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGDKVHIIGHIPPGHCLKSWSWNYYRIV 445 FCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGDKVHIIGHIPPGHCLKSWSWNYYRIV Sbjct 338 FCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGDKVHIIGHIPPGHCLKSWSWNYYRIV 397 Query 446 ARYENTLAAQFFGHTHVDEFEVFYDEETLSRPLAVAFLAPSATTYIGLNPGYRVYQIDGN 505 ARYENTLAAQFFGHTHVDEFEVFYDEETLSRPLAVAFLAPSATTYIGLNPGYRVYQIDGN Sbjct 398 ARYENTLAAQFFGHTHVDEFEVFYDEETLSRPLAVAFLAPSATTYIGLNPGYRVYQIDGN 457 Query 506 YSGSSHVVLDHETYILNLTQANIPGAIPHWQLLYRARETYGLPNTLPTAWHNLVYRMRGD 565 YSGSSHVVLDHETYILNLTQANIPGAIPHWQLLYRARETYGLPNTLPTAWHNLVYRMRGD Sbjct 458 YSGSSHVVLDHETYILNLTQANIPGAIPHWQLLYRARETYGLPNTLPTAWHNLVYRMRGD 517 Query 566 MQLFQTFWFLYHKGHPPSEPCGTPCRLATLCAQLSARADSPALCRHLM 613 MQLFQTFWFLYHKGHPPSEPCGTPCRLATLCAQLSARADSPALCRHLM Sbjct 518 MQLFQTFWFLYHKGHPPSEPCGTPCRLATLCAQLSARADSPALCRHLM 565
>5i8r_A A Sphingomyelin phosphodiesterase
Length=583 Score = 1087 bits (2812), Expect = 0.0, Method: Compositional matrix adjust. Identities = 528/528 (100%), Positives = 528/528 (100%), Gaps = 0/528 (0%) Query 86 WGNLTCPICKGLFTAINLGLKKEPNVARVGSVAIKLCNLLKIAPPAVCQSIVHLFEDDMV 145 WGNLTCPICKGLFTAINLGLKKEPNVARVGSVAIKLCNLLKIAPPAVCQSIVHLFEDDMV Sbjct 38 WGNLTCPICKGLFTAINLGLKKEPNVARVGSVAIKLCNLLKIAPPAVCQSIVHLFEDDMV 97 Query 146 EVWRRSVLSPSEACGLLLGSTCGHWDIFSSWNISLPTVPKPPPKPPSPPAPGAPVSRILF 205 EVWRRSVLSPSEACGLLLGSTCGHWDIFSSWNISLPTVPKPPPKPPSPPAPGAPVSRILF Sbjct 98 EVWRRSVLSPSEACGLLLGSTCGHWDIFSSWNISLPTVPKPPPKPPSPPAPGAPVSRILF 157 Query 206 LTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGEYSKCDLPLRTLESLLSG 265 LTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGEYSKCDLPLRTLESLLSG Sbjct 158 LTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGEYSKCDLPLRTLESLLSG 217 Query 266 LGPAGPFDMVYWTGDIPAHDVWHQTRQDQLRALTTVTALVRKFLGPVPVYPAVGNHESTP 325 LGPAGPFDMVYWTGDIPAHDVWHQTRQDQLRALTTVTALVRKFLGPVPVYPAVGNHESTP Sbjct 218 LGPAGPFDMVYWTGDIPAHDVWHQTRQDQLRALTTVTALVRKFLGPVPVYPAVGNHESTP 277 Query 326 VNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGGFYALSPYPGLRLISLNMN 385 VNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGGFYALSPYPGLRLISLNMN Sbjct 278 VNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGGFYALSPYPGLRLISLNMN 337 Query 386 FCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGDKVHIIGHIPPGHCLKSWSWNYYRIV 445 FCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGDKVHIIGHIPPGHCLKSWSWNYYRIV Sbjct 338 FCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGDKVHIIGHIPPGHCLKSWSWNYYRIV 397 Query 446 ARYENTLAAQFFGHTHVDEFEVFYDEETLSRPLAVAFLAPSATTYIGLNPGYRVYQIDGN 505 ARYENTLAAQFFGHTHVDEFEVFYDEETLSRPLAVAFLAPSATTYIGLNPGYRVYQIDGN Sbjct 398 ARYENTLAAQFFGHTHVDEFEVFYDEETLSRPLAVAFLAPSATTYIGLNPGYRVYQIDGN 457 Query 506 YSGSSHVVLDHETYILNLTQANIPGAIPHWQLLYRARETYGLPNTLPTAWHNLVYRMRGD 565 YSGSSHVVLDHETYILNLTQANIPGAIPHWQLLYRARETYGLPNTLPTAWHNLVYRMRGD Sbjct 458 YSGSSHVVLDHETYILNLTQANIPGAIPHWQLLYRARETYGLPNTLPTAWHNLVYRMRGD 517 Query 566 MQLFQTFWFLYHKGHPPSEPCGTPCRLATLCAQLSARADSPALCRHLM 613 MQLFQTFWFLYHKGHPPSEPCGTPCRLATLCAQLSARADSPALCRHLM Sbjct 518 MQLFQTFWFLYHKGHPPSEPCGTPCRLATLCAQLSARADSPALCRHLM 565
>5i8r_C C Sphingomyelin phosphodiesterase
Length=583 Score = 1087 bits (2812), Expect = 0.0, Method: Compositional matrix adjust. Identities = 528/528 (100%), Positives = 528/528 (100%), Gaps = 0/528 (0%) Query 86 WGNLTCPICKGLFTAINLGLKKEPNVARVGSVAIKLCNLLKIAPPAVCQSIVHLFEDDMV 145 WGNLTCPICKGLFTAINLGLKKEPNVARVGSVAIKLCNLLKIAPPAVCQSIVHLFEDDMV Sbjct 38 WGNLTCPICKGLFTAINLGLKKEPNVARVGSVAIKLCNLLKIAPPAVCQSIVHLFEDDMV 97 Query 146 EVWRRSVLSPSEACGLLLGSTCGHWDIFSSWNISLPTVPKPPPKPPSPPAPGAPVSRILF 205 EVWRRSVLSPSEACGLLLGSTCGHWDIFSSWNISLPTVPKPPPKPPSPPAPGAPVSRILF Sbjct 98 EVWRRSVLSPSEACGLLLGSTCGHWDIFSSWNISLPTVPKPPPKPPSPPAPGAPVSRILF 157 Query 206 LTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGEYSKCDLPLRTLESLLSG 265 LTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGEYSKCDLPLRTLESLLSG Sbjct 158 LTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGEYSKCDLPLRTLESLLSG 217 Query 266 LGPAGPFDMVYWTGDIPAHDVWHQTRQDQLRALTTVTALVRKFLGPVPVYPAVGNHESTP 325 LGPAGPFDMVYWTGDIPAHDVWHQTRQDQLRALTTVTALVRKFLGPVPVYPAVGNHESTP Sbjct 218 LGPAGPFDMVYWTGDIPAHDVWHQTRQDQLRALTTVTALVRKFLGPVPVYPAVGNHESTP 277 Query 326 VNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGGFYALSPYPGLRLISLNMN 385 VNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGGFYALSPYPGLRLISLNMN Sbjct 278 VNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGGFYALSPYPGLRLISLNMN 337 Query 386 FCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGDKVHIIGHIPPGHCLKSWSWNYYRIV 445 FCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGDKVHIIGHIPPGHCLKSWSWNYYRIV Sbjct 338 FCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGDKVHIIGHIPPGHCLKSWSWNYYRIV 397 Query 446 ARYENTLAAQFFGHTHVDEFEVFYDEETLSRPLAVAFLAPSATTYIGLNPGYRVYQIDGN 505 ARYENTLAAQFFGHTHVDEFEVFYDEETLSRPLAVAFLAPSATTYIGLNPGYRVYQIDGN Sbjct 398 ARYENTLAAQFFGHTHVDEFEVFYDEETLSRPLAVAFLAPSATTYIGLNPGYRVYQIDGN 457 Query 506 YSGSSHVVLDHETYILNLTQANIPGAIPHWQLLYRARETYGLPNTLPTAWHNLVYRMRGD 565 YSGSSHVVLDHETYILNLTQANIPGAIPHWQLLYRARETYGLPNTLPTAWHNLVYRMRGD Sbjct 458 YSGSSHVVLDHETYILNLTQANIPGAIPHWQLLYRARETYGLPNTLPTAWHNLVYRMRGD 517 Query 566 MQLFQTFWFLYHKGHPPSEPCGTPCRLATLCAQLSARADSPALCRHLM 613 MQLFQTFWFLYHKGHPPSEPCGTPCRLATLCAQLSARADSPALCRHLM Sbjct 518 MQLFQTFWFLYHKGHPPSEPCGTPCRLATLCAQLSARADSPALCRHLM 565
>5fic_B B Sphingomyelin phosphodiesterase
Length=538 Score = 933 bits (2411), Expect = 0.0, Method: Compositional matrix adjust. Identities = 466/527 (88%), Positives = 493/527 (94%), Gaps = 0/527 (0%) Query 88 NLTCPICKGLFTAINLGLKKEPNVARVGSVAIKLCNLLKIAPPAVCQSIVHLFEDDMVEV 147 NLTCP CK LFTA+N GLKKEPNVARVGSVAIK+C +L IAP VCQS VHLFEDD+VEV Sbjct 11 NLTCPACKVLFTALNHGLKKEPNVARVGSVAIKICKMLNIAPLDVCQSAVHLFEDDVVEV 70 Query 148 WRRSVLSPSEACGLLLGSTCGHWDIFSSWNISLPTVPKPPPKPPSPPAPGAPVSRILFLT 207 W RSVLSPSEACGLLLGS+CGHWDIFS+WNISLP+VPKPPPKPPSPPAPGAPVSR+LFLT Sbjct 71 WTRSVLSPSEACGLLLGSSCGHWDIFSTWNISLPSVPKPPPKPPSPPAPGAPVSRVLFLT 130 Query 208 DLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGEYSKCDLPLRTLESLLSGLG 267 DLHWDH+YLEGTDP CADPLCCRRGSG PP S+ GAG+WGEYSKCDLPLRTLESLL GLG Sbjct 131 DLHWDHEYLEGTDPYCADPLCCRRGSGWPPNSQKGAGFWGEYSKCDLPLRTLESLLKGLG 190 Query 268 PAGPFDMVYWTGDIPAHDVWHQTRQDQLRALTTVTALVRKFLGPVPVYPAVGNHESTPVN 327 PAGPF+MVYWTGDIPAHDVW Q+RQDQLRALTT+T LVRKFLGPVPVYPAVGNHESTPVN Sbjct 191 PAGPFEMVYWTGDIPAHDVWQQSRQDQLRALTTITDLVRKFLGPVPVYPAVGNHESTPVN 250 Query 328 SFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGGFYALSPYPGLRLISLNMNFC 387 FPPPFI+GN SS+WLYEAMAKAWEPWLPA+AL TLRIGGFYAL+P PGLRLISLNMNFC Sbjct 251 GFPPPFIKGNQSSQWLYEAMAKAWEPWLPADALHTLRIGGFYALTPRPGLRLISLNMNFC 310 Query 388 SRENFWLLINSTDPAGQLQWLVGELQAAEDRGDKVHIIGHIPPGHCLKSWSWNYYRIVAR 447 SRENFWLLINSTDPAGQLQWLV ELQAAE+RGDKVHIIGHIPPGHCLKSWSWNYY+I+AR Sbjct 311 SRENFWLLINSTDPAGQLQWLVEELQAAENRGDKVHIIGHIPPGHCLKSWSWNYYKIIAR 370 Query 448 YENTLAAQFFGHTHVDEFEVFYDEETLSRPLAVAFLAPSATTYIGLNPGYRVYQIDGNYS 507 YENTLA QFFGHTHVDEFE+FYDEETLSRPLAVAFLAPSATT+I LNPGYRVYQIDGNY Sbjct 371 YENTLAGQFFGHTHVDEFEIFYDEETLSRPLAVAFLAPSATTFINLNPGYRVYQIDGNYP 430 Query 508 GSSHVVLDHETYILNLTQANIPGAIPHWQLLYRARETYGLPNTLPTAWHNLVYRMRGDMQ 567 GSSHVVLDHETYILNLTQAN G P W+ LYRARETYGLP+ +P +WHNLVYRMR D Q Sbjct 431 GSSHVVLDHETYILNLTQANAAGGTPSWKRLYRARETYGLPDAMPASWHNLVYRMRDDEQ 490 Query 568 LFQTFWFLYHKGHPPSEPCGTPCRLATLCAQLSARADSPALCRHLMP 614 LFQTFWFLYHKGHPPSEPCGTPCRLATLCAQLSARADSPALCRHLMP Sbjct 491 LFQTFWFLYHKGHPPSEPCGTPCRLATLCAQLSARADSPALCRHLMP 537
>5fic_A A Sphingomyelin phosphodiesterase
Length=538 Score = 933 bits (2411), Expect = 0.0, Method: Compositional matrix adjust. Identities = 466/527 (88%), Positives = 493/527 (94%), Gaps = 0/527 (0%) Query 88 NLTCPICKGLFTAINLGLKKEPNVARVGSVAIKLCNLLKIAPPAVCQSIVHLFEDDMVEV 147 NLTCP CK LFTA+N GLKKEPNVARVGSVAIK+C +L IAP VCQS VHLFEDD+VEV Sbjct 11 NLTCPACKVLFTALNHGLKKEPNVARVGSVAIKICKMLNIAPLDVCQSAVHLFEDDVVEV 70 Query 148 WRRSVLSPSEACGLLLGSTCGHWDIFSSWNISLPTVPKPPPKPPSPPAPGAPVSRILFLT 207 W RSVLSPSEACGLLLGS+CGHWDIFS+WNISLP+VPKPPPKPPSPPAPGAPVSR+LFLT Sbjct 71 WTRSVLSPSEACGLLLGSSCGHWDIFSTWNISLPSVPKPPPKPPSPPAPGAPVSRVLFLT 130 Query 208 DLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGEYSKCDLPLRTLESLLSGLG 267 DLHWDH+YLEGTDP CADPLCCRRGSG PP S+ GAG+WGEYSKCDLPLRTLESLL GLG Sbjct 131 DLHWDHEYLEGTDPYCADPLCCRRGSGWPPNSQKGAGFWGEYSKCDLPLRTLESLLKGLG 190 Query 268 PAGPFDMVYWTGDIPAHDVWHQTRQDQLRALTTVTALVRKFLGPVPVYPAVGNHESTPVN 327 PAGPF+MVYWTGDIPAHDVW Q+RQDQLRALTT+T LVRKFLGPVPVYPAVGNHESTPVN Sbjct 191 PAGPFEMVYWTGDIPAHDVWQQSRQDQLRALTTITDLVRKFLGPVPVYPAVGNHESTPVN 250 Query 328 SFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGGFYALSPYPGLRLISLNMNFC 387 FPPPFI+GN SS+WLYEAMAKAWEPWLPA+AL TLRIGGFYAL+P PGLRLISLNMNFC Sbjct 251 GFPPPFIKGNQSSQWLYEAMAKAWEPWLPADALHTLRIGGFYALTPRPGLRLISLNMNFC 310 Query 388 SRENFWLLINSTDPAGQLQWLVGELQAAEDRGDKVHIIGHIPPGHCLKSWSWNYYRIVAR 447 SRENFWLLINSTDPAGQLQWLV ELQAAE+RGDKVHIIGHIPPGHCLKSWSWNYY+I+AR Sbjct 311 SRENFWLLINSTDPAGQLQWLVEELQAAENRGDKVHIIGHIPPGHCLKSWSWNYYKIIAR 370 Query 448 YENTLAAQFFGHTHVDEFEVFYDEETLSRPLAVAFLAPSATTYIGLNPGYRVYQIDGNYS 507 YENTLA QFFGHTHVDEFE+FYDEETLSRPLAVAFLAPSATT+I LNPGYRVYQIDGNY Sbjct 371 YENTLAGQFFGHTHVDEFEIFYDEETLSRPLAVAFLAPSATTFINLNPGYRVYQIDGNYP 430 Query 508 GSSHVVLDHETYILNLTQANIPGAIPHWQLLYRARETYGLPNTLPTAWHNLVYRMRGDMQ 567 GSSHVVLDHETYILNLTQAN G P W+ LYRARETYGLP+ +P +WHNLVYRMR D Q Sbjct 431 GSSHVVLDHETYILNLTQANAAGGTPSWKRLYRARETYGLPDAMPASWHNLVYRMRDDEQ 490 Query 568 LFQTFWFLYHKGHPPSEPCGTPCRLATLCAQLSARADSPALCRHLMP 614 LFQTFWFLYHKGHPPSEPCGTPCRLATLCAQLSARADSPALCRHLMP Sbjct 491 LFQTFWFLYHKGHPPSEPCGTPCRLATLCAQLSARADSPALCRHLMP 537
>5fic_C C Sphingomyelin phosphodiesterase
Length=538 Score = 933 bits (2411), Expect = 0.0, Method: Compositional matrix adjust. Identities = 466/527 (88%), Positives = 493/527 (94%), Gaps = 0/527 (0%) Query 88 NLTCPICKGLFTAINLGLKKEPNVARVGSVAIKLCNLLKIAPPAVCQSIVHLFEDDMVEV 147 NLTCP CK LFTA+N GLKKEPNVARVGSVAIK+C +L IAP VCQS VHLFEDD+VEV Sbjct 11 NLTCPACKVLFTALNHGLKKEPNVARVGSVAIKICKMLNIAPLDVCQSAVHLFEDDVVEV 70 Query 148 WRRSVLSPSEACGLLLGSTCGHWDIFSSWNISLPTVPKPPPKPPSPPAPGAPVSRILFLT 207 W RSVLSPSEACGLLLGS+CGHWDIFS+WNISLP+VPKPPPKPPSPPAPGAPVSR+LFLT Sbjct 71 WTRSVLSPSEACGLLLGSSCGHWDIFSTWNISLPSVPKPPPKPPSPPAPGAPVSRVLFLT 130 Query 208 DLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGEYSKCDLPLRTLESLLSGLG 267 DLHWDH+YLEGTDP CADPLCCRRGSG PP S+ GAG+WGEYSKCDLPLRTLESLL GLG Sbjct 131 DLHWDHEYLEGTDPYCADPLCCRRGSGWPPNSQKGAGFWGEYSKCDLPLRTLESLLKGLG 190 Query 268 PAGPFDMVYWTGDIPAHDVWHQTRQDQLRALTTVTALVRKFLGPVPVYPAVGNHESTPVN 327 PAGPF+MVYWTGDIPAHDVW Q+RQDQLRALTT+T LVRKFLGPVPVYPAVGNHESTPVN Sbjct 191 PAGPFEMVYWTGDIPAHDVWQQSRQDQLRALTTITDLVRKFLGPVPVYPAVGNHESTPVN 250 Query 328 SFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGGFYALSPYPGLRLISLNMNFC 387 FPPPFI+GN SS+WLYEAMAKAWEPWLPA+AL TLRIGGFYAL+P PGLRLISLNMNFC Sbjct 251 GFPPPFIKGNQSSQWLYEAMAKAWEPWLPADALHTLRIGGFYALTPRPGLRLISLNMNFC 310 Query 388 SRENFWLLINSTDPAGQLQWLVGELQAAEDRGDKVHIIGHIPPGHCLKSWSWNYYRIVAR 447 SRENFWLLINSTDPAGQLQWLV ELQAAE+RGDKVHIIGHIPPGHCLKSWSWNYY+I+AR Sbjct 311 SRENFWLLINSTDPAGQLQWLVEELQAAENRGDKVHIIGHIPPGHCLKSWSWNYYKIIAR 370 Query 448 YENTLAAQFFGHTHVDEFEVFYDEETLSRPLAVAFLAPSATTYIGLNPGYRVYQIDGNYS 507 YENTLA QFFGHTHVDEFE+FYDEETLSRPLAVAFLAPSATT+I LNPGYRVYQIDGNY Sbjct 371 YENTLAGQFFGHTHVDEFEIFYDEETLSRPLAVAFLAPSATTFINLNPGYRVYQIDGNYP 430 Query 508 GSSHVVLDHETYILNLTQANIPGAIPHWQLLYRARETYGLPNTLPTAWHNLVYRMRGDMQ 567 GSSHVVLDHETYILNLTQAN G P W+ LYRARETYGLP+ +P +WHNLVYRMR D Q Sbjct 431 GSSHVVLDHETYILNLTQANAAGGTPSWKRLYRARETYGLPDAMPASWHNLVYRMRDDEQ 490 Query 568 LFQTFWFLYHKGHPPSEPCGTPCRLATLCAQLSARADSPALCRHLMP 614 LFQTFWFLYHKGHPPSEPCGTPCRLATLCAQLSARADSPALCRHLMP Sbjct 491 LFQTFWFLYHKGHPPSEPCGTPCRLATLCAQLSARADSPALCRHLMP 537
>5fic_D D Sphingomyelin phosphodiesterase
Length=538 Score = 933 bits (2411), Expect = 0.0, Method: Compositional matrix adjust. Identities = 466/527 (88%), Positives = 493/527 (94%), Gaps = 0/527 (0%) Query 88 NLTCPICKGLFTAINLGLKKEPNVARVGSVAIKLCNLLKIAPPAVCQSIVHLFEDDMVEV 147 NLTCP CK LFTA+N GLKKEPNVARVGSVAIK+C +L IAP VCQS VHLFEDD+VEV Sbjct 11 NLTCPACKVLFTALNHGLKKEPNVARVGSVAIKICKMLNIAPLDVCQSAVHLFEDDVVEV 70 Query 148 WRRSVLSPSEACGLLLGSTCGHWDIFSSWNISLPTVPKPPPKPPSPPAPGAPVSRILFLT 207 W RSVLSPSEACGLLLGS+CGHWDIFS+WNISLP+VPKPPPKPPSPPAPGAPVSR+LFLT Sbjct 71 WTRSVLSPSEACGLLLGSSCGHWDIFSTWNISLPSVPKPPPKPPSPPAPGAPVSRVLFLT 130 Query 208 DLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGEYSKCDLPLRTLESLLSGLG 267 DLHWDH+YLEGTDP CADPLCCRRGSG PP S+ GAG+WGEYSKCDLPLRTLESLL GLG Sbjct 131 DLHWDHEYLEGTDPYCADPLCCRRGSGWPPNSQKGAGFWGEYSKCDLPLRTLESLLKGLG 190 Query 268 PAGPFDMVYWTGDIPAHDVWHQTRQDQLRALTTVTALVRKFLGPVPVYPAVGNHESTPVN 327 PAGPF+MVYWTGDIPAHDVW Q+RQDQLRALTT+T LVRKFLGPVPVYPAVGNHESTPVN Sbjct 191 PAGPFEMVYWTGDIPAHDVWQQSRQDQLRALTTITDLVRKFLGPVPVYPAVGNHESTPVN 250 Query 328 SFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGGFYALSPYPGLRLISLNMNFC 387 FPPPFI+GN SS+WLYEAMAKAWEPWLPA+AL TLRIGGFYAL+P PGLRLISLNMNFC Sbjct 251 GFPPPFIKGNQSSQWLYEAMAKAWEPWLPADALHTLRIGGFYALTPRPGLRLISLNMNFC 310 Query 388 SRENFWLLINSTDPAGQLQWLVGELQAAEDRGDKVHIIGHIPPGHCLKSWSWNYYRIVAR 447 SRENFWLLINSTDPAGQLQWLV ELQAAE+RGDKVHIIGHIPPGHCLKSWSWNYY+I+AR Sbjct 311 SRENFWLLINSTDPAGQLQWLVEELQAAENRGDKVHIIGHIPPGHCLKSWSWNYYKIIAR 370 Query 448 YENTLAAQFFGHTHVDEFEVFYDEETLSRPLAVAFLAPSATTYIGLNPGYRVYQIDGNYS 507 YENTLA QFFGHTHVDEFE+FYDEETLSRPLAVAFLAPSATT+I LNPGYRVYQIDGNY Sbjct 371 YENTLAGQFFGHTHVDEFEIFYDEETLSRPLAVAFLAPSATTFINLNPGYRVYQIDGNYP 430 Query 508 GSSHVVLDHETYILNLTQANIPGAIPHWQLLYRARETYGLPNTLPTAWHNLVYRMRGDMQ 567 GSSHVVLDHETYILNLTQAN G P W+ LYRARETYGLP+ +P +WHNLVYRMR D Q Sbjct 431 GSSHVVLDHETYILNLTQANAAGGTPSWKRLYRARETYGLPDAMPASWHNLVYRMRDDEQ 490 Query 568 LFQTFWFLYHKGHPPSEPCGTPCRLATLCAQLSARADSPALCRHLMP 614 LFQTFWFLYHKGHPPSEPCGTPCRLATLCAQLSARADSPALCRHLMP Sbjct 491 LFQTFWFLYHKGHPPSEPCGTPCRLATLCAQLSARADSPALCRHLMP 537
>5fi9_B B Sphingomyelin phosphodiesterase
Length=538 Score = 932 bits (2410), Expect = 0.0, Method: Compositional matrix adjust. Identities = 466/527 (88%), Positives = 493/527 (94%), Gaps = 0/527 (0%) Query 88 NLTCPICKGLFTAINLGLKKEPNVARVGSVAIKLCNLLKIAPPAVCQSIVHLFEDDMVEV 147 NLTCP CK LFTA+N GLKKEPNVARVGSVAIK+C +L IAP VCQS VHLFEDD+VEV Sbjct 11 NLTCPACKVLFTALNHGLKKEPNVARVGSVAIKICKMLNIAPLDVCQSAVHLFEDDVVEV 70 Query 148 WRRSVLSPSEACGLLLGSTCGHWDIFSSWNISLPTVPKPPPKPPSPPAPGAPVSRILFLT 207 W RSVLSPSEACGLLLGS+CGHWDIFS+WNISLP+VPKPPPKPPSPPAPGAPVSR+LFLT Sbjct 71 WTRSVLSPSEACGLLLGSSCGHWDIFSTWNISLPSVPKPPPKPPSPPAPGAPVSRVLFLT 130 Query 208 DLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGEYSKCDLPLRTLESLLSGLG 267 DLHWDH+YLEGTDP CADPLCCRRGSG PP S+ GAG+WGEYSKCDLPLRTLESLL GLG Sbjct 131 DLHWDHEYLEGTDPYCADPLCCRRGSGWPPNSQKGAGFWGEYSKCDLPLRTLESLLKGLG 190 Query 268 PAGPFDMVYWTGDIPAHDVWHQTRQDQLRALTTVTALVRKFLGPVPVYPAVGNHESTPVN 327 PAGPF+MVYWTGDIPAHDVW Q+RQDQLRALTT+T LVRKFLGPVPVYPAVGNHESTPVN Sbjct 191 PAGPFEMVYWTGDIPAHDVWQQSRQDQLRALTTITDLVRKFLGPVPVYPAVGNHESTPVN 250 Query 328 SFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGGFYALSPYPGLRLISLNMNFC 387 FPPPFI+GN SS+WLYEAMAKAWEPWLPA+AL TLRIGGFYAL+P PGLRLISLNMNFC Sbjct 251 GFPPPFIKGNQSSQWLYEAMAKAWEPWLPADALHTLRIGGFYALTPRPGLRLISLNMNFC 310 Query 388 SRENFWLLINSTDPAGQLQWLVGELQAAEDRGDKVHIIGHIPPGHCLKSWSWNYYRIVAR 447 SRENFWLLINSTDPAGQLQWLV ELQAAE+RGDKVHIIGHIPPGHCLKSWSWNYY+I+AR Sbjct 311 SRENFWLLINSTDPAGQLQWLVEELQAAENRGDKVHIIGHIPPGHCLKSWSWNYYKIIAR 370 Query 448 YENTLAAQFFGHTHVDEFEVFYDEETLSRPLAVAFLAPSATTYIGLNPGYRVYQIDGNYS 507 YENTLA QFFGHTHVDEFE+FYDEETLSRPLAVAFLAPSATT+I LNPGYRVYQIDGNY Sbjct 371 YENTLAGQFFGHTHVDEFEIFYDEETLSRPLAVAFLAPSATTFINLNPGYRVYQIDGNYP 430 Query 508 GSSHVVLDHETYILNLTQANIPGAIPHWQLLYRARETYGLPNTLPTAWHNLVYRMRGDMQ 567 GSSHVVLDHETYILNLTQAN G P W+ LYRARETYGLP+ +P +WHNLVYRMR D Q Sbjct 431 GSSHVVLDHETYILNLTQANAAGGTPSWKRLYRARETYGLPDAMPASWHNLVYRMRDDEQ 490 Query 568 LFQTFWFLYHKGHPPSEPCGTPCRLATLCAQLSARADSPALCRHLMP 614 LFQTFWFLYHKGHPPSEPCGTPCRLATLCAQLSARADSPALCRHLMP Sbjct 491 LFQTFWFLYHKGHPPSEPCGTPCRLATLCAQLSARADSPALCRHLMP 537
>5fib_B B Sphingomyelin phosphodiesterase
Length=538 Score = 931 bits (2406), Expect = 0.0, Method: Compositional matrix adjust. Identities = 465/526 (88%), Positives = 492/526 (94%), Gaps = 0/526 (0%) Query 88 NLTCPICKGLFTAINLGLKKEPNVARVGSVAIKLCNLLKIAPPAVCQSIVHLFEDDMVEV 147 NLTCP CK LFTA+N GLKKEPNVARVGSVAIK+C +L IAP VCQS VHLFEDD+VEV Sbjct 11 NLTCPACKVLFTALNHGLKKEPNVARVGSVAIKICKMLNIAPLDVCQSAVHLFEDDVVEV 70 Query 148 WRRSVLSPSEACGLLLGSTCGHWDIFSSWNISLPTVPKPPPKPPSPPAPGAPVSRILFLT 207 W RSVLSPSEACGLLLGS+CGHWDIFS+WNISLP+VPKPPPKPPSPPAPGAPVSR+LFLT Sbjct 71 WTRSVLSPSEACGLLLGSSCGHWDIFSTWNISLPSVPKPPPKPPSPPAPGAPVSRVLFLT 130 Query 208 DLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGEYSKCDLPLRTLESLLSGLG 267 DLHWDH+YLEGTDP CADPLCCRRGSG PP S+ GAG+WGEYSKCDLPLRTLESLL GLG Sbjct 131 DLHWDHEYLEGTDPYCADPLCCRRGSGWPPNSQKGAGFWGEYSKCDLPLRTLESLLKGLG 190 Query 268 PAGPFDMVYWTGDIPAHDVWHQTRQDQLRALTTVTALVRKFLGPVPVYPAVGNHESTPVN 327 PAGPF+MVYWTGDIPAHDVW Q+RQDQLRALTT+T LVRKFLGPVPVYPAVGNHESTPVN Sbjct 191 PAGPFEMVYWTGDIPAHDVWQQSRQDQLRALTTITDLVRKFLGPVPVYPAVGNHESTPVN 250 Query 328 SFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGGFYALSPYPGLRLISLNMNFC 387 FPPPFI+GN SS+WLYEAMAKAWEPWLPA+AL TLRIGGFYAL+P PGLRLISLNMNFC Sbjct 251 GFPPPFIKGNQSSQWLYEAMAKAWEPWLPADALHTLRIGGFYALTPRPGLRLISLNMNFC 310 Query 388 SRENFWLLINSTDPAGQLQWLVGELQAAEDRGDKVHIIGHIPPGHCLKSWSWNYYRIVAR 447 SRENFWLLINSTDPAGQLQWLV ELQAAE+RGDKVHIIGHIPPGHCLKSWSWNYY+I+AR Sbjct 311 SRENFWLLINSTDPAGQLQWLVEELQAAENRGDKVHIIGHIPPGHCLKSWSWNYYKIIAR 370 Query 448 YENTLAAQFFGHTHVDEFEVFYDEETLSRPLAVAFLAPSATTYIGLNPGYRVYQIDGNYS 507 YENTLA QFFGHTHVDEFE+FYDEETLSRPLAVAFLAPSATT+I LNPGYRVYQIDGNY Sbjct 371 YENTLAGQFFGHTHVDEFEIFYDEETLSRPLAVAFLAPSATTFINLNPGYRVYQIDGNYP 430 Query 508 GSSHVVLDHETYILNLTQANIPGAIPHWQLLYRARETYGLPNTLPTAWHNLVYRMRGDMQ 567 GSSHVVLDHETYILNLTQAN G P W+ LYRARETYGLP+ +P +WHNLVYRMR D Q Sbjct 431 GSSHVVLDHETYILNLTQANAAGGTPSWKRLYRARETYGLPDAMPASWHNLVYRMRDDEQ 490 Query 568 LFQTFWFLYHKGHPPSEPCGTPCRLATLCAQLSARADSPALCRHLM 613 LFQTFWFLYHKGHPPSEPCGTPCRLATLCAQLSARADSPALCRHLM Sbjct 491 LFQTFWFLYHKGHPPSEPCGTPCRLATLCAQLSARADSPALCRHLM 536
>5fib_A A Sphingomyelin phosphodiesterase
Length=538 Score = 931 bits (2406), Expect = 0.0, Method: Compositional matrix adjust. Identities = 465/526 (88%), Positives = 492/526 (94%), Gaps = 0/526 (0%) Query 88 NLTCPICKGLFTAINLGLKKEPNVARVGSVAIKLCNLLKIAPPAVCQSIVHLFEDDMVEV 147 NLTCP CK LFTA+N GLKKEPNVARVGSVAIK+C +L IAP VCQS VHLFEDD+VEV Sbjct 11 NLTCPACKVLFTALNHGLKKEPNVARVGSVAIKICKMLNIAPLDVCQSAVHLFEDDVVEV 70 Query 148 WRRSVLSPSEACGLLLGSTCGHWDIFSSWNISLPTVPKPPPKPPSPPAPGAPVSRILFLT 207 W RSVLSPSEACGLLLGS+CGHWDIFS+WNISLP+VPKPPPKPPSPPAPGAPVSR+LFLT Sbjct 71 WTRSVLSPSEACGLLLGSSCGHWDIFSTWNISLPSVPKPPPKPPSPPAPGAPVSRVLFLT 130 Query 208 DLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGEYSKCDLPLRTLESLLSGLG 267 DLHWDH+YLEGTDP CADPLCCRRGSG PP S+ GAG+WGEYSKCDLPLRTLESLL GLG Sbjct 131 DLHWDHEYLEGTDPYCADPLCCRRGSGWPPNSQKGAGFWGEYSKCDLPLRTLESLLKGLG 190 Query 268 PAGPFDMVYWTGDIPAHDVWHQTRQDQLRALTTVTALVRKFLGPVPVYPAVGNHESTPVN 327 PAGPF+MVYWTGDIPAHDVW Q+RQDQLRALTT+T LVRKFLGPVPVYPAVGNHESTPVN Sbjct 191 PAGPFEMVYWTGDIPAHDVWQQSRQDQLRALTTITDLVRKFLGPVPVYPAVGNHESTPVN 250 Query 328 SFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGGFYALSPYPGLRLISLNMNFC 387 FPPPFI+GN SS+WLYEAMAKAWEPWLPA+AL TLRIGGFYAL+P PGLRLISLNMNFC Sbjct 251 GFPPPFIKGNQSSQWLYEAMAKAWEPWLPADALHTLRIGGFYALTPRPGLRLISLNMNFC 310 Query 388 SRENFWLLINSTDPAGQLQWLVGELQAAEDRGDKVHIIGHIPPGHCLKSWSWNYYRIVAR 447 SRENFWLLINSTDPAGQLQWLV ELQAAE+RGDKVHIIGHIPPGHCLKSWSWNYY+I+AR Sbjct 311 SRENFWLLINSTDPAGQLQWLVEELQAAENRGDKVHIIGHIPPGHCLKSWSWNYYKIIAR 370 Query 448 YENTLAAQFFGHTHVDEFEVFYDEETLSRPLAVAFLAPSATTYIGLNPGYRVYQIDGNYS 507 YENTLA QFFGHTHVDEFE+FYDEETLSRPLAVAFLAPSATT+I LNPGYRVYQIDGNY Sbjct 371 YENTLAGQFFGHTHVDEFEIFYDEETLSRPLAVAFLAPSATTFINLNPGYRVYQIDGNYP 430 Query 508 GSSHVVLDHETYILNLTQANIPGAIPHWQLLYRARETYGLPNTLPTAWHNLVYRMRGDMQ 567 GSSHVVLDHETYILNLTQAN G P W+ LYRARETYGLP+ +P +WHNLVYRMR D Q Sbjct 431 GSSHVVLDHETYILNLTQANAAGGTPSWKRLYRARETYGLPDAMPASWHNLVYRMRDDEQ 490 Query 568 LFQTFWFLYHKGHPPSEPCGTPCRLATLCAQLSARADSPALCRHLM 613 LFQTFWFLYHKGHPPSEPCGTPCRLATLCAQLSARADSPALCRHLM Sbjct 491 LFQTFWFLYHKGHPPSEPCGTPCRLATLCAQLSARADSPALCRHLM 536
>5fi9_A A Sphingomyelin phosphodiesterase
Length=538 Score = 916 bits (2367), Expect = 0.0, Method: Compositional matrix adjust. Identities = 460/526 (87%), Positives = 487/526 (93%), Gaps = 0/526 (0%) Query 88 NLTCPICKGLFTAINLGLKKEPNVARVGSVAIKLCNLLKIAPPAVCQSIVHLFEDDMVEV 147 NLTCP CK LFTA+N GLKKEPNVARVGSVAIK+C +L IAP VCQS VHLFEDD+VEV Sbjct 11 NLTCPACKVLFTALNHGLKKEPNVARVGSVAIKICKMLNIAPLDVCQSAVHLFEDDVVEV 70 Query 148 WRRSVLSPSEACGLLLGSTCGHWDIFSSWNISLPTVPKPPPKPPSPPAPGAPVSRILFLT 207 W RSVLSPSEACGLLLGS+C FS+WNISLP+VPKPPPKPPSPPAPGAPVSR+LFLT Sbjct 71 WTRSVLSPSEACGLLLGSSCXXXXXFSTWNISLPSVPKPPPKPPSPPAPGAPVSRVLFLT 130 Query 208 DLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGEYSKCDLPLRTLESLLSGLG 267 DLHWDH+YLEGTDP CADPLCCRRGSG PP S+ GAG+WGEYSKCDLPLRTLESLL GLG Sbjct 131 DLHWDHEYLEGTDPYCADPLCCRRGSGWPPNSQKGAGFWGEYSKCDLPLRTLESLLKGLG 190 Query 268 PAGPFDMVYWTGDIPAHDVWHQTRQDQLRALTTVTALVRKFLGPVPVYPAVGNHESTPVN 327 PAGPF+MVYWTGDIPAHDVW Q+RQDQLRALTT+T LVRKFLGPVPVYPAVGNHESTPVN Sbjct 191 PAGPFEMVYWTGDIPAHDVWQQSRQDQLRALTTITDLVRKFLGPVPVYPAVGNHESTPVN 250 Query 328 SFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGGFYALSPYPGLRLISLNMNFC 387 FPPPFI+GN SS+WLYEAMAKAWEPWLPA+AL TLRIGGFYAL+P PGLRLISLNMNFC Sbjct 251 GFPPPFIKGNQSSQWLYEAMAKAWEPWLPADALHTLRIGGFYALTPRPGLRLISLNMNFC 310 Query 388 SRENFWLLINSTDPAGQLQWLVGELQAAEDRGDKVHIIGHIPPGHCLKSWSWNYYRIVAR 447 SRENFWLLINSTDPAGQLQWLV ELQAAE+RGDKVHIIGHIPPGHCLKSWSWNYY+I+AR Sbjct 311 SRENFWLLINSTDPAGQLQWLVEELQAAENRGDKVHIIGHIPPGHCLKSWSWNYYKIIAR 370 Query 448 YENTLAAQFFGHTHVDEFEVFYDEETLSRPLAVAFLAPSATTYIGLNPGYRVYQIDGNYS 507 YENTLA QFFGHTHVDEFE+FYDEETLSRPLAVAFLAPSATT+I LNPGYRVYQIDGNY Sbjct 371 YENTLAGQFFGHTHVDEFEIFYDEETLSRPLAVAFLAPSATTFINLNPGYRVYQIDGNYP 430 Query 508 GSSHVVLDHETYILNLTQANIPGAIPHWQLLYRARETYGLPNTLPTAWHNLVYRMRGDMQ 567 GSSHVVLDHETYILNLTQAN G P W+ LYRARETYGLP+ +P +WHNLVYRMR D Q Sbjct 431 GSSHVVLDHETYILNLTQANAAGGTPSWKRLYRARETYGLPDAMPASWHNLVYRMRDDEQ 490 Query 568 LFQTFWFLYHKGHPPSEPCGTPCRLATLCAQLSARADSPALCRHLM 613 LFQTFWFLYHKGHPPSEPCGTPCRLATLCAQLSARADSPALCRHLM Sbjct 491 LFQTFWFLYHKGHPPSEPCGTPCRLATLCAQLSARADSPALCRHLM 536
>5hqn_A A Sphingomyelin phosphodiesterase
Length=473 Score = 785 bits (2028), Expect = 0.0, Method: Compositional matrix adjust. Identities = 395/442 (89%), Positives = 417/442 (94%), Gaps = 0/442 (0%) Query 171 DIFSSWNISLPTVPKPPPKPPSPPAPGAPVSRILFLTDLHWDHDYLEGTDPDCADPLCCR 230 DIFS+WNISLP+VPKPPPKPPSPPAPGAPVSR+LFLTDLHWDH+YLEGTDP CADPLCCR Sbjct 13 DIFSTWNISLPSVPKPPPKPPSPPAPGAPVSRVLFLTDLHWDHEYLEGTDPYCADPLCCR 72 Query 231 RGSGLPPASRPGAGYWGEYSKCDLPLRTLESLLSGLGPAGPFDMVYWTGDIPAHDVWHQT 290 RGSG PP S+ GAG+WGEYSKCDLPLRTLESLL GLGPAGPF+MVYWTGDIPAHDVW Q+ Sbjct 73 RGSGWPPNSQKGAGFWGEYSKCDLPLRTLESLLKGLGPAGPFEMVYWTGDIPAHDVWQQS 132 Query 291 RQDQLRALTTVTALVRKFLGPVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKA 350 RQDQLRALTT+T LVRKFLGPVPVYPAVGNHESTPVN FPPPFI+GN SS+WLYEAMAKA Sbjct 133 RQDQLRALTTITDLVRKFLGPVPVYPAVGNHESTPVNGFPPPFIKGNQSSQWLYEAMAKA 192 Query 351 WEPWLPAEALRTLRIGGFYALSPYPGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVG 410 WEPWLPA+AL TLRIGGFYAL+P PGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLV Sbjct 193 WEPWLPADALHTLRIGGFYALTPRPGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVE 252 Query 411 ELQAAEDRGDKVHIIGHIPPGHCLKSWSWNYYRIVARYENTLAAQFFGHTHVDEFEVFYD 470 ELQAAE+RGDKVHIIGHIPPGHCLKSWSWNYY+I+ARYENTLA QFFGHTHVDEFE+FYD Sbjct 253 ELQAAENRGDKVHIIGHIPPGHCLKSWSWNYYKIIARYENTLAGQFFGHTHVDEFEIFYD 312 Query 471 EETLSRPLAVAFLAPSATTYIGLNPGYRVYQIDGNYSGSSHVVLDHETYILNLTQANIPG 530 EETLSRPLAVAFLAPSATT+I LNPGYRVYQIDGNY GSSHVVLDHETYILNLTQAN G Sbjct 313 EETLSRPLAVAFLAPSATTFINLNPGYRVYQIDGNYPGSSHVVLDHETYILNLTQANAAG 372 Query 531 AIPHWQLLYRARETYGLPNTLPTAWHNLVYRMRGDMQLFQTFWFLYHKGHPPSEPCGTPC 590 P W+ LYRARETYGLP+ +P +WHNLVYRMR D QLFQTFWFLYHKGHPPSEPCGTPC Sbjct 373 GTPSWKRLYRARETYGLPDAMPASWHNLVYRMRDDEQLFQTFWFLYHKGHPPSEPCGTPC 432 Query 591 RLATLCAQLSARADSPALCRHL 612 RLATLCAQLSARADSPALCRHL Sbjct 433 RLATLCAQLSARADSPALCRHL 454
>5hqn_B B Sphingomyelin phosphodiesterase
Length=473 Score = 785 bits (2028), Expect = 0.0, Method: Compositional matrix adjust. Identities = 395/442 (89%), Positives = 417/442 (94%), Gaps = 0/442 (0%) Query 171 DIFSSWNISLPTVPKPPPKPPSPPAPGAPVSRILFLTDLHWDHDYLEGTDPDCADPLCCR 230 DIFS+WNISLP+VPKPPPKPPSPPAPGAPVSR+LFLTDLHWDH+YLEGTDP CADPLCCR Sbjct 13 DIFSTWNISLPSVPKPPPKPPSPPAPGAPVSRVLFLTDLHWDHEYLEGTDPYCADPLCCR 72 Query 231 RGSGLPPASRPGAGYWGEYSKCDLPLRTLESLLSGLGPAGPFDMVYWTGDIPAHDVWHQT 290 RGSG PP S+ GAG+WGEYSKCDLPLRTLESLL GLGPAGPF+MVYWTGDIPAHDVW Q+ Sbjct 73 RGSGWPPNSQKGAGFWGEYSKCDLPLRTLESLLKGLGPAGPFEMVYWTGDIPAHDVWQQS 132 Query 291 RQDQLRALTTVTALVRKFLGPVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKA 350 RQDQLRALTT+T LVRKFLGPVPVYPAVGNHESTPVN FPPPFI+GN SS+WLYEAMAKA Sbjct 133 RQDQLRALTTITDLVRKFLGPVPVYPAVGNHESTPVNGFPPPFIKGNQSSQWLYEAMAKA 192 Query 351 WEPWLPAEALRTLRIGGFYALSPYPGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVG 410 WEPWLPA+AL TLRIGGFYAL+P PGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLV Sbjct 193 WEPWLPADALHTLRIGGFYALTPRPGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVE 252 Query 411 ELQAAEDRGDKVHIIGHIPPGHCLKSWSWNYYRIVARYENTLAAQFFGHTHVDEFEVFYD 470 ELQAAE+RGDKVHIIGHIPPGHCLKSWSWNYY+I+ARYENTLA QFFGHTHVDEFE+FYD Sbjct 253 ELQAAENRGDKVHIIGHIPPGHCLKSWSWNYYKIIARYENTLAGQFFGHTHVDEFEIFYD 312 Query 471 EETLSRPLAVAFLAPSATTYIGLNPGYRVYQIDGNYSGSSHVVLDHETYILNLTQANIPG 530 EETLSRPLAVAFLAPSATT+I LNPGYRVYQIDGNY GSSHVVLDHETYILNLTQAN G Sbjct 313 EETLSRPLAVAFLAPSATTFINLNPGYRVYQIDGNYPGSSHVVLDHETYILNLTQANAAG 372 Query 531 AIPHWQLLYRARETYGLPNTLPTAWHNLVYRMRGDMQLFQTFWFLYHKGHPPSEPCGTPC 590 P W+ LYRARETYGLP+ +P +WHNLVYRMR D QLFQTFWFLYHKGHPPSEPCGTPC Sbjct 373 GTPSWKRLYRARETYGLPDAMPASWHNLVYRMRDDEQLFQTFWFLYHKGHPPSEPCGTPC 432 Query 591 RLATLCAQLSARADSPALCRHL 612 RLATLCAQLSARADSPALCRHL Sbjct 433 RLATLCAQLSARADSPALCRHL 454
>5fc5_A A Acid sphingomyelinase-like phosphodiesterase 3a
Length=433 Score = 181 bits (460), Expect = 2e-49, Method: Compositional matrix adjust. Identities = 140/445 (31%), Positives = 213/445 (48%), Gaps = 46/445 (10%) Query 191 PSPPAPGAP-VSRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGEY 249 P PA AP V + +TDLH D Y TD D +G+ AS PG +G+ Sbjct 12 PLAPADRAPAVGQFWHVTDLHLDPTY-HITD-DRTKVCASSKGAN---ASNPGP--FGD- 63 Query 250 SKCDLPLRTLESLLSGLGPAG-PFDMVYWTGDIPAHD-VWHQTRQDQLRALTTVTALVRK 307 CD P + + S + +G + WTGD P H V + ++ +T +T V+ Sbjct 64 VLCDSPYQLILSAFDFIKNSGQEASFMIWTGDSPPHVPVPELSTGTVIKVITNMTMTVQN 123 Query 308 FLGPVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGG 367 + V+PA+GNH+ P + P + +Y A+A W+PWL EA+ TL+ GG Sbjct 124 LFPNLQVFPALGNHDYWPQDQLPI-------VTSKVYSAVADLWKPWLGEEAISTLKKGG 176 Query 368 FYA--LSPYPGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGDKVHII 425 FY+ ++ PGLR+ISLN N N + +N TDPA Q +WL L ++ +KV+II Sbjct 177 FYSQKVASNPGLRIISLNTNLYYGPNI-MTLNKTDPANQFEWLENTLNSSLWNKEKVYII 235 Query 426 GHIPPGH---------CLKSWSWNYYRIVARYENTLAAQFFGHTHVDEFEVFYDEETLSR 476 H+P G+ + ++ I RY + +A QF+GHTH D V D+ Sbjct 236 AHVPVGYLPYATDTPAIRQYYNEKLLDIFRRYSSVIAGQFYGHTHRDSLMVLSDKN--GN 293 Query 477 PLAVAFLAPSATTYIGL------NPGYRVYQIDGNYSGSSHVVLDHETYILNLTQANIPG 530 PL F+AP+ T G+ NPG R++Q Y + +LD Y LNLT+AN+ G Sbjct 294 PLNSVFVAPAVTPVKGVLQKETNNPGVRLFQ----YKPGDYTLLDMVQYYLNLTEANLKG 349 Query 531 AIPHWQLLYRARETYGLPNTLPTAWHNLVYRM-RGDMQLFQTFWFLYHKGHPPSEPCGTP 589 +W L Y + Y + + P + + LV + D + F ++ Y + S C Sbjct 350 E-SNWTLEYVLTQAYSVADLQPKSLYALVQQFATKDSKQFLKYYHYYFVSYDSSATCDQH 408 Query 590 CRLATLCA--QLSARADSPALCRHL 612 C+ +CA L + + L +HL Sbjct 409 CKTLQVCAIMNLDSMSYDDCLKQHL 433
>5fca_A A Acid sphingomyelinase-like phosphodiesterase 3a
Length=433 Score = 181 bits (460), Expect = 2e-49, Method: Compositional matrix adjust. Identities = 140/445 (31%), Positives = 213/445 (48%), Gaps = 46/445 (10%) Query 191 PSPPAPGAP-VSRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGEY 249 P PA AP V + +TDLH D Y TD D +G+ AS PG +G+ Sbjct 12 PLAPADRAPAVGQFWHVTDLHLDPTY-HITD-DRTKVCASSKGAN---ASNPGP--FGD- 63 Query 250 SKCDLPLRTLESLLSGLGPAG-PFDMVYWTGDIPAHD-VWHQTRQDQLRALTTVTALVRK 307 CD P + + S + +G + WTGD P H V + ++ +T +T V+ Sbjct 64 VLCDSPYQLILSAFDFIKNSGQEASFMIWTGDSPPHVPVPELSTGTVIKVITNMTMTVQN 123 Query 308 FLGPVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGG 367 + V+PA+GNH+ P + P + +Y A+A W+PWL EA+ TL+ GG Sbjct 124 LFPNLQVFPALGNHDYWPQDQLPI-------VTSKVYSAVADLWKPWLGEEAISTLKKGG 176 Query 368 FYA--LSPYPGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGDKVHII 425 FY+ ++ PGLR+ISLN N N + +N TDPA Q +WL L ++ +KV+II Sbjct 177 FYSQKVASNPGLRIISLNTNLYYGPNI-MTLNKTDPANQFEWLENTLNSSLWNKEKVYII 235 Query 426 GHIPPGH---------CLKSWSWNYYRIVARYENTLAAQFFGHTHVDEFEVFYDEETLSR 476 H+P G+ + ++ I RY + +A QF+GHTH D V D+ Sbjct 236 AHVPVGYLPYATDTPAIRQYYNEKLLDIFRRYSSVIAGQFYGHTHRDSLMVLSDKN--GN 293 Query 477 PLAVAFLAPSATTYIGL------NPGYRVYQIDGNYSGSSHVVLDHETYILNLTQANIPG 530 PL F+AP+ T G+ NPG R++Q Y + +LD Y LNLT+AN+ G Sbjct 294 PLNSVFVAPAVTPVKGVLQKETNNPGVRLFQ----YKPGDYTLLDMVQYYLNLTEANLKG 349 Query 531 AIPHWQLLYRARETYGLPNTLPTAWHNLVYRM-RGDMQLFQTFWFLYHKGHPPSEPCGTP 589 +W L Y + Y + + P + + LV + D + F ++ Y + S C Sbjct 350 E-SNWTLEYVLTQAYSVADLQPKSLYALVQQFATKDSKQFLKYYHYYFVSYDSSATCDQH 408 Query 590 CRLATLCA--QLSARADSPALCRHL 612 C+ +CA L + + L +HL Sbjct 409 CKTLQVCAIMNLDSMSYDDCLKQHL 433
>5fc6_A A Acid sphingomyelinase-like phosphodiesterase 3a
Length=433 Score = 181 bits (460), Expect = 2e-49, Method: Compositional matrix adjust. Identities = 140/445 (31%), Positives = 213/445 (48%), Gaps = 46/445 (10%) Query 191 PSPPAPGAP-VSRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGEY 249 P PA AP V + +TDLH D Y TD D +G+ AS PG +G+ Sbjct 12 PLAPADRAPAVGQFWHVTDLHLDPTY-HITD-DRTKVCASSKGAN---ASNPGP--FGD- 63 Query 250 SKCDLPLRTLESLLSGLGPAG-PFDMVYWTGDIPAHD-VWHQTRQDQLRALTTVTALVRK 307 CD P + + S + +G + WTGD P H V + ++ +T +T V+ Sbjct 64 VLCDSPYQLILSAFDFIKNSGQEASFMIWTGDSPPHVPVPELSTGTVIKVITNMTMTVQN 123 Query 308 FLGPVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGG 367 + V+PA+GNH+ P + P + +Y A+A W+PWL EA+ TL+ GG Sbjct 124 LFPNLQVFPALGNHDYWPQDQLPI-------VTSKVYSAVADLWKPWLGEEAISTLKKGG 176 Query 368 FYA--LSPYPGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGDKVHII 425 FY+ ++ PGLR+ISLN N N + +N TDPA Q +WL L ++ +KV+II Sbjct 177 FYSQKVASNPGLRIISLNTNLYYGPNI-MTLNKTDPANQFEWLENTLNSSLWNKEKVYII 235 Query 426 GHIPPGH---------CLKSWSWNYYRIVARYENTLAAQFFGHTHVDEFEVFYDEETLSR 476 H+P G+ + ++ I RY + +A QF+GHTH D V D+ Sbjct 236 AHVPVGYLPYATDTPAIRQYYNEKLLDIFRRYSSVIAGQFYGHTHRDSLMVLSDKN--GN 293 Query 477 PLAVAFLAPSATTYIGL------NPGYRVYQIDGNYSGSSHVVLDHETYILNLTQANIPG 530 PL F+AP+ T G+ NPG R++Q Y + +LD Y LNLT+AN+ G Sbjct 294 PLNSVFVAPAVTPVKGVLQKETNNPGVRLFQ----YKPGDYTLLDMVQYYLNLTEANLKG 349 Query 531 AIPHWQLLYRARETYGLPNTLPTAWHNLVYRM-RGDMQLFQTFWFLYHKGHPPSEPCGTP 589 +W L Y + Y + + P + + LV + D + F ++ Y + S C Sbjct 350 E-SNWTLEYVLTQAYSVADLQPKSLYALVQQFATKDSKQFLKYYHYYFVSYDSSATCDQH 408 Query 590 CRLATLCA--QLSARADSPALCRHL 612 C+ +CA L + + L +HL Sbjct 409 CKTLQVCAIMNLDSMSYDDCLKQHL 433
>5fcb_A A Acid sphingomyelinase-like phosphodiesterase 3a
Length=433 Score = 181 bits (460), Expect = 2e-49, Method: Compositional matrix adjust. Identities = 140/445 (31%), Positives = 213/445 (48%), Gaps = 46/445 (10%) Query 191 PSPPAPGAP-VSRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGEY 249 P PA AP V + +TDLH D Y TD D +G+ AS PG +G+ Sbjct 12 PLAPADRAPAVGQFWHVTDLHLDPTY-HITD-DRTKVCASSKGAN---ASNPGP--FGD- 63 Query 250 SKCDLPLRTLESLLSGLGPAG-PFDMVYWTGDIPAHD-VWHQTRQDQLRALTTVTALVRK 307 CD P + + S + +G + WTGD P H V + ++ +T +T V+ Sbjct 64 VLCDSPYQLILSAFDFIKNSGQEASFMIWTGDSPPHVPVPELSTGTVIKVITNMTMTVQN 123 Query 308 FLGPVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGG 367 + V+PA+GNH+ P + P + +Y A+A W+PWL EA+ TL+ GG Sbjct 124 LFPNLQVFPALGNHDYWPQDQLPI-------VTSKVYSAVADLWKPWLGEEAISTLKKGG 176 Query 368 FYA--LSPYPGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGDKVHII 425 FY+ ++ PGLR+ISLN N N + +N TDPA Q +WL L ++ +KV+II Sbjct 177 FYSQKVASNPGLRIISLNTNLYYGPNI-MTLNKTDPANQFEWLENTLNSSLWNKEKVYII 235 Query 426 GHIPPGH---------CLKSWSWNYYRIVARYENTLAAQFFGHTHVDEFEVFYDEETLSR 476 H+P G+ + ++ I RY + +A QF+GHTH D V D+ Sbjct 236 AHVPVGYLPYATDTPAIRQYYNEKLLDIFRRYSSVIAGQFYGHTHRDSLMVLSDKN--GN 293 Query 477 PLAVAFLAPSATTYIGL------NPGYRVYQIDGNYSGSSHVVLDHETYILNLTQANIPG 530 PL F+AP+ T G+ NPG R++Q Y + +LD Y LNLT+AN+ G Sbjct 294 PLNSVFVAPAVTPVKGVLQKETNNPGVRLFQ----YKPGDYTLLDMVQYYLNLTEANLKG 349 Query 531 AIPHWQLLYRARETYGLPNTLPTAWHNLVYRM-RGDMQLFQTFWFLYHKGHPPSEPCGTP 589 +W L Y + Y + + P + + LV + D + F ++ Y + S C Sbjct 350 E-SNWTLEYVLTQAYSVADLQPKSLYALVQQFATKDSKQFLKYYHYYFVSYDSSATCDQH 408 Query 590 CRLATLCA--QLSARADSPALCRHL 612 C+ +CA L + + L +HL Sbjct 409 CKTLQVCAIMNLDSMSYDDCLKQHL 433
>5fca_B B Acid sphingomyelinase-like phosphodiesterase 3a
Length=433 Score = 181 bits (460), Expect = 2e-49, Method: Compositional matrix adjust. Identities = 140/445 (31%), Positives = 213/445 (48%), Gaps = 46/445 (10%) Query 191 PSPPAPGAP-VSRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGEY 249 P PA AP V + +TDLH D Y TD D +G+ AS PG +G+ Sbjct 12 PLAPADRAPAVGQFWHVTDLHLDPTY-HITD-DRTKVCASSKGAN---ASNPGP--FGD- 63 Query 250 SKCDLPLRTLESLLSGLGPAG-PFDMVYWTGDIPAHD-VWHQTRQDQLRALTTVTALVRK 307 CD P + + S + +G + WTGD P H V + ++ +T +T V+ Sbjct 64 VLCDSPYQLILSAFDFIKNSGQEASFMIWTGDSPPHVPVPELSTGTVIKVITNMTMTVQN 123 Query 308 FLGPVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGG 367 + V+PA+GNH+ P + P + +Y A+A W+PWL EA+ TL+ GG Sbjct 124 LFPNLQVFPALGNHDYWPQDQLPI-------VTSKVYSAVADLWKPWLGEEAISTLKKGG 176 Query 368 FYA--LSPYPGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGDKVHII 425 FY+ ++ PGLR+ISLN N N + +N TDPA Q +WL L ++ +KV+II Sbjct 177 FYSQKVASNPGLRIISLNTNLYYGPNI-MTLNKTDPANQFEWLENTLNSSLWNKEKVYII 235 Query 426 GHIPPGH---------CLKSWSWNYYRIVARYENTLAAQFFGHTHVDEFEVFYDEETLSR 476 H+P G+ + ++ I RY + +A QF+GHTH D V D+ Sbjct 236 AHVPVGYLPYATDTPAIRQYYNEKLLDIFRRYSSVIAGQFYGHTHRDSLMVLSDKN--GN 293 Query 477 PLAVAFLAPSATTYIGL------NPGYRVYQIDGNYSGSSHVVLDHETYILNLTQANIPG 530 PL F+AP+ T G+ NPG R++Q Y + +LD Y LNLT+AN+ G Sbjct 294 PLNSVFVAPAVTPVKGVLQKETNNPGVRLFQ----YKPGDYTLLDMVQYYLNLTEANLKG 349 Query 531 AIPHWQLLYRARETYGLPNTLPTAWHNLVYRM-RGDMQLFQTFWFLYHKGHPPSEPCGTP 589 +W L Y + Y + + P + + LV + D + F ++ Y + S C Sbjct 350 E-SNWTLEYVLTQAYSVADLQPKSLYALVQQFATKDSKQFLKYYHYYFVSYDSSATCDQH 408 Query 590 CRLATLCA--QLSARADSPALCRHL 612 C+ +CA L + + L +HL Sbjct 409 CKTLQVCAIMNLDSMSYDDCLKQHL 433
>5fc1_A A Acid sphingomyelinase-like phosphodiesterase 3a
Length=433 Score = 181 bits (460), Expect = 2e-49, Method: Compositional matrix adjust. Identities = 140/445 (31%), Positives = 213/445 (48%), Gaps = 46/445 (10%) Query 191 PSPPAPGAP-VSRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGEY 249 P PA AP V + +TDLH D Y TD D +G+ AS PG +G+ Sbjct 12 PLAPADRAPAVGQFWHVTDLHLDPTY-HITD-DRTKVCASSKGAN---ASNPGP--FGD- 63 Query 250 SKCDLPLRTLESLLSGLGPAG-PFDMVYWTGDIPAHD-VWHQTRQDQLRALTTVTALVRK 307 CD P + + S + +G + WTGD P H V + ++ +T +T V+ Sbjct 64 VLCDSPYQLILSAFDFIKNSGQEASFMIWTGDSPPHVPVPELSTGTVIKVITNMTMTVQN 123 Query 308 FLGPVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGG 367 + V+PA+GNH+ P + P + +Y A+A W+PWL EA+ TL+ GG Sbjct 124 LFPNLQVFPALGNHDYWPQDQLPI-------VTSKVYSAVADLWKPWLGEEAISTLKKGG 176 Query 368 FYA--LSPYPGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGDKVHII 425 FY+ ++ PGLR+ISLN N N + +N TDPA Q +WL L ++ +KV+II Sbjct 177 FYSQKVASNPGLRIISLNTNLYYGPNI-MTLNKTDPANQFEWLENTLNSSLWNKEKVYII 235 Query 426 GHIPPGH---------CLKSWSWNYYRIVARYENTLAAQFFGHTHVDEFEVFYDEETLSR 476 H+P G+ + ++ I RY + +A QF+GHTH D V D+ Sbjct 236 AHVPVGYLPYATDTPAIRQYYNEKLLDIFRRYSSVIAGQFYGHTHRDSLMVLSDKN--GN 293 Query 477 PLAVAFLAPSATTYIGL------NPGYRVYQIDGNYSGSSHVVLDHETYILNLTQANIPG 530 PL F+AP+ T G+ NPG R++Q Y + +LD Y LNLT+AN+ G Sbjct 294 PLNSVFVAPAVTPVKGVLQKETNNPGVRLFQ----YKPGDYTLLDMVQYYLNLTEANLKG 349 Query 531 AIPHWQLLYRARETYGLPNTLPTAWHNLVYRM-RGDMQLFQTFWFLYHKGHPPSEPCGTP 589 +W L Y + Y + + P + + LV + D + F ++ Y + S C Sbjct 350 E-SNWTLEYVLTQAYSVADLQPKSLYALVQQFATKDSKQFLKYYHYYFVSYDSSATCDQH 408 Query 590 CRLATLCA--QLSARADSPALCRHL 612 C+ +CA L + + L +HL Sbjct 409 CKTLQVCAIMNLDSMSYDDCLKQHL 433
>5fc7_A A Acid sphingomyelinase-like phosphodiesterase 3a
Length=433 Score = 180 bits (456), Expect = 6e-49, Method: Compositional matrix adjust. Identities = 139/445 (31%), Positives = 212/445 (48%), Gaps = 46/445 (10%) Query 191 PSPPAPGAP-VSRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGEY 249 P PA P V + +TDLH D Y TD D +G+ AS PG +G+ Sbjct 12 PLAPAXXXPAVGQFWHVTDLHLDPTY-HITD-DRTKVCASSKGAN---ASNPGP--FGD- 63 Query 250 SKCDLPLRTLESLLSGLGPAG-PFDMVYWTGDIPAHD-VWHQTRQDQLRALTTVTALVRK 307 CD P + + S + +G + WTGD P H V + ++ +T +T V+ Sbjct 64 VLCDSPYQLILSAFDFIKNSGQEASFMIWTGDSPPHVPVPELSTGTVIKVITNMTMTVQN 123 Query 308 FLGPVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGG 367 + V+PA+GNH+ P + P + +Y A+A W+PWL EA+ TL+ GG Sbjct 124 LFPNLQVFPALGNHDYWPQDQLPI-------VTSKVYSAVADLWKPWLGEEAISTLKKGG 176 Query 368 FYA--LSPYPGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGDKVHII 425 FY+ ++ PGLR+ISLN N N + +N TDPA Q +WL L ++ +KV+II Sbjct 177 FYSQKVASNPGLRIISLNTNLYYGPNI-MTLNKTDPANQFEWLENTLNSSLWNKEKVYII 235 Query 426 GHIPPGH---------CLKSWSWNYYRIVARYENTLAAQFFGHTHVDEFEVFYDEETLSR 476 H+P G+ + ++ I RY + +A QF+GHTH D V D+ Sbjct 236 AHVPVGYLPYATDTPAIRQYYNEKLLDIFRRYSSVIAGQFYGHTHRDSLMVLSDKN--GN 293 Query 477 PLAVAFLAPSATTYIGL------NPGYRVYQIDGNYSGSSHVVLDHETYILNLTQANIPG 530 PL F+AP+ T G+ NPG R++Q Y + +LD Y LNLT+AN+ G Sbjct 294 PLNSVFVAPAVTPVKGVLQKETNNPGVRLFQ----YKPGDYTLLDMVQYYLNLTEANLKG 349 Query 531 AIPHWQLLYRARETYGLPNTLPTAWHNLVYRM-RGDMQLFQTFWFLYHKGHPPSEPCGTP 589 +W L Y + Y + + P + + LV + D + F ++ Y + S C Sbjct 350 E-SNWTLEYVLTQAYSVADLQPKSLYALVQQFATKDSKQFLKYYHYYFVSYDSSATCDQH 408 Query 590 CRLATLCA--QLSARADSPALCRHL 612 C+ +CA L + + L +HL Sbjct 409 CKTLQVCAIMNLDSMSYDDCLKQHL 433
>8w6p_A A Acid sphingomyelinase-like phosphodiesterase 3a
Length=413 Score = 178 bits (451), Expect = 2e-48, Method: Compositional matrix adjust. Identities = 135/435 (31%), Positives = 208/435 (48%), Gaps = 45/435 (10%) Query 200 VSRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGEYSKCDLPLRTL 259 V + +TDLH D Y TD D +G+ AS PG +G+ CD P + + Sbjct 2 VGQFWHVTDLHLDPTY-HITD-DRTKVCASSKGAN---ASNPGP--FGD-VLCDSPYQLI 53 Query 260 ESLLSGLGPAG-PFDMVYWTGDIPAHD-VWHQTRQDQLRALTTVTALVRKFLGPVPVYPA 317 S + +G + WTGD P H V + ++ +T +T V+ + V+PA Sbjct 54 LSAFDFIKNSGQEASFMIWTGDSPPHVPVPELSTGTVIKVITNMTMTVQNLFPNLQVFPA 113 Query 318 VGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGGFYA--LSPYP 375 +GNH+ P + P + +Y A+A W+PWL EA+ TL+ GGFY+ ++ P Sbjct 114 LGNHDYWPQDQLPI-------VTSKVYSAVADLWKPWLGEEAISTLKKGGFYSQKVASNP 166 Query 376 GLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGDKVHIIGHIPPGH--- 432 GLR+ISLN N N + +N TDPA Q +WL L ++ +KV+II H+P G+ Sbjct 167 GLRIISLNTNLYYGPNI-MTLNKTDPANQFEWLENTLNSSLWNKEKVYIIAHVPVGYLPY 225 Query 433 ------CLKSWSWNYYRIVARYENTLAAQFFGHTHVDEFEVFYDEETLSRPLAVAFLAPS 486 + ++ I RY + +A QF+GHTH D V D+ PL F+AP+ Sbjct 226 ATDTPAIRQYYNEKLLDIFRRYSSVIAGQFYGHTHRDSLMVLSDKN--GNPLNSVFVAPA 283 Query 487 ATTYIGL------NPGYRVYQIDGNYSGSSHVVLDHETYILNLTQANIPGAIPHWQLLYR 540 T G+ NPG R++Q Y + +LD Y LNLT+AN+ G +W L Y Sbjct 284 VTPVKGVLQKETNNPGVRLFQ----YKPGDYTLLDMVQYYLNLTEANLKGE-SNWTLEYV 338 Query 541 ARETYGLPNTLPTAWHNLVYRM-RGDMQLFQTFWFLYHKGHPPSEPCGTPCRLATLCA-- 597 + Y + + P + + LV + D + F ++ Y + S C C+ +CA Sbjct 339 LTQAYSVADLQPKSLYALVQQFATKDSKQFLKYYHYYFVSYDSSATCDQHCKTLQVCAIM 398 Query 598 QLSARADSPALCRHL 612 L + + L +HL Sbjct 399 NLDSMSYDDCLKQHL 413
>8w6p_B B Acid sphingomyelinase-like phosphodiesterase 3a
Length=413 Score = 178 bits (451), Expect = 2e-48, Method: Compositional matrix adjust. Identities = 135/435 (31%), Positives = 208/435 (48%), Gaps = 45/435 (10%) Query 200 VSRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGEYSKCDLPLRTL 259 V + +TDLH D Y TD D +G+ AS PG +G+ CD P + + Sbjct 2 VGQFWHVTDLHLDPTY-HITD-DRTKVCASSKGAN---ASNPGP--FGD-VLCDSPYQLI 53 Query 260 ESLLSGLGPAG-PFDMVYWTGDIPAHD-VWHQTRQDQLRALTTVTALVRKFLGPVPVYPA 317 S + +G + WTGD P H V + ++ +T +T V+ + V+PA Sbjct 54 LSAFDFIKNSGQEASFMIWTGDSPPHVPVPELSTGTVIKVITNMTMTVQNLFPNLQVFPA 113 Query 318 VGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGGFYA--LSPYP 375 +GNH+ P + P + +Y A+A W+PWL EA+ TL+ GGFY+ ++ P Sbjct 114 LGNHDYWPQDQLPI-------VTSKVYSAVADLWKPWLGEEAISTLKKGGFYSQKVASNP 166 Query 376 GLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGDKVHIIGHIPPGH--- 432 GLR+ISLN N N + +N TDPA Q +WL L ++ +KV+II H+P G+ Sbjct 167 GLRIISLNTNLYYGPNI-MTLNKTDPANQFEWLENTLNSSLWNKEKVYIIAHVPVGYLPY 225 Query 433 ------CLKSWSWNYYRIVARYENTLAAQFFGHTHVDEFEVFYDEETLSRPLAVAFLAPS 486 + ++ I RY + +A QF+GHTH D V D+ PL F+AP+ Sbjct 226 ATDTPAIRQYYNEKLLDIFRRYSSVIAGQFYGHTHRDSLMVLSDKN--GNPLNSVFVAPA 283 Query 487 ATTYIGL------NPGYRVYQIDGNYSGSSHVVLDHETYILNLTQANIPGAIPHWQLLYR 540 T G+ NPG R++Q Y + +LD Y LNLT+AN+ G +W L Y Sbjct 284 VTPVKGVLQKETNNPGVRLFQ----YKPGDYTLLDMVQYYLNLTEANLKGE-SNWTLEYV 338 Query 541 ARETYGLPNTLPTAWHNLVYRM-RGDMQLFQTFWFLYHKGHPPSEPCGTPCRLATLCA-- 597 + Y + + P + + LV + D + F ++ Y + S C C+ +CA Sbjct 339 LTQAYSVADLQPKSLYALVQQFATKDSKQFLKYYHYYFVSYDSSATCDQHCKTLQVCAIM 398 Query 598 QLSARADSPALCRHL 612 L + + L +HL Sbjct 399 NLDSMSYDDCLKQHL 413
>8w6r_A A Acid sphingomyelinase-like phosphodiesterase 3a
Length=422 Score = 177 bits (450), Expect = 3e-48, Method: Compositional matrix adjust. Identities = 133/430 (31%), Positives = 206/430 (48%), Gaps = 43/430 (10%) Query 200 VSRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGEYSKCDLPLRTL 259 V + +TDLH D Y TD D +G+ AS PG +G+ CD P + + Sbjct 12 VGQFWHVTDLHLDPTY-HITD-DRTKVCASSKGAN---ASNPGP--FGD-VLCDSPYQLI 63 Query 260 ESLLSGLGPAG-PFDMVYWTGDIPAHD-VWHQTRQDQLRALTTVTALVRKFLGPVPVYPA 317 S + +G + WTGD P H V + ++ +T +T V+ + V+PA Sbjct 64 LSAFDFIKNSGQEASFMIWTGDSPPHVPVPELSTGTVIKVITNMTMTVQNLFPNLQVFPA 123 Query 318 VGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGGFYA--LSPYP 375 +GNH+ P + P + +Y A+A W+PWL EA+ TL+ GGFY+ ++ P Sbjct 124 LGNHDYWPQDQLPI-------VTSKVYSAVADLWKPWLGEEAISTLKKGGFYSQKVASNP 176 Query 376 GLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGDKVHIIGHIPPGH--- 432 GLR+ISLN N N + +N TDPA Q +WL L ++ +KV+II H+P G+ Sbjct 177 GLRIISLNTNLYYGPNI-MTLNKTDPANQFEWLENTLNSSLWNKEKVYIIAHVPVGYLPY 235 Query 433 ------CLKSWSWNYYRIVARYENTLAAQFFGHTHVDEFEVFYDEETLSRPLAVAFLAPS 486 + ++ I RY + +A QF+GHTH D V D+ PL F+AP+ Sbjct 236 ATDTPAIRQYYNEKLLDIFRRYSSVIAGQFYGHTHRDSLMVLSDKN--GNPLNSVFVAPA 293 Query 487 ATTYIGL------NPGYRVYQIDGNYSGSSHVVLDHETYILNLTQANIPGAIPHWQLLYR 540 T G+ NPG R++Q Y + +LD Y LNLT+AN+ G +W L Y Sbjct 294 VTPVKGVLQKETNNPGVRLFQ----YKPGDYTLLDMVQYYLNLTEANLKGE-SNWTLEYV 348 Query 541 ARETYGLPNTLPTAWHNLVYRM-RGDMQLFQTFWFLYHKGHPPSEPCGTPCRLATLCAQL 599 + Y + + P + + LV + D + F ++ Y + S C C+ +CA + Sbjct 349 LTQAYSVADLQPKSLYALVQQFATKDSKQFLKYYHYYFVSYDSSATCDQHCKTLQVCAIM 408 Query 600 SARADSPALC 609 + + S C Sbjct 409 NLDSMSYDDC 418
>5ebb_B B Acid sphingomyelinase-like phosphodiesterase 3a
Length=410 Score = 177 bits (448), Expect = 5e-48, Method: Compositional matrix adjust. Identities = 135/437 (31%), Positives = 208/437 (48%), Gaps = 47/437 (11%) Query 193 PPAPGAPVSRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGEYSKC 252 PPA G + +TDLH D Y TD D +G+ AS PG +G+ C Sbjct 1 PPAIG----QFWHVTDLHLDPTY-HITD-DHTKVCASSKGAN---ASNPGP--FGDV-LC 48 Query 253 DLPLRTLESLLSGLGPAG-PFDMVYWTGDIPAHDVWHQTRQDQ-LRALTTVTALVRKFLG 310 D P + + S + +G + WTGD P H + D + +T +T ++ Sbjct 49 DSPYQLILSAFDFIKNSGQEASFMIWTGDSPPHVPVPELSTDTVINVITNMTTTIQSLFP 108 Query 311 PVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGGFYA 370 + V+PA+GNH+ P + P + +Y A+A W+PWL EA+ TLR GGFY+ Sbjct 109 NLQVFPALGNHDYWPQDQLPV-------VTSKVYNAVANLWKPWLDEEAISTLRKGGFYS 161 Query 371 --LSPYPGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGDKVHIIGHI 428 ++ P LR+ISLN N N + +N TDPA Q +WL L ++ +KV+II H+ Sbjct 162 QKVTTNPNLRIISLNTNLYYGPNI-MTLNKTDPANQFEWLESTLNNSQQNKEKVYIIAHV 220 Query 429 PPGHCLKSWSWN----YYR-----IVARYENTLAAQFFGHTHVDEFEVFYDEETLSRPLA 479 P G+ S + YY I +Y + +A QF+GHTH D V D++ P+ Sbjct 221 PVGYLPSSQNITAMREYYNEKLIDIFQKYSDVIAGQFYGHTHRDSIMVLSDKK--GSPVN 278 Query 480 VAFLAPSATTYIGL------NPGYRVYQIDGNYSGSSHVVLDHETYILNLTQANIPGAIP 533 F+AP+ T + NPG R++Q Y + +LD Y LNLT+AN+ G Sbjct 279 SLFVAPAVTPVKSVLEKQTNNPGIRLFQ----YDPRDYKLLDMLQYYLNLTEANLKGE-S 333 Query 534 HWQLLYRARETYGLPNTLPTAWHNLVYRMRG-DMQLFQTFWFLYHKGHPPSEPCGTPCRL 592 W+L Y +TY + + P + + L + D + F ++ + + S C C+ Sbjct 334 IWKLEYILTQTYDIEDLQPESLYGLAKQFTILDSKQFIKYYNYFFVSYDSSVTCDKTCKA 393 Query 593 ATLCAQLSARADSPALC 609 +CA ++ S A C Sbjct 394 FQICAIMNLDNISYADC 410
>5ebb_C C Acid sphingomyelinase-like phosphodiesterase 3a
Length=410 Score = 177 bits (448), Expect = 5e-48, Method: Compositional matrix adjust. Identities = 135/437 (31%), Positives = 208/437 (48%), Gaps = 47/437 (11%) Query 193 PPAPGAPVSRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGEYSKC 252 PPA G + +TDLH D Y TD D +G+ AS PG +G+ C Sbjct 1 PPAIG----QFWHVTDLHLDPTY-HITD-DHTKVCASSKGAN---ASNPGP--FGDV-LC 48 Query 253 DLPLRTLESLLSGLGPAG-PFDMVYWTGDIPAHDVWHQTRQDQ-LRALTTVTALVRKFLG 310 D P + + S + +G + WTGD P H + D + +T +T ++ Sbjct 49 DSPYQLILSAFDFIKNSGQEASFMIWTGDSPPHVPVPELSTDTVINVITNMTTTIQSLFP 108 Query 311 PVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGGFYA 370 + V+PA+GNH+ P + P + +Y A+A W+PWL EA+ TLR GGFY+ Sbjct 109 NLQVFPALGNHDYWPQDQLPV-------VTSKVYNAVANLWKPWLDEEAISTLRKGGFYS 161 Query 371 --LSPYPGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGDKVHIIGHI 428 ++ P LR+ISLN N N + +N TDPA Q +WL L ++ +KV+II H+ Sbjct 162 QKVTTNPNLRIISLNTNLYYGPNI-MTLNKTDPANQFEWLESTLNNSQQNKEKVYIIAHV 220 Query 429 PPGHCLKSWSWN----YYR-----IVARYENTLAAQFFGHTHVDEFEVFYDEETLSRPLA 479 P G+ S + YY I +Y + +A QF+GHTH D V D++ P+ Sbjct 221 PVGYLPSSQNITAMREYYNEKLIDIFQKYSDVIAGQFYGHTHRDSIMVLSDKK--GSPVN 278 Query 480 VAFLAPSATTYIGL------NPGYRVYQIDGNYSGSSHVVLDHETYILNLTQANIPGAIP 533 F+AP+ T + NPG R++Q Y + +LD Y LNLT+AN+ G Sbjct 279 SLFVAPAVTPVKSVLEKQTNNPGIRLFQ----YDPRDYKLLDMLQYYLNLTEANLKGE-S 333 Query 534 HWQLLYRARETYGLPNTLPTAWHNLVYRMRG-DMQLFQTFWFLYHKGHPPSEPCGTPCRL 592 W+L Y +TY + + P + + L + D + F ++ + + S C C+ Sbjct 334 IWKLEYILTQTYDIEDLQPESLYGLAKQFTILDSKQFIKYYNYFFVSYDSSVTCDKTCKA 393 Query 593 ATLCAQLSARADSPALC 609 +CA ++ S A C Sbjct 394 FQICAIMNLDNISYADC 410
>5ebb_A A Acid sphingomyelinase-like phosphodiesterase 3a
Length=410 Score = 177 bits (448), Expect = 5e-48, Method: Compositional matrix adjust. Identities = 135/437 (31%), Positives = 208/437 (48%), Gaps = 47/437 (11%) Query 193 PPAPGAPVSRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGEYSKC 252 PPA G + +TDLH D Y TD D +G+ AS PG +G+ C Sbjct 1 PPAIG----QFWHVTDLHLDPTY-HITD-DHTKVCASSKGAN---ASNPGP--FGDV-LC 48 Query 253 DLPLRTLESLLSGLGPAG-PFDMVYWTGDIPAHDVWHQTRQDQ-LRALTTVTALVRKFLG 310 D P + + S + +G + WTGD P H + D + +T +T ++ Sbjct 49 DSPYQLILSAFDFIKNSGQEASFMIWTGDSPPHVPVPELSTDTVINVITNMTTTIQSLFP 108 Query 311 PVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGGFYA 370 + V+PA+GNH+ P + P + +Y A+A W+PWL EA+ TLR GGFY+ Sbjct 109 NLQVFPALGNHDYWPQDQLPV-------VTSKVYNAVANLWKPWLDEEAISTLRKGGFYS 161 Query 371 --LSPYPGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGDKVHIIGHI 428 ++ P LR+ISLN N N + +N TDPA Q +WL L ++ +KV+II H+ Sbjct 162 QKVTTNPNLRIISLNTNLYYGPNI-MTLNKTDPANQFEWLESTLNNSQQNKEKVYIIAHV 220 Query 429 PPGHCLKSWSWN----YYR-----IVARYENTLAAQFFGHTHVDEFEVFYDEETLSRPLA 479 P G+ S + YY I +Y + +A QF+GHTH D V D++ P+ Sbjct 221 PVGYLPSSQNITAMREYYNEKLIDIFQKYSDVIAGQFYGHTHRDSIMVLSDKK--GSPVN 278 Query 480 VAFLAPSATTYIGL------NPGYRVYQIDGNYSGSSHVVLDHETYILNLTQANIPGAIP 533 F+AP+ T + NPG R++Q Y + +LD Y LNLT+AN+ G Sbjct 279 SLFVAPAVTPVKSVLEKQTNNPGIRLFQ----YDPRDYKLLDMLQYYLNLTEANLKGE-S 333 Query 534 HWQLLYRARETYGLPNTLPTAWHNLVYRMRG-DMQLFQTFWFLYHKGHPPSEPCGTPCRL 592 W+L Y +TY + + P + + L + D + F ++ + + S C C+ Sbjct 334 IWKLEYILTQTYDIEDLQPESLYGLAKQFTILDSKQFIKYYNYFFVSYDSSVTCDKTCKA 393 Query 593 ATLCAQLSARADSPALC 609 +CA ++ S A C Sbjct 394 FQICAIMNLDNISYADC 410
>5ebe_B B Acid sphingomyelinase-like phosphodiesterase 3a
Length=415 Score = 177 bits (448), Expect = 5e-48, Method: Compositional matrix adjust. Identities = 135/437 (31%), Positives = 208/437 (48%), Gaps = 47/437 (11%) Query 193 PPAPGAPVSRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGEYSKC 252 PPA G + +TDLH D Y TD D +G+ AS PG +G+ C Sbjct 2 PPAIG----QFWHVTDLHLDPTY-HITD-DHTKVCASSKGAN---ASNPGP--FGDV-LC 49 Query 253 DLPLRTLESLLSGLGPAG-PFDMVYWTGDIPAHDVWHQTRQDQ-LRALTTVTALVRKFLG 310 D P + + S + +G + WTGD P H + D + +T +T ++ Sbjct 50 DSPYQLILSAFDFIKNSGQEASFMIWTGDSPPHVPVPELSTDTVINVITNMTTTIQSLFP 109 Query 311 PVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGGFYA 370 + V+PA+GNH+ P + P + +Y A+A W+PWL EA+ TLR GGFY+ Sbjct 110 NLQVFPALGNHDYWPQDQLPV-------VTSKVYNAVANLWKPWLDEEAISTLRKGGFYS 162 Query 371 --LSPYPGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGDKVHIIGHI 428 ++ P LR+ISLN N N + +N TDPA Q +WL L ++ +KV+II H+ Sbjct 163 QKVTTNPNLRIISLNTNLYYGPNI-MTLNKTDPANQFEWLESTLNNSQQNKEKVYIIAHV 221 Query 429 PPGHCLKSWSWN----YYR-----IVARYENTLAAQFFGHTHVDEFEVFYDEETLSRPLA 479 P G+ S + YY I +Y + +A QF+GHTH D V D++ P+ Sbjct 222 PVGYLPSSQNITAMREYYNEKLIDIFQKYSDVIAGQFYGHTHRDSIMVLSDKK--GSPVN 279 Query 480 VAFLAPSATTYIGL------NPGYRVYQIDGNYSGSSHVVLDHETYILNLTQANIPGAIP 533 F+AP+ T + NPG R++Q Y + +LD Y LNLT+AN+ G Sbjct 280 SLFVAPAVTPVKSVLEKQTNNPGIRLFQ----YDPRDYKLLDMLQYYLNLTEANLKGE-S 334 Query 534 HWQLLYRARETYGLPNTLPTAWHNLVYRMRG-DMQLFQTFWFLYHKGHPPSEPCGTPCRL 592 W+L Y +TY + + P + + L + D + F ++ + + S C C+ Sbjct 335 IWKLEYILTQTYDIEDLQPESLYGLAKQFTILDSKQFIKYYNYFFVSYDSSVTCDKTCKA 394 Query 593 ATLCAQLSARADSPALC 609 +CA ++ S A C Sbjct 395 FQICAIMNLDNISYADC 411
>5ebe_C C Acid sphingomyelinase-like phosphodiesterase 3a
Length=415 Score = 177 bits (448), Expect = 5e-48, Method: Compositional matrix adjust. Identities = 135/437 (31%), Positives = 208/437 (48%), Gaps = 47/437 (11%) Query 193 PPAPGAPVSRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGEYSKC 252 PPA G + +TDLH D Y TD D +G+ AS PG +G+ C Sbjct 2 PPAIG----QFWHVTDLHLDPTY-HITD-DHTKVCASSKGAN---ASNPGP--FGDV-LC 49 Query 253 DLPLRTLESLLSGLGPAG-PFDMVYWTGDIPAHDVWHQTRQDQ-LRALTTVTALVRKFLG 310 D P + + S + +G + WTGD P H + D + +T +T ++ Sbjct 50 DSPYQLILSAFDFIKNSGQEASFMIWTGDSPPHVPVPELSTDTVINVITNMTTTIQSLFP 109 Query 311 PVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGGFYA 370 + V+PA+GNH+ P + P + +Y A+A W+PWL EA+ TLR GGFY+ Sbjct 110 NLQVFPALGNHDYWPQDQLPV-------VTSKVYNAVANLWKPWLDEEAISTLRKGGFYS 162 Query 371 --LSPYPGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGDKVHIIGHI 428 ++ P LR+ISLN N N + +N TDPA Q +WL L ++ +KV+II H+ Sbjct 163 QKVTTNPNLRIISLNTNLYYGPNI-MTLNKTDPANQFEWLESTLNNSQQNKEKVYIIAHV 221 Query 429 PPGHCLKSWSWN----YYR-----IVARYENTLAAQFFGHTHVDEFEVFYDEETLSRPLA 479 P G+ S + YY I +Y + +A QF+GHTH D V D++ P+ Sbjct 222 PVGYLPSSQNITAMREYYNEKLIDIFQKYSDVIAGQFYGHTHRDSIMVLSDKK--GSPVN 279 Query 480 VAFLAPSATTYIGL------NPGYRVYQIDGNYSGSSHVVLDHETYILNLTQANIPGAIP 533 F+AP+ T + NPG R++Q Y + +LD Y LNLT+AN+ G Sbjct 280 SLFVAPAVTPVKSVLEKQTNNPGIRLFQ----YDPRDYKLLDMLQYYLNLTEANLKGE-S 334 Query 534 HWQLLYRARETYGLPNTLPTAWHNLVYRMRG-DMQLFQTFWFLYHKGHPPSEPCGTPCRL 592 W+L Y +TY + + P + + L + D + F ++ + + S C C+ Sbjct 335 IWKLEYILTQTYDIEDLQPESLYGLAKQFTILDSKQFIKYYNYFFVSYDSSVTCDKTCKA 394 Query 593 ATLCAQLSARADSPALC 609 +CA ++ S A C Sbjct 395 FQICAIMNLDNISYADC 411
>5ebe_A A Acid sphingomyelinase-like phosphodiesterase 3a
Length=418 Score = 176 bits (447), Expect = 7e-48, Method: Compositional matrix adjust. Identities = 135/437 (31%), Positives = 208/437 (48%), Gaps = 47/437 (11%) Query 193 PPAPGAPVSRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGEYSKC 252 PPA G + +TDLH D Y TD D +G+ AS PG +G+ C Sbjct 2 PPAIG----QFWHVTDLHLDPTY-HITD-DHTKVCASSKGAN---ASNPGP--FGD-VLC 49 Query 253 DLPLRTLESLLSGLGPAG-PFDMVYWTGDIPAHDVWHQTRQDQ-LRALTTVTALVRKFLG 310 D P + + S + +G + WTGD P H + D + +T +T ++ Sbjct 50 DSPYQLILSAFDFIKNSGQEASFMIWTGDSPPHVPVPELSTDTVINVITNMTTTIQSLFP 109 Query 311 PVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGGFYA 370 + V+PA+GNH+ P + P + +Y A+A W+PWL EA+ TLR GGFY+ Sbjct 110 NLQVFPALGNHDYWPQDQLPV-------VTSKVYNAVANLWKPWLDEEAISTLRKGGFYS 162 Query 371 --LSPYPGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGDKVHIIGHI 428 ++ P LR+ISLN N N + +N TDPA Q +WL L ++ +KV+II H+ Sbjct 163 QKVTTNPNLRIISLNTNLYYGPNI-MTLNKTDPANQFEWLESTLNNSQQNKEKVYIIAHV 221 Query 429 PPGHCLKSWSWN----YYR-----IVARYENTLAAQFFGHTHVDEFEVFYDEETLSRPLA 479 P G+ S + YY I +Y + +A QF+GHTH D V D++ P+ Sbjct 222 PVGYLPSSQNITAMREYYNEKLIDIFQKYSDVIAGQFYGHTHRDSIMVLSDKK--GSPVN 279 Query 480 VAFLAPSATTYIGL------NPGYRVYQIDGNYSGSSHVVLDHETYILNLTQANIPGAIP 533 F+AP+ T + NPG R++Q Y + +LD Y LNLT+AN+ G Sbjct 280 SLFVAPAVTPVKSVLEKQTNNPGIRLFQ----YDPRDYKLLDMLQYYLNLTEANLKGE-S 334 Query 534 HWQLLYRARETYGLPNTLPTAWHNLVYRMRG-DMQLFQTFWFLYHKGHPPSEPCGTPCRL 592 W+L Y +TY + + P + + L + D + F ++ + + S C C+ Sbjct 335 IWKLEYILTQTYDIEDLQPESLYGLAKQFTILDSKQFIKYYNYFFVSYDSSVTCDKTCKA 394 Query 593 ATLCAQLSARADSPALC 609 +CA ++ S A C Sbjct 395 FQICAIMNLDNISYADC 411
>5kas_A A Acid sphingomyelinase-like phosphodiesterase 3b
Length=427 Score = 173 bits (438), Expect = 2e-46, Method: Compositional matrix adjust. Identities = 129/435 (30%), Positives = 195/435 (45%), Gaps = 47/435 (11%) Query 200 VSRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGEYSKCDLPLRTL 259 + R ++DLH D +Y DP P +G P AG WG+Y CD P + Sbjct 12 LGRFWHISDLHLDPNYTVSKDPLQVCP-----SAGSQPVL--NAGPWGDY-LCDSPWALI 63 Query 260 ESLLSGLGPAGPF-DMVYWTGDIPAHDVWHQTRQDQLRALTT-VTALVRKFLGPVPVYPA 317 S L + P D + WTGD H + + A+ +T L+++ VY A Sbjct 64 NSSLYAMKEIEPKPDFILWTGDDTPHVPNESLGEAAVLAIVERLTNLIKEVFPDTKVYAA 123 Query 318 VGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGGFYALS---PY 374 +GNH+ P N FP S +Y +A+ W PWL E+ + G FY+ P Sbjct 124 LGNHDFHPKNQFPA-------QSNRIYNQVAELWRPWLSNESYALFKRGAFYSEKLPGPS 176 Query 375 PGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGDKVHIIGHIPPGHCL 434 R++ LN N N DP Q +WL L A G+ V++IGH+PPG Sbjct 177 RAGRVVVLNTNLYYSNN-EQTAGMADPGEQFRWLGDVLSNASRDGEMVYVIGHVPPGFFE 235 Query 435 K---------SWSWNYYRIVARYENTLAAQFFGHTHVDEFEVFYDEETLSRPLAVAFLAP 485 K S++ Y +++ ++ +A QFFGH H D F +FYD P+ V FL P Sbjct 236 KTQNKAWFRESFNEEYLKVIQKHHRVIAGQFFGHHHTDSFRMFYD--NTGAPINVMFLTP 293 Query 486 SA----TTYIGL-----NPGYRVYQIDGNYSGSSHVVLDHETYILNLTQANIPGAIPHWQ 536 TT G+ NPG R+++ Y ++ + D TY LNL QAN+ P W+ Sbjct 294 GVTPWKTTLPGVVDGANNPGIRIFE----YDRATLNLKDLVTYFLNLRQANVQ-ETPRWE 348 Query 537 LLYRARETYGLPNTLPTAWHNLVYRMRGDMQLFQTFWFLYHKGHPPSEPCGTPCRLATLC 596 YR E Y +P+ ++ H + R+ + + Q + ++Y+ C CR+ +C Sbjct 349 QEYRLTEAYQVPDASVSSMHTALTRIASEPHILQRY-YVYNSVSYNHLTCEDSCRIEHVC 407 Query 597 AQLSARADSPALCRH 611 A ++ A C H Sbjct 408 AIQHVAFNTYATCLH 422
>5kar_A A Acid sphingomyelinase-like phosphodiesterase 3b
Length=427 Score = 173 bits (438), Expect = 2e-46, Method: Compositional matrix adjust. Identities = 129/435 (30%), Positives = 195/435 (45%), Gaps = 47/435 (11%) Query 200 VSRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGEYSKCDLPLRTL 259 + R ++DLH D +Y DP P +G P AG WG+Y CD P + Sbjct 12 LGRFWHISDLHLDPNYTVSKDPLQVCP-----SAGSQPVL--NAGPWGDY-LCDSPWALI 63 Query 260 ESLLSGLGPAGPF-DMVYWTGDIPAHDVWHQTRQDQLRALTT-VTALVRKFLGPVPVYPA 317 S L + P D + WTGD H + + A+ +T L+++ VY A Sbjct 64 NSSLYAMKEIEPKPDFILWTGDDTPHVPNESLGEAAVLAIVERLTNLIKEVFPDTKVYAA 123 Query 318 VGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGGFYALS---PY 374 +GNH+ P N FP S +Y +A+ W PWL E+ + G FY+ P Sbjct 124 LGNHDFHPKNQFPA-------QSNRIYNQVAELWRPWLSNESYALFKRGAFYSEKLPGPS 176 Query 375 PGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGDKVHIIGHIPPGHCL 434 R++ LN N N DP Q +WL L A G+ V++IGH+PPG Sbjct 177 RAGRVVVLNTNLYYSNN-EQTAGMADPGEQFRWLGDVLSNASRDGEMVYVIGHVPPGFFE 235 Query 435 K---------SWSWNYYRIVARYENTLAAQFFGHTHVDEFEVFYDEETLSRPLAVAFLAP 485 K S++ Y +++ ++ +A QFFGH H D F +FYD P+ V FL P Sbjct 236 KTQNKAWFRESFNEEYLKVIQKHHRVIAGQFFGHHHTDSFRMFYD--NTGAPINVMFLTP 293 Query 486 SA----TTYIGL-----NPGYRVYQIDGNYSGSSHVVLDHETYILNLTQANIPGAIPHWQ 536 TT G+ NPG R+++ Y ++ + D TY LNL QAN+ P W+ Sbjct 294 GVTPWKTTLPGVVDGANNPGIRIFE----YDRATLNLKDLVTYFLNLRQANVQ-ETPRWE 348 Query 537 LLYRARETYGLPNTLPTAWHNLVYRMRGDMQLFQTFWFLYHKGHPPSEPCGTPCRLATLC 596 YR E Y +P+ ++ H + R+ + + Q + ++Y+ C CR+ +C Sbjct 349 QEYRLTEAYQVPDASVSSMHTALTRIASEPHILQRY-YVYNSVSYNHLTCEDSCRIEHVC 407 Query 597 AQLSARADSPALCRH 611 A ++ A C H Sbjct 408 AIQHVAFNTYATCLH 422 Lambda K H a alpha 0.322 0.139 0.468 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 68514690699 Database: unitmol_20240403.fasta Posted date: Apr 4, 2024 8:53 PM Number of letters in database: 237,935,689 Number of sequences in database: 829,018 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40