Contact Molecules for Homologous Proteins | ||||
[Summary Bars] |
[SiteTable] |
|
[Back to Search Page] |
[Back to HOMCOS] |
[SupCon3D] |
[help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
31126 | 468 | 38 | P08887(IL6RA_HUMAN) | RecName: Full=Interleukin-6 receptor subunit alpha ; Short=IL-6 receptor subunit alpha; Short=IL-6R subunit alpha; Short=IL-6R-alpha; Short=IL-6RA;AltName: Full=IL-6R 1;AltName: Full=Membrane glycoprotein 80; Short=gp80;AltName: CD_antigen=CD126;Contains: RecName: Full=Soluble interleukin-6 receptor subunit alpha ; Short=sIL6R ;Flags: Precursor; |
QUERYSEQ |
MLAVGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLV RKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQ GEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPRPTPVLVPLISPPVSPSSLGSDNTSSHNRPDA RDPRSPYDISNTDYFFPR |
468 | region | name | description |
1-19 | SIGNAL | ||
20-468 | CHAIN | /note="Interleukin-6 receptor subunit alpha" /id="PRO_0000010895" | |
20-355 | CHAIN | /note="Soluble interleukin-6 receptor subunit alpha" /id="PRO_0000450730" | |
20-365 | TOPO_DOM | /note="Extracellular" | |
366-386 | TRANSMEM | /note="Helical" | |
387-468 | TOPO_DOM | /note="Cytoplasmic" | |
26-112 | DOMAIN | /note="Ig-like C2-type" | |
113-217 | DOMAIN | /note="Fibronectin type-III 1" | |
218-316 | DOMAIN | /note="Fibronectin type-III 2" | |
303-328 | REGION | /note="Disordered" | |
421-468 | REGION | /note="Disordered" | |
311-328 | COMPBIAS | /note="Polar residues" | |
1-468 | DISORDER | predicted by DISOPRED |
MONOMER | |||||||
468 | |||||||
pdb_id | a1 | identity[%]2 | description | ||||
1n26 | A | 100.0 | IL6A_HUMAN IL-6 Receptor alpha chain | ||||
8d82 | A | 100.0 | IL6RA_HUMAN Soluble interleukin-6 receptor subunit alpha | ||||
8d82 | D | 100.0 | IL6RA_HUMAN Soluble interleukin-6 receptor subunit alpha | ||||
1p9m | C | 100.0 | IL6RA_HUMAN Interleukin-6 receptor alpha chain | ||||
8qy6 | E | 100.0 | IL6RA_HUMAN Interleukin-6 receptor subunit alpha | ||||
8qy6 | C | 100.0 | IL6RA_HUMAN Interleukin-6 receptor subunit alpha | ||||
8qy5 | C | 100.0 | IL6RA_HUMAN Interleukin-6 receptor subunit alpha | ||||
8qy5 | E | 100.0 | IL6RA_HUMAN Interleukin-6 receptor subunit alpha | ||||
5fuc | C | 99.0 | D6R9R8_HUMAN IL6RA_HUMAN INTERLEUKIN-6 RECEPTOR SUBUNIT ALPHA, INTERLEUKIN-6 RECEPTOR | ||||
5fuc | D | 99.0 | D6R9R8_HUMAN IL6RA_HUMAN INTERLEUKIN-6 RECEPTOR SUBUNIT ALPHA, INTERLEUKIN-6 RECEPTOR | ||||
7dc8 | C | 99.5 | IL6RA_HUMAN Interleukin-6 receptor subunit alpha | ||||
7dc8 | F | 99.5 | IL6RA_HUMAN Interleukin-6 receptor subunit alpha | ||||
2arw | A | 100.0 | IL6RA_HUMAN Interleukin-6 receptor alpha chain | ||||
8iow | A | 100.0 | IL6RA_HUMAN Interleukin-6 receptor subunit alpha | ||||
8j6f | C | 100.0 | IL6RA_HUMAN Interleukin-6 receptor subunit alpha | ||||
8dpt | C | 34.2 | I11RA_HUMAN Interleukin-11 receptor subunit alpha | ||||
8dpt | F | 34.2 | I11RA_HUMAN Interleukin-11 receptor subunit alpha | ||||
6o4p | A | 35.0 | I11RA_HUMAN Interleukin-11 receptor subunit alpha | ||||
6o4p | B | 35.4 | I11RA_HUMAN Interleukin-11 receptor subunit alpha | ||||
8dpu | R | 35.3 | I11RA_HUMAN Interleukin-11 receptor subunit alpha | ||||
8dpu | O | 35.3 | I11RA_HUMAN Interleukin-11 receptor subunit alpha | ||||
8dpu | C | 35.3 | I11RA_HUMAN Interleukin-11 receptor subunit alpha | ||||
8dpu | L | 35.3 | I11RA_HUMAN Interleukin-11 receptor subunit alpha | ||||
8dpu | I | 35.3 | I11RA_HUMAN Interleukin-11 receptor subunit alpha | ||||
8dpu | F | 35.3 | I11RA_HUMAN Interleukin-11 receptor subunit alpha | ||||
8d7h | D | 33.9 | CNTFR_HUMAN Ciliary neurotrophic factor receptor subunit alpha | ||||
8d7h | A | 33.9 | CNTFR_HUMAN Ciliary neurotrophic factor receptor subunit alpha | ||||
8d7e | A | 33.9 | CNTFR_HUMAN Ciliary neurotrophic factor receptor subunit alpha | ||||
8d74 | C | 34.7 | CNTFR_HUMAN Ciliary neurotrophic factor receptor subunit alpha | ||||
8d7r | B | 34.7 | CNTFR_HUMAN Ciliary neurotrophic factor receptor subunit alpha | ||||
1uc6 | A | 40.8 | CNTFR_HUMAN Ciliary Neurotrophic Factor Receptor alpha | ||||
8dps | C | 33.9 | I11RA_HUMAN Interleukin-11 receptor subunit alpha | ||||
8dps | F | 33.9 | I11RA_HUMAN Interleukin-11 receptor subunit alpha | ||||
8qy4 | F | 31.7 | I11RA_HUMAN Interleukin-11 receptor subunit alpha | ||||
8qy4 | E | 31.7 | I11RA_HUMAN Interleukin-11 receptor subunit alpha | ||||
1bqu | A | 30.2 | IL6RB_HUMAN PROTEIN (GP130) | ||||
8upa | D | 30.9 | IL6RB_HUMAN Interleukin-6 receptor subunit beta | ||||
1f45 | A | 30.4 | I12B_HUMAN INTERLEUKIN-12 BETA CHAIN | ||||
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue. |
HETERO | |||||||
468 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
1p9m | B | IL6_HUMAN Interleukin-6[163 aa] | C | 100.0 /100.0 |
15 /15 |
IL6RA_HUMAN Interleukin-6 receptor alpha chain | |
1p9m | B | IL6_HUMAN Interleukin-6[163 aa] | C | 100.0 /100.0 |
15 /15 |
IL6RA_HUMAN Interleukin-6 receptor alpha chain | |
5fuc | B | IL6_HUMAN INTERLEUKIN-6[160 aa] | C | 100.0 /99.0 |
18 /18 |
D6R9R8_HUMAN IL6RA_HUMAN INTERLEUKIN-6 RECEPTOR SUBUNIT ALPHA, INTERLEUKIN-.. | |
8d82 | B | IL6_HUMAN Interleukin-6[169 aa] | A | 100.0 /100.0 |
12 /12 |
IL6RA_HUMAN Soluble interleukin-6 receptor subunit alpha | |
8d82 | E | IL6_HUMAN Interleukin-6[169 aa] | D | 100.0 /100.0 |
12 /12 |
IL6RA_HUMAN Soluble interleukin-6 receptor subunit alpha | |
8qy5 | B | IL6_HUMAN Interleukin-6[157 aa] | C | 100.0 /100.0 |
11 /11 |
IL6RA_HUMAN Interleukin-6 receptor subunit alpha | |
8qy5 | D | IL6_HUMAN Interleukin-6[157 aa] | E | 100.0 /100.0 |
10 /10 |
IL6RA_HUMAN Interleukin-6 receptor subunit alpha | |
8qy6 | B | IL6_HUMAN Interleukin-6[157 aa] | C | 100.0 /100.0 |
10 /10 |
IL6RA_HUMAN Interleukin-6 receptor subunit alpha | |
8qy6 | D | IL6_HUMAN Interleukin-6[157 aa] | E | 100.0 /100.0 |
11 /11 |
IL6RA_HUMAN Interleukin-6 receptor subunit alpha | |
8d82 | C | IL6RB_HUMAN Interleukin-6 receptor subunit beta[589 aa] | A | 100.0 /100.0 |
11 /11 |
IL6RA_HUMAN Soluble interleukin-6 receptor subunit alpha | |
8d82 | F | IL6RB_HUMAN Interleukin-6 receptor subunit beta[589 aa] | A | 100.0 /100.0 |
6 /6 |
IL6RA_HUMAN Soluble interleukin-6 receptor subunit alpha | |
8d82 | C | IL6RB_HUMAN Interleukin-6 receptor subunit beta[589 aa] | D | 100.0 /100.0 |
6 /6 |
IL6RA_HUMAN Soluble interleukin-6 receptor subunit alpha | |
8d82 | F | IL6RB_HUMAN Interleukin-6 receptor subunit beta[589 aa] | D | 100.0 /100.0 |
11 /11 |
IL6RA_HUMAN Soluble interleukin-6 receptor subunit alpha | |
8iow | C | Light chain of Sarilumab Fab[212 aa] | A | 100.0 /100.0 |
6 /6 |
IL6RA_HUMAN Interleukin-6 receptor subunit alpha | |
8j6f | B | Light chain of Tocilizumab Fab[209 aa] | C | 100.0 /100.0 |
12 /12 |
IL6RA_HUMAN Interleukin-6 receptor subunit alpha | |
8iow | D | Heavy chain of Sarilumab Fab[207 aa] | A | 100.0 /100.0 |
12 /12 |
IL6RA_HUMAN Interleukin-6 receptor subunit alpha | |
8j6f | A | Heavy chain of Tocilizumab Fab[211 aa] | C | 100.0 /100.0 |
14 /14 |
IL6RA_HUMAN Interleukin-6 receptor subunit alpha | |
8j6f | D | IL6RA_HUMAN IL6R-D2 peptide[10 aa] | C | 100.0 /100.0 |
6 /6 |
IL6RA_HUMAN Interleukin-6 receptor subunit alpha | |
8qy4 | B | IL6RB_MOUSE Interleukin-6 receptor subunit beta[583 aa] | E | 41.7 /31.7 |
12 /12 |
I11RA_HUMAN Interleukin-11 receptor subunit alpha | |
8qy4 | D | IL6RB_MOUSE Interleukin-6 receptor subunit beta[583 aa] | E | 0.0 /31.7 |
6 /6 |
I11RA_HUMAN Interleukin-11 receptor subunit alpha | |
8qy4 | B | IL6RB_MOUSE Interleukin-6 receptor subunit beta[583 aa] | F | 0.0 /31.7 |
6 /6 |
I11RA_HUMAN Interleukin-11 receptor subunit alpha | |
8qy4 | D | IL6RB_MOUSE Interleukin-6 receptor subunit beta[583 aa] | F | 41.7 /31.7 |
12 /12 |
I11RA_HUMAN Interleukin-11 receptor subunit alpha | |
8qy5 | A | IL6RB_MOUSE Interleukin-6 receptor subunit beta[584 aa] | C | 100.0 /100.0 |
14 /14 |
IL6RA_HUMAN Interleukin-6 receptor subunit alpha | |
8qy5 | F | IL6RB_MOUSE Interleukin-6 receptor subunit beta[584 aa] | C | 100.0 /100.0 |
8 /8 |
IL6RA_HUMAN Interleukin-6 receptor subunit alpha | |
8qy5 | A | IL6RB_MOUSE Interleukin-6 receptor subunit beta[584 aa] | E | 100.0 /100.0 |
4 /4 |
IL6RA_HUMAN Interleukin-6 receptor subunit alpha | |
8qy5 | F | IL6RB_MOUSE Interleukin-6 receptor subunit beta[584 aa] | E | 100.0 /100.0 |
13 /13 |
IL6RA_HUMAN Interleukin-6 receptor subunit alpha | |
8qy6 | A | IL6RB_MOUSE Interleukin-6 receptor subunit beta[584 aa] | C | 100.0 /100.0 |
13 /13 |
IL6RA_HUMAN Interleukin-6 receptor subunit alpha | |
8qy6 | F | IL6RB_MOUSE Interleukin-6 receptor subunit beta[584 aa] | C | 100.0 /100.0 |
10 /10 |
IL6RA_HUMAN Interleukin-6 receptor subunit alpha | |
8qy6 | A | IL6RB_MOUSE Interleukin-6 receptor subunit beta[584 aa] | E | 100.0 /100.0 |
5 /5 |
IL6RA_HUMAN Interleukin-6 receptor subunit alpha | |
8qy6 | F | IL6RB_MOUSE Interleukin-6 receptor subunit beta[584 aa] | E | 100.0 /100.0 |
11 /11 |
IL6RA_HUMAN Interleukin-6 receptor subunit alpha | |
7dc8 | A | Switch Ab Fab light chain[212 aa] | C | 100.0 /99.5 |
5 /5 |
IL6RA_HUMAN Interleukin-6 receptor subunit alpha | |
7dc8 | D | Switch Ab Fab light chain[212 aa] | F | 100.0 /99.5 |
5 /5 |
IL6RA_HUMAN Interleukin-6 receptor subunit alpha | |
7dc8 | B | Switch Ab Fab heavy chain[209 aa] | C | 100.0 /99.5 |
9 /9 |
IL6RA_HUMAN Interleukin-6 receptor subunit alpha | |
7dc8 | E | Switch Ab Fab heavy chain[209 aa] | F | 100.0 /99.5 |
8 /8 |
IL6RA_HUMAN Interleukin-6 receptor subunit alpha | |
5fuc | E | VHH6[110 aa] | C | 100.0 /99.0 |
10 /10 |
D6R9R8_HUMAN IL6RA_HUMAN INTERLEUKIN-6 RECEPTOR SUBUNIT ALPHA, INTERLEUKIN-.. | |
5fuc | A | IL6_HUMAN INTERLEUKIN-6[152 aa] | D | 100.0 /99.0 |
12 /12 |
D6R9R8_HUMAN IL6RA_HUMAN INTERLEUKIN-6 RECEPTOR SUBUNIT ALPHA, INTERLEUKIN-.. | |
5fuc | F | VHH6[124 aa] | D | 100.0 /99.0 |
10 /10 |
D6R9R8_HUMAN IL6RA_HUMAN INTERLEUKIN-6 RECEPTOR SUBUNIT ALPHA, INTERLEUKIN-.. | |
1p9m | A | IL6RB_HUMAN Interleukin-6 receptor beta chain[298 aa] | C | 100.0 /100.0 |
12 /12 |
IL6RA_HUMAN Interleukin-6 receptor alpha chain | |
1p9m | A | IL6RB_HUMAN Interleukin-6 receptor beta chain[298 aa] | C | 100.0 /100.0 |
8 /8 |
IL6RA_HUMAN Interleukin-6 receptor alpha chain | |
1p9m | A | IL6RB_HUMAN Interleukin-6 receptor beta chain[298 aa] | C | 100.0 /100.0 |
8 /8 |
IL6RA_HUMAN Interleukin-6 receptor alpha chain | |
1p9m | A | IL6RB_HUMAN Interleukin-6 receptor beta chain[298 aa] | C | 100.0 /100.0 |
12 /12 |
IL6RA_HUMAN Interleukin-6 receptor alpha chain | |
8dps | A | IL6RB_HUMAN Interleukin-6 receptor subunit beta[297 aa] | C | 36.4 /33.9 |
11 /11 |
I11RA_HUMAN Interleukin-11 receptor subunit alpha | |
8dps | D | IL6RB_HUMAN Interleukin-6 receptor subunit beta[297 aa] | C | 0.0 /33.9 |
4 /4 |
I11RA_HUMAN Interleukin-11 receptor subunit alpha | |
8dps | A | IL6RB_HUMAN Interleukin-6 receptor subunit beta[297 aa] | F | 0.0 /33.9 |
4 /4 |
I11RA_HUMAN Interleukin-11 receptor subunit alpha | |
8dps | D | IL6RB_HUMAN Interleukin-6 receptor subunit beta[297 aa] | F | 36.4 /33.9 |
11 /11 |
I11RA_HUMAN Interleukin-11 receptor subunit alpha | |
8dpu | A | IL6RB_HUMAN Interleukin-6 receptor subunit beta[298 aa] | C | 41.7 /35.3 |
12 /12 |
I11RA_HUMAN Interleukin-11 receptor subunit alpha | |
8dpu | D | IL6RB_HUMAN Interleukin-6 receptor subunit beta[298 aa] | C | 0.0 /35.3 |
5 /5 |
I11RA_HUMAN Interleukin-11 receptor subunit alpha | |
8dpu | A | IL6RB_HUMAN Interleukin-6 receptor subunit beta[298 aa] | F | 0.0 /35.3 |
5 /5 |
I11RA_HUMAN Interleukin-11 receptor subunit alpha | |
8dpu | D | IL6RB_HUMAN Interleukin-6 receptor subunit beta[298 aa] | F | 35.7 /35.3 |
14 /14 |
I11RA_HUMAN Interleukin-11 receptor subunit alpha | |
8dpu | G | IL6RB_HUMAN Interleukin-6 receptor subunit beta[298 aa] | I | 41.7 /35.3 |
12 /12 |
I11RA_HUMAN Interleukin-11 receptor subunit alpha | |
8dpu | J | IL6RB_HUMAN Interleukin-6 receptor subunit beta[298 aa] | I | 0.0 /35.3 |
6 /6 |
I11RA_HUMAN Interleukin-11 receptor subunit alpha | |
8dpu | G | IL6RB_HUMAN Interleukin-6 receptor subunit beta[298 aa] | L | 0.0 /35.3 |
6 /6 |
I11RA_HUMAN Interleukin-11 receptor subunit alpha | |
8dpu | J | IL6RB_HUMAN Interleukin-6 receptor subunit beta[298 aa] | L | 38.5 /35.3 |
13 /13 |
I11RA_HUMAN Interleukin-11 receptor subunit alpha | |
8dpu | M | IL6RB_HUMAN Interleukin-6 receptor subunit beta[298 aa] | O | 38.5 /35.3 |
13 /13 |
I11RA_HUMAN Interleukin-11 receptor subunit alpha | |
8dpu | P | IL6RB_HUMAN Interleukin-6 receptor subunit beta[298 aa] | O | 0.0 /35.3 |
5 /5 |
I11RA_HUMAN Interleukin-11 receptor subunit alpha | |
8dpu | M | IL6RB_HUMAN Interleukin-6 receptor subunit beta[298 aa] | R | 0.0 /35.3 |
5 /5 |
I11RA_HUMAN Interleukin-11 receptor subunit alpha | |
8dpu | P | IL6RB_HUMAN Interleukin-6 receptor subunit beta[298 aa] | R | 35.7 /35.3 |
14 /14 |
I11RA_HUMAN Interleukin-11 receptor subunit alpha | |
8d74 | A | IL6RB_HUMAN Interleukin-6 receptor subunit beta[392 aa] | C | 36.4 /34.7 |
11 /11 |
CNTFR_HUMAN Ciliary neurotrophic factor receptor subunit alpha.. | |
8d7r | D | IL6RB_HUMAN Interleukin-6 receptor subunit beta[392 aa] | B | 27.3 /34.7 |
11 /11 |
CNTFR_HUMAN Ciliary neurotrophic factor receptor subunit alpha.. | |
8d74 | B | CNTF_HUMAN Ciliary neurotrophic factor[174 aa] | C | 14.3 /34.7 |
14 /14 |
CNTFR_HUMAN Ciliary neurotrophic factor receptor subunit alpha.. | |
8d7h | B | CLCF1_HUMAN Cardiotrophin-like cytokine factor 1[178 aa] | A | 12.5 /33.9 |
16 /17 |
CNTFR_HUMAN Ciliary neurotrophic factor receptor subunit alpha.. | |
8d7h | E | CLCF1_HUMAN Cardiotrophin-like cytokine factor 1[178 aa] | D | 12.5 /33.9 |
16 /17 |
CNTFR_HUMAN Ciliary neurotrophic factor receptor subunit alpha.. | |
8d7r | A | CLCF1_HUMAN Cardiotrophin-like cytokine factor 1[178 aa] | B | 6.2 /34.7 |
16 /17 |
CNTFR_HUMAN Ciliary neurotrophic factor receptor subunit alpha.. | |
8dpt | A | IL6RB_HUMAN Interleukin-6 receptor subunit beta[398 aa] | C | 33.3 /34.2 |
15 /15 |
I11RA_HUMAN Interleukin-11 receptor subunit alpha | |
8dpt | D | IL6RB_HUMAN Interleukin-6 receptor subunit beta[398 aa] | C | 0.0 /34.2 |
3 /3 |
I11RA_HUMAN Interleukin-11 receptor subunit alpha | |
8dpt | A | IL6RB_HUMAN Interleukin-6 receptor subunit beta[398 aa] | F | 0.0 /34.2 |
3 /3 |
I11RA_HUMAN Interleukin-11 receptor subunit alpha | |
8dpt | D | IL6RB_HUMAN Interleukin-6 receptor subunit beta[398 aa] | F | 31.2 /34.2 |
16 /16 |
I11RA_HUMAN Interleukin-11 receptor subunit alpha | |
8d7e | B | H4H25311P2 antibody Fab fragment light chain[215 a.. | A | 33.3 /33.9 |
9 /9 |
CNTFR_HUMAN Ciliary neurotrophic factor receptor subunit alpha.. | |
8d7e | C | H4H25311P2 antibody Fab fragment heavy chain[217 a.. | A | 27.3 /33.9 |
11 /11 |
CNTFR_HUMAN Ciliary neurotrophic factor receptor subunit alpha.. | |
8d7e | E | REGN8938 antibody Fab fragment heavy chain[214 aa].. | A | 0.0 /33.9 |
3 /11 |
CNTFR_HUMAN Ciliary neurotrophic factor receptor subunit alpha.. | |
8dps | B | IL11_HUMAN Interleukin-11[165 aa] | C | 6.7 /33.9 |
15 /18 |
I11RA_HUMAN Interleukin-11 receptor subunit alpha | |
8dps | E | IL11_HUMAN Interleukin-11[165 aa] | F | 6.7 /33.9 |
15 /18 |
I11RA_HUMAN Interleukin-11 receptor subunit alpha | |
8dpt | B | IL11_HUMAN Interleukin-11[165 aa] | C | 0.0 /34.2 |
15 /18 |
I11RA_HUMAN Interleukin-11 receptor subunit alpha | |
8dpt | E | IL11_HUMAN Interleukin-11[165 aa] | F | 0.0 /34.2 |
13 /16 |
I11RA_HUMAN Interleukin-11 receptor subunit alpha | |
8dpu | B | IL11_HUMAN Interleukin-11[164 aa] | C | 25.0 /35.3 |
16 /19 |
I11RA_HUMAN Interleukin-11 receptor subunit alpha | |
8dpu | E | IL11_HUMAN Interleukin-11[164 aa] | F | 25.0 /35.3 |
16 /19 |
I11RA_HUMAN Interleukin-11 receptor subunit alpha | |
8dpu | H | IL11_HUMAN Interleukin-11[164 aa] | I | 23.5 /35.3 |
17 /20 |
I11RA_HUMAN Interleukin-11 receptor subunit alpha | |
8dpu | K | IL11_HUMAN Interleukin-11[164 aa] | L | 23.5 /35.3 |
17 /19 |
I11RA_HUMAN Interleukin-11 receptor subunit alpha | |
8dpu | N | IL11_HUMAN Interleukin-11[164 aa] | O | 23.5 /35.3 |
17 /20 |
I11RA_HUMAN Interleukin-11 receptor subunit alpha | |
8dpu | Q | IL11_HUMAN Interleukin-11[164 aa] | R | 20.0 /35.3 |
15 /18 |
I11RA_HUMAN Interleukin-11 receptor subunit alpha | |
8qy4 | A | IL11_HUMAN Interleukin-11[165 aa] | E | 0.0 /31.7 |
10 /15 |
I11RA_HUMAN Interleukin-11 receptor subunit alpha | |
8qy4 | C | IL11_HUMAN Interleukin-11[165 aa] | F | 0.0 /31.7 |
9 /14 |
I11RA_HUMAN Interleukin-11 receptor subunit alpha | |
8upa | C | De novo designed IL-6 mimetic[56 aa] | D | 40.0 /30.9 |
15 /15 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
1f45 | B | I12A_HUMAN INTERLEUKIN-12 ALPHA CHAIN[133 aa] | A | 25.0 /30.4 |
20 /21 |
I12B_HUMAN INTERLEUKIN-12 BETA CHAIN | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
COMPOUND | |||||||
468 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
1n26 | H |
CYS
CYSTEINE[7 atoms] |
A | 100.0 /100.0 |
5 /5 |
IL6A_HUMAN IL-6 Receptor alpha chain | |
1n26 | H |
CYS
CYSTEINE[7 atoms] |
A | 100.0 /100.0 |
5 /5 |
IL6A_HUMAN IL-6 Receptor alpha chain | |
7dc8 | H |
ATP
ADENOSINE-5'-TRIPHOSPHATE[31 atoms] |
C | 100.0 /99.5 |
1 /1 |
IL6RA_HUMAN Interleukin-6 receptor subunit alpha | |
7dc8 | O |
ATP
ADENOSINE-5'-TRIPHOSPHATE[31 atoms] |
F | 100.0 /99.5 |
1 /1 |
IL6RA_HUMAN Interleukin-6 receptor subunit alpha | |
1n26 | D |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 100.0 /100.0 |
5 /5 |
IL6A_HUMAN IL-6 Receptor alpha chain | |
1n26 | D |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 100.0 /100.0 |
5 /5 |
IL6A_HUMAN IL-6 Receptor alpha chain | |
1n26 | E |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 100.0 /100.0 |
3 /3 |
IL6A_HUMAN IL-6 Receptor alpha chain | |
1n26 | E |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 100.0 /100.0 |
3 /3 |
IL6A_HUMAN IL-6 Receptor alpha chain | |
1n26 | E |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 100.0 /100.0 |
3 /3 |
IL6A_HUMAN IL-6 Receptor alpha chain | |
5fuc | G |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
C | 100.0 /99.0 |
3 /3 |
D6R9R8_HUMAN IL6RA_HUMAN INTERLEUKIN-6 RECEPTOR SUBUNIT ALPHA, INTERLEUKIN-.. | |
5fuc | H |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
C | 100.0 /99.0 |
1 /1 |
D6R9R8_HUMAN IL6RA_HUMAN INTERLEUKIN-6 RECEPTOR SUBUNIT ALPHA, INTERLEUKIN-.. | |
5fuc | I |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
D | 100.0 /99.0 |
2 /2 |
D6R9R8_HUMAN IL6RA_HUMAN INTERLEUKIN-6 RECEPTOR SUBUNIT ALPHA, INTERLEUKIN-.. | |
5fuc | J |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
D | 100.0 /99.0 |
2 /2 |
D6R9R8_HUMAN IL6RA_HUMAN INTERLEUKIN-6 RECEPTOR SUBUNIT ALPHA, INTERLEUKIN-.. | |
6o4p | E |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 50.0 /35.0 |
4 /4 |
I11RA_HUMAN Interleukin-11 receptor subunit alpha | |
8d74 | P |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
C | 0.0 /34.7 |
1 /1 |
CNTFR_HUMAN Ciliary neurotrophic factor receptor subunit alpha.. | |
8d7r | J |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
B | 0.0 /34.7 |
3 /3 |
CNTFR_HUMAN Ciliary neurotrophic factor receptor subunit alpha.. | |
8d82 | Q |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 100.0 /100.0 |
6 /6 |
IL6RA_HUMAN Soluble interleukin-6 receptor subunit alpha | |
8d82 | R |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 100.0 /100.0 |
2 /2 |
IL6RA_HUMAN Soluble interleukin-6 receptor subunit alpha | |
8d82 | S |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 100.0 /100.0 |
3 /3 |
IL6RA_HUMAN Soluble interleukin-6 receptor subunit alpha | |
8d82 | AA |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
D | 100.0 /100.0 |
2 /2 |
IL6RA_HUMAN Soluble interleukin-6 receptor subunit alpha | |
8d82 | BA |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
D | 100.0 /100.0 |
3 /3 |
IL6RA_HUMAN Soluble interleukin-6 receptor subunit alpha | |
8d82 | Z |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
D | 100.0 /100.0 |
6 /6 |
IL6RA_HUMAN Soluble interleukin-6 receptor subunit alpha | |
8dpu | GA |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
C | 25.0 /35.3 |
4 /4 |
I11RA_HUMAN Interleukin-11 receptor subunit alpha | |
8dpu | JA |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
F | 25.0 /35.3 |
4 /4 |
I11RA_HUMAN Interleukin-11 receptor subunit alpha | |
8dpu | MA |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
I | 25.0 /35.3 |
4 /4 |
I11RA_HUMAN Interleukin-11 receptor subunit alpha | |
8dpu | PA |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
L | 25.0 /35.3 |
4 /4 |
I11RA_HUMAN Interleukin-11 receptor subunit alpha | |
8dpu | SA |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
O | 25.0 /35.3 |
4 /4 |
I11RA_HUMAN Interleukin-11 receptor subunit alpha | |
8dpu | VA |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
R | 25.0 /35.3 |
4 /4 |
I11RA_HUMAN Interleukin-11 receptor subunit alpha | |
8iow | E |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 100.0 /100.0 |
3 /3 |
IL6RA_HUMAN Interleukin-6 receptor subunit alpha | |
8iow | F |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 100.0 /100.0 |
3 /3 |
IL6RA_HUMAN Interleukin-6 receptor subunit alpha | |
8j6f | E |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
C | 100.0 /100.0 |
1 /1 |
IL6RA_HUMAN Interleukin-6 receptor subunit alpha | |
8upa | H |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
D | 50.0 /30.9 |
2 /2 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8upa | I |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
D | 0.0 /30.9 |
3 /3 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
OTHERPOLY | |||||||
468 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
1n26 | B | 2-acetamido-2-deoxy-alpha-D-glucopyranose-(1-4)-al.. | A | 100.0 /100.0 |
9 /9 |
IL6A_HUMAN IL-6 Receptor alpha chain | |
1n26 | B | 2-acetamido-2-deoxy-alpha-D-glucopyranose-(1-4)-al.. | A | 100.0 /100.0 |
9 /9 |
IL6A_HUMAN IL-6 Receptor alpha chain | |
8dps | H | beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. | C | 0.0 /33.9 |
3 /3 |
I11RA_HUMAN Interleukin-11 receptor subunit alpha | |
8dps | J | beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. | F | 0.0 /33.9 |
3 /3 |
I11RA_HUMAN Interleukin-11 receptor subunit alpha | |
8dpt | G | beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. | C | 0.0 /34.2 |
4 /4 |
I11RA_HUMAN Interleukin-11 receptor subunit alpha | |
8dpt | H | beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. | F | 0.0 /34.2 |
4 /4 |
I11RA_HUMAN Interleukin-11 receptor subunit alpha | |
8dpu | T | beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. | C | 16.7 /35.3 |
6 /6 |
I11RA_HUMAN Interleukin-11 receptor subunit alpha | |
8dpu | V | beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. | F | 16.7 /35.3 |
6 /6 |
I11RA_HUMAN Interleukin-11 receptor subunit alpha | |
8dpu | X | beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. | I | 16.7 /35.3 |
6 /6 |
I11RA_HUMAN Interleukin-11 receptor subunit alpha | |
8dpu | Z | beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. | L | 16.7 /35.3 |
6 /6 |
I11RA_HUMAN Interleukin-11 receptor subunit alpha | |
8dpu | BA | beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. | O | 16.7 /35.3 |
6 /6 |
I11RA_HUMAN Interleukin-11 receptor subunit alpha | |
8dpu | DA | beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. | R | 16.7 /35.3 |
6 /6 |
I11RA_HUMAN Interleukin-11 receptor subunit alpha | |
6o4p | C | alpha-D-mannopyranose-(1-3)-beta-D-mannopyranose-(.. | A | 0.0 /35.0 |
5 /5 |
I11RA_HUMAN Interleukin-11 receptor subunit alpha | |
1n26 | C | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | A | 100.0 /100.0 |
5 /5 |
IL6A_HUMAN IL-6 Receptor alpha chain | |
1n26 | C | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | A | 100.0 /100.0 |
5 /5 |
IL6A_HUMAN IL-6 Receptor alpha chain | |
6o4p | D | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | B | 0.0 /35.4 |
4 /4 |
I11RA_HUMAN Interleukin-11 receptor subunit alpha | |
8d74 | F | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | C | 40.0 /34.7 |
5 /5 |
CNTFR_HUMAN Ciliary neurotrophic factor receptor subunit alpha.. | |
8d7e | F | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | A | 25.0 /33.9 |
4 /4 |
CNTFR_HUMAN Ciliary neurotrophic factor receptor subunit alpha.. | |
8d7e | H | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | A | 50.0 /33.9 |
2 /4 |
CNTFR_HUMAN Ciliary neurotrophic factor receptor subunit alpha.. | |
8d7e | I | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | A | 0.0 /33.9 |
2 /2 |
CNTFR_HUMAN Ciliary neurotrophic factor receptor subunit alpha.. | |
8d7h | G | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | A | 25.0 /33.9 |
4 /4 |
CNTFR_HUMAN Ciliary neurotrophic factor receptor subunit alpha.. | |
8d7h | I | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | A | 50.0 /33.9 |
2 /3 |
CNTFR_HUMAN Ciliary neurotrophic factor receptor subunit alpha.. | |
8d7h | J | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | A | 0.0 /33.9 |
1 /1 |
CNTFR_HUMAN Ciliary neurotrophic factor receptor subunit alpha.. | |
8d7h | N | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | D | 25.0 /33.9 |
4 /4 |
CNTFR_HUMAN Ciliary neurotrophic factor receptor subunit alpha.. | |
8d7h | P | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | D | 50.0 /33.9 |
2 /3 |
CNTFR_HUMAN Ciliary neurotrophic factor receptor subunit alpha.. | |
8d7h | Q | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | D | 0.0 /33.9 |
1 /1 |
CNTFR_HUMAN Ciliary neurotrophic factor receptor subunit alpha.. | |
8d7r | E | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | B | 33.3 /34.7 |
3 /3 |
CNTFR_HUMAN Ciliary neurotrophic factor receptor subunit alpha.. | |
8d82 | G | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | A | 100.0 /100.0 |
1 /1 |
IL6RA_HUMAN Soluble interleukin-6 receptor subunit alpha | |
8d82 | L | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | D | 100.0 /100.0 |
1 /1 |
IL6RA_HUMAN Soluble interleukin-6 receptor subunit alpha | |
8qy4 | I | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | E | 40.0 /31.7 |
5 /5 |
I11RA_HUMAN Interleukin-11 receptor subunit alpha | |
8qy4 | J | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | E | 0.0 /31.7 |
5 /5 |
I11RA_HUMAN Interleukin-11 receptor subunit alpha | |
8qy4 | K | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | F | 40.0 /31.7 |
5 /5 |
I11RA_HUMAN Interleukin-11 receptor subunit alpha | |
8qy4 | L | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | F | 0.0 /31.7 |
5 /5 |
I11RA_HUMAN Interleukin-11 receptor subunit alpha | |
1f45 | C | alpha-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-be.. | A | 0.0 /30.4 |
3 /7 |
I12B_HUMAN INTERLEUKIN-12 BETA CHAIN | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
HOMO | |||||||
468 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
1n26 | A | IL6A_HUMAN IL-6 Receptor alpha chain[299 aa] | A | 100.0 /100.0 |
11 /11 |
IL6A_HUMAN IL-6 Receptor alpha chain | |
1n26 | A | IL6A_HUMAN IL-6 Receptor alpha chain[299 aa] | A | 100.0 /100.0 |
15 /15 |
IL6A_HUMAN IL-6 Receptor alpha chain | |
8iow | B | IL6RA_HUMAN Interleukin-6 receptor subunit alpha[14 aa] | A | 100.0 /100.0 |
8 /8 |
IL6RA_HUMAN Interleukin-6 receptor subunit alpha | |
1bqu | B | IL6RB_HUMAN PROTEIN (GP130)[215 aa] | A | 33.3 /30.2 |
9 /9 |
IL6RB_HUMAN PROTEIN (GP130) | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
PRECIPITANT | |||||||
468 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
1bqu | C |
SO4
SULFATE ION[5 atoms] |
A | 0.0 /30.2 |
4 /4 |
IL6RB_HUMAN PROTEIN (GP130) | |
1bqu | D |
SO4
SULFATE ION[5 atoms] |
A | 0.0 /30.2 |
1 /1 |
IL6RB_HUMAN PROTEIN (GP130) | |
1bqu | E |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /30.2 |
2 /2 |
IL6RB_HUMAN PROTEIN (GP130) | |
1n26 | F |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /100.0 |
3 /3 |
IL6A_HUMAN IL-6 Receptor alpha chain | |
1n26 | F |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /100.0 |
3 /3 |
IL6A_HUMAN IL-6 Receptor alpha chain | |
1n26 | G |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /100.0 |
3 /3 |
IL6A_HUMAN IL-6 Receptor alpha chain | |
1n26 | G |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /100.0 |
3 /3 |
IL6A_HUMAN IL-6 Receptor alpha chain | |
6o4p | F |
SO4
SULFATE ION[5 atoms] |
A | 0.0 /35.0 |
4 /4 |
I11RA_HUMAN Interleukin-11 receptor subunit alpha | |
6o4p | G |
SO4
SULFATE ION[5 atoms] |
A | 0.0 /35.0 |
2 /2 |
I11RA_HUMAN Interleukin-11 receptor subunit alpha | |
6o4p | H |
SO4
SULFATE ION[5 atoms] |
A | 0.0 /35.0 |
4 /4 |
I11RA_HUMAN Interleukin-11 receptor subunit alpha | |
6o4p | I |
SO4
SULFATE ION[5 atoms] |
A | 0.0 /35.0 |
1 /3 |
I11RA_HUMAN Interleukin-11 receptor subunit alpha | |
6o4p | J |
SO4
SULFATE ION[5 atoms] |
A | 33.3 /35.0 |
3 /3 |
I11RA_HUMAN Interleukin-11 receptor subunit alpha | |
6o4p | K |
SO4
SULFATE ION[5 atoms] |
A | 0.0 /35.0 |
2 /2 |
I11RA_HUMAN Interleukin-11 receptor subunit alpha | |
6o4p | L |
SO4
SULFATE ION[5 atoms] |
B | 0.0 /35.4 |
2 /2 |
I11RA_HUMAN Interleukin-11 receptor subunit alpha | |
6o4p | M |
SO4
SULFATE ION[5 atoms] |
B | 0.0 /35.4 |
3 /3 |
I11RA_HUMAN Interleukin-11 receptor subunit alpha | |
6o4p | N |
SO4
SULFATE ION[5 atoms] |
B | 0.0 /35.4 |
1 /1 |
I11RA_HUMAN Interleukin-11 receptor subunit alpha | |
6o4p | O |
SO4
SULFATE ION[5 atoms] |
B | 0.0 /35.4 |
1 /1 |
I11RA_HUMAN Interleukin-11 receptor subunit alpha | |
6o4p | P |
SO4
SULFATE ION[5 atoms] |
B | 0.0 /35.4 |
1 /1 |
I11RA_HUMAN Interleukin-11 receptor subunit alpha | |
7dc8 | K |
SO4
SULFATE ION[5 atoms] |
C | 100.0 /99.5 |
3 /3 |
IL6RA_HUMAN Interleukin-6 receptor subunit alpha | |
7dc8 | L |
SO4
SULFATE ION[5 atoms] |
C | 100.0 /99.5 |
3 /3 |
IL6RA_HUMAN Interleukin-6 receptor subunit alpha | |
7dc8 | Q |
SO4
SULFATE ION[5 atoms] |
F | 100.0 /99.5 |
4 /4 |
IL6RA_HUMAN Interleukin-6 receptor subunit alpha | |
7dc8 | R |
SO4
SULFATE ION[5 atoms] |
F | 100.0 /99.5 |
2 /2 |
IL6RA_HUMAN Interleukin-6 receptor subunit alpha | |
1bqu | F |
GOL
GLYCEROL[6 atoms] |
A | 50.0 /30.2 |
6 /6 |
IL6RB_HUMAN PROTEIN (GP130) | |
1bqu | G |
GOL
GLYCEROL[6 atoms] |
A | 25.0 /30.2 |
8 /8 |
IL6RB_HUMAN PROTEIN (GP130) | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. |