Contact Molecules for Homologous Proteins | ||||
[Full Bars] |
[SiteTable] |
|
[Back to Search Page] |
[Back to HOMCOS] |
[SupCon3D] |
[help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
2690321 | 904 | 29 | O15455(TLR3_HUMAN) | RecName: Full=Toll-like receptor 3 ;AltName: CD_antigen=CD283;Flags: Precursor; |
QUERYSEQ |
MRQTLPCIYFWGGLLPFGMLCASSTTKCTVSHEVADCSHLKLTQVPDDLPTNITVLNLTHNQLRRLPAANFTRYSQLTSLDVGFNTISKLEPELCQKLPMLKVLNLQHNELSQLSDKTFAFCTNLTELHLMSNSIQKIKNNPFVKQKNLI TLDLSHNGLSSTKLGTQVQLENLQELLLSNNKIQALKSEELDIFANSSLKKLELSSNQIKEFSPGCFHAIGRLFGLFLNNVQLGPSLTEKLCLELANTSIRNLSLSNSQLSTTSNTTFLGLKWTNLTMLDLSYNNLNVVGNDSFAWLPQL EYFFLEYNNIQHLFSHSLHGLFNVRYLNLKRSFTKQSISLASLPKIDDFSFQWLKCLEHLNMEDNDIPGIKSNMFTGLINLKYLSLSNSFTSLRTLTNETFVSLAHSPLHILNLTKNKISKIESDAFSWLGHLEVLDLGLNEIGQELTGQ EWRGLENIFEIYLSYNKYLQLTRNSFALVPSLQRLMLRRVALKNVDSSPSPFQPLRNLTILDLSNNNIANINDDMLEGLEKLEILDLQHNNLARLWKHANPGGPIYFLKGLSHLHILNLESNGFDEIPVEVFKDLFELKIIDLGLNNLNT LPASVFNNQVSLKSLNLQKNLITSVEKKVFGPAFRNLTELDMRFNPFDCTCESIAWFVNWINETHTNIPELSSHYLCNTPPHYHGFPVRLFDTSSCKDSAPFELFFMINTSILLIFIFIVLLIHFEGWRISFYWNVSVHRVLGFKEIDRQ TEQFEYAAYIIHAYKDKDWVWEHFSSMEKEDQSLKFCLEERDFEAGVFELEAIVNSIKRSRKIIFVITHHLLKDPLCKRFKVHHAVQQAIEQNLDSIILVFLEEIPDYKLNHALCLRRGMFKSHCILNWPVQKERIGAFRHKLQVALGSK NSVH |
904 | region | name | description |
1-23 | SIGNAL | ||
24-904 | CHAIN | /note="Toll-like receptor 3" /id="PRO_0000034715" | |
24-704 | TOPO_DOM | /note="Lumenal" | |
705-725 | TRANSMEM | /note="Helical" | |
726-904 | TOPO_DOM | /note="Cytoplasmic" | |
24-51 | DOMAIN | /note="LRRNT" | |
52-73 | REPEAT | /note="LRR 1" | |
76-97 | REPEAT | /note="LRR 2" | |
100-121 | REPEAT | /note="LRR 3" | |
124-145 | REPEAT | /note="LRR 4" | |
148-168 | REPEAT | /note="LRR 5" | |
172-193 | REPEAT | /note="LRR 6" | |
198-219 | REPEAT | /note="LRR 7" | |
222-244 | REPEAT | /note="LRR 8" | |
249-270 | REPEAT | /note="LRR 9" | |
275-296 | REPEAT | /note="LRR 10" | |
299-320 | REPEAT | /note="LRR 11" | |
323-344 | REPEAT | /note="LRR 12" | |
356-377 | REPEAT | /note="LRR 13" | |
380-400 | REPEAT | /note="LRR 14" | |
408-429 | REPEAT | /note="LRR 15" | |
432-454 | REPEAT | /note="LRR 16" | |
465-486 | REPEAT | /note="LRR 17" | |
507-528 | REPEAT | /note="LRR 18" | |
531-552 | REPEAT | /note="LRR 19" | |
563-584 | REPEAT | /note="LRR 20" | |
587-608 | REPEAT | /note="LRR 21" | |
611-632 | REPEAT | /note="LRR 22" | |
645-698 | DOMAIN | /note="LRRCT" | |
754-897 | DOMAIN | /note="TIR" | |
1-904 | DISORDER | predicted by DISOPRED |
MONOMER | |||||||
904 | |||||||
pdb_id | a1 | identity[%]2 | description | ||||
7c76 | A | 100.0 | TLR3_HUMAN Toll-like receptor 3 | ||||
8ar1 | A | 100.0 | TLR3_HUMAN Toll-like receptor 3 | ||||
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue. |
HETERO | |||||||
904 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
3ulu[2] | B | Fab15 light chain[214 aa] | A | 100.0 /100.0 |
10 /10 |
TLR3_HUMAN Toll-like receptor 3 | |
3ulu[2] | C | Fab15 heavy chain[225 aa] | A | 100.0 /100.0 |
17 /17 |
TLR3_HUMAN Toll-like receptor 3 | |
3ulu[2] | D | Fab12 light chain[210 aa] | A | 100.0 /100.0 |
8 /8 |
TLR3_HUMAN Toll-like receptor 3 | |
3ulu[2] | E | Fab12 heavy chain[224 aa] | A | 100.0 /100.0 |
9 /9 |
TLR3_HUMAN Toll-like receptor 3 | |
3ulu[2] | F | Fab1068 light chain[215 aa] | A | 100.0 /100.0 |
8 /8 |
TLR3_HUMAN Toll-like receptor 3 | |
3ulu[2] | G | Fab1068 heavy chain[217 aa] | A | 100.0 /100.0 |
13 /13 |
TLR3_HUMAN Toll-like receptor 3 | |
5gs0[2] | B | light chain (anti-TLR3)[107 aa] | A | 100.0 /100.0 |
10 /10 |
TLR3_HUMAN Toll-like receptor 3 | |
5gs0[2] | C | heavy chain (anti-TLR3)[122 aa] | A | 100.0 /100.0 |
11 /11 |
TLR3_HUMAN Toll-like receptor 3 | |
7c76[1] | B | UN93B_HUMAN Protein unc-93 homolog B1[483 aa] | A | 100.0 /100.0 |
23 /23 |
TLR3_HUMAN Toll-like receptor 3 | |
7wvf[1] | E | mAb12[228 aa] | A | 100.0 /100.0 |
12 /12 |
TLR3_HUMAN Toll-like receptor 3 | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
NUCLEOTIDE | |||||||
904 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
7wv3[4] | E | RNA (80-MER) | A | 100.0 /100.0 |
14 /14 |
TLR3_HUMAN Toll-like receptor 3 | |
7wv3[4] | E | RNA (80-MER) | B | 100.0 /100.0 |
14 /14 |
TLR3_HUMAN Toll-like receptor 3 | |
7wv3[4] | F | RNA (80-MER) | A | 100.0 /100.0 |
7 /7 |
TLR3_HUMAN Toll-like receptor 3 | |
7wv3[4] | F | RNA (80-MER) | B | 100.0 /100.0 |
13 /13 |
TLR3_HUMAN Toll-like receptor 3 | |
7wv5[8] | C | RNA (46-MER) | A | 100.0 /100.0 |
15 /15 |
TLR3_HUMAN Toll-like receptor 3 | |
7wv5[8] | D | RNA (46-MER) | A | 100.0 /100.0 |
15 /15 |
TLR3_HUMAN Toll-like receptor 3 | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
COMPOUND | |||||||
904 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
1ziw[3] | F |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 100.0 /100.0 |
5 /5 |
TLR3_HUMAN Toll-like receptor 3 | |
1ziw[3] | G |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 100.0 /100.0 |
3 /3 |
TLR3_HUMAN Toll-like receptor 3 | |
1ziw[4] | H |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 100.0 /100.0 |
4 /4 |
TLR3_HUMAN Toll-like receptor 3 | |
1ziw[3] | I |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 100.0 /100.0 |
2 /2 |
TLR3_HUMAN Toll-like receptor 3 | |
2a0z[1] | L |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 100.0 /100.0 |
2 /2 |
TLR3_HUMAN Toll-like receptor 3 | |
3ulu[4] | N |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 100.0 /100.0 |
2 /2 |
TLR3_HUMAN Toll-like receptor 3 | |
3ulu[2] | P |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 100.0 /100.0 |
5 /5 |
TLR3_HUMAN Toll-like receptor 3 | |
3ulu[4] | Q |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 100.0 /100.0 |
3 /3 |
TLR3_HUMAN Toll-like receptor 3 | |
3ulu[2] | R |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 100.0 /100.0 |
2 /2 |
TLR3_HUMAN Toll-like receptor 3 | |
3ulv[1] | O |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 100.0 /100.0 |
4 /4 |
TLR3_HUMAN Toll-like receptor 3 | |
5gs0[2] | AA |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[15 atoms].. |
A | 100.0 /100.0 |
3 /3 |
TLR3_HUMAN Toll-like receptor 3 | |
5gs0[2] | K |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[15 atoms].. |
A | 100.0 /100.0 |
2 /2 |
TLR3_HUMAN Toll-like receptor 3 | |
5gs0[4] | O |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[15 atoms].. |
A | 100.0 /100.0 |
2 /2 |
TLR3_HUMAN Toll-like receptor 3 | |
5gs0[2] | P |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[15 atoms].. |
A | 100.0 /100.0 |
3 /3 |
TLR3_HUMAN Toll-like receptor 3 | |
5gs0[2] | X |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[15 atoms].. |
A | 100.0 /100.0 |
6 /6 |
TLR3_HUMAN Toll-like receptor 3 | |
5gs0[2] | Y |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[15 atoms].. |
A | 100.0 /100.0 |
1 /1 |
TLR3_HUMAN Toll-like receptor 3 | |
7c76[1] | J |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 100.0 /100.0 |
2 /2 |
TLR3_HUMAN Toll-like receptor 3 | |
7c76[1] | K |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 100.0 /100.0 |
3 /3 |
TLR3_HUMAN Toll-like receptor 3 | |
7c76[1] | L |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 100.0 /100.0 |
5 /5 |
TLR3_HUMAN Toll-like receptor 3 | |
7c76[1] | M |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 100.0 /100.0 |
3 /3 |
TLR3_HUMAN Toll-like receptor 3 | |
7c76[1] | N |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 100.0 /100.0 |
2 /2 |
TLR3_HUMAN Toll-like receptor 3 | |
7c76[5] | P |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 100.0 /100.0 |
2 /2 |
TLR3_HUMAN Toll-like receptor 3 | |
7c76[1] | Q |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 100.0 /100.0 |
1 /1 |
TLR3_HUMAN Toll-like receptor 3 | |
7wv3[6] | O |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 100.0 /100.0 |
1 /1 |
TLR3_HUMAN Toll-like receptor 3 | |
7wv3[4] | P |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 100.0 /100.0 |
4 /4 |
TLR3_HUMAN Toll-like receptor 3 | |
7wv3[4] | Q |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 100.0 /100.0 |
3 /3 |
TLR3_HUMAN Toll-like receptor 3 | |
7wv3[6] | R |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 100.0 /100.0 |
2 /2 |
TLR3_HUMAN Toll-like receptor 3 | |
7wv3[6] | T |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 100.0 /100.0 |
3 /3 |
TLR3_HUMAN Toll-like receptor 3 | |
7wv3[4] | U |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 100.0 /100.0 |
4 /4 |
TLR3_HUMAN Toll-like receptor 3 | |
7wv5[2] | Q |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 100.0 /100.0 |
1 /1 |
TLR3_HUMAN Toll-like receptor 3 | |
7wv5[2] | R |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 100.0 /100.0 |
1 /1 |
TLR3_HUMAN Toll-like receptor 3 | |
2a0z[1] | M |
GLC
alpha-D-glucopyranose[12 atoms] |
A | 100.0 /100.0 |
5 /5 |
TLR3_HUMAN Toll-like receptor 3 | |
2a0z[1] | N |
GLC
alpha-D-glucopyranose[12 atoms] |
A | 100.0 /100.0 |
4 /4 |
TLR3_HUMAN Toll-like receptor 3 | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
OTHERPOLY | |||||||
904 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
1ziw[5] | B | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | A | 100.0 /100.0 |
6 /6 |
TLR3_HUMAN Toll-like receptor 3 | |
1ziw[4] | C | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | A | 100.0 /100.0 |
4 /4 |
TLR3_HUMAN Toll-like receptor 3 | |
1ziw[1] | D | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | A | 100.0 /100.0 |
6 /6 |
TLR3_HUMAN Toll-like receptor 3 | |
1ziw[1] | E | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | A | 100.0 /100.0 |
4 /4 |
TLR3_HUMAN Toll-like receptor 3 | |
2a0z[1] | B | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | A | 100.0 /100.0 |
2 /2 |
TLR3_HUMAN Toll-like receptor 3 | |
2a0z[1] | C | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | A | 100.0 /100.0 |
5 /5 |
TLR3_HUMAN Toll-like receptor 3 | |
2a0z[1] | D | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | A | 100.0 /100.0 |
4 /4 |
TLR3_HUMAN Toll-like receptor 3 | |
2a0z[3] | G | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | A | 100.0 /100.0 |
4 /4 |
TLR3_HUMAN Toll-like receptor 3 | |
3ulu[1] | H | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | A | 100.0 /100.0 |
4 /4 |
TLR3_HUMAN Toll-like receptor 3 | |
3ulu[2] | J | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | A | 100.0 /100.0 |
4 /4 |
TLR3_HUMAN Toll-like receptor 3 | |
3ulu[2] | K | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | A | 100.0 /100.0 |
2 /2 |
TLR3_HUMAN Toll-like receptor 3 | |
3ulv[1] | L | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | A | 100.0 /100.0 |
4 /4 |
TLR3_HUMAN Toll-like receptor 3 | |
7c76[1] | F | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | A | 100.0 /100.0 |
6 /6 |
TLR3_HUMAN Toll-like receptor 3 | |
7c76[1] | H | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | A | 100.0 /100.0 |
4 /4 |
TLR3_HUMAN Toll-like receptor 3 | |
7wv3[4] | G | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | A | 100.0 /100.0 |
4 /4 |
TLR3_HUMAN Toll-like receptor 3 | |
7wv3[4] | H | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | A | 100.0 /100.0 |
7 /7 |
TLR3_HUMAN Toll-like receptor 3 | |
7wv5[2] | E | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | A | 100.0 /100.0 |
4 /4 |
TLR3_HUMAN Toll-like receptor 3 | |
7wv5[2] | I | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | A | 100.0 /100.0 |
4 /4 |
TLR3_HUMAN Toll-like receptor 3 | |
2a0z[2] | E | beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. | A | 100.0 /100.0 |
2 /2 |
TLR3_HUMAN Toll-like receptor 3 | |
3ulu[1] | M | beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. | A | 100.0 /100.0 |
4 /4 |
TLR3_HUMAN Toll-like receptor 3 | |
7c76[1] | G | beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. | A | 100.0 /100.0 |
3 /3 |
TLR3_HUMAN Toll-like receptor 3 | |
2a0z[1] | H | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[al.. | A | 100.0 /100.0 |
3 /3 |
TLR3_HUMAN Toll-like receptor 3 | |
2a0z[1] | J | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[al.. | A | 100.0 /100.0 |
4 /4 |
TLR3_HUMAN Toll-like receptor 3 | |
2a0z[1] | I | alpha-D-mannopyranose-(1-3)-[beta-D-mannopyranose-.. | A | 100.0 /100.0 |
6 /6 |
TLR3_HUMAN Toll-like receptor 3 | |
2a0z[1] | K | 2-acetamido-2-deoxy-alpha-D-glucopyranose-(1-4)-2-.. | A | 100.0 /100.0 |
2 /2 |
TLR3_HUMAN Toll-like receptor 3 | |
3ulu[2] | L | alpha-D-mannopyranose-(1-6)-beta-D-mannopyranose-(.. | A | 100.0 /100.0 |
7 /7 |
TLR3_HUMAN Toll-like receptor 3 | |
7wv5[2] | H | beta-D-mannopyranose-(1-6)-beta-D-mannopyranose-(1.. | A | 100.0 /100.0 |
8 /8 |
TLR3_HUMAN Toll-like receptor 3 | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
HOMO | |||||||
904 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
2mk9[7] | B | TLR3_HUMAN Toll-like receptor 3[34 aa] | A | 100.0 /100.0 |
6 /6 |
TLR3_HUMAN Toll-like receptor 3 | |
2mka[1] | C | TLR3_HUMAN Toll-like receptor 3[34 aa] | B | 100.0 /100.0 |
2 /2 |
TLR3_HUMAN Toll-like receptor 3 | |
7wv3[16] | B | TLR3_HUMAN Toll-like receptor 3[668 aa] | A | 100.0 /100.0 |
9 /9 |
TLR3_HUMAN Toll-like receptor 3 | |
7wv3[2] | D | TLR3_HUMAN Toll-like receptor 3[668 aa] | A | 100.0 /100.0 |
1 /1 |
TLR3_HUMAN Toll-like receptor 3 | |
7wv3[2] | A | TLR3_HUMAN Toll-like receptor 3[668 aa] | D | 100.0 /100.0 |
1 /1 |
TLR3_HUMAN Toll-like receptor 3 | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
PRECIPITANT | |||||||
904 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
1ziw[1] | J |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /100.0 |
4 /4 |
TLR3_HUMAN Toll-like receptor 3 | |
1ziw[1] | K |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /100.0 |
4 /4 |
TLR3_HUMAN Toll-like receptor 3 | |
2a0z[1] | P |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /100.0 |
4 /4 |
TLR3_HUMAN Toll-like receptor 3 | |
2a0z[1] | Q |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /100.0 |
4 /4 |
TLR3_HUMAN Toll-like receptor 3 | |
3ulu[2] | O |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /100.0 |
2 /2 |
TLR3_HUMAN Toll-like receptor 3 | |
3ulv[1] | S |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /100.0 |
4 /4 |
TLR3_HUMAN Toll-like receptor 3 | |
3ulv[1] | T |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /100.0 |
3 /3 |
TLR3_HUMAN Toll-like receptor 3 | |
3ulv[1] | U |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /100.0 |
4 /4 |
TLR3_HUMAN Toll-like receptor 3 | |
3ulv[1] | W |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /100.0 |
1 /1 |
TLR3_HUMAN Toll-like receptor 3 | |
1ziw[1] | M |
GOL
GLYCEROL[6 atoms] |
A | 100.0 /100.0 |
6 /6 |
TLR3_HUMAN Toll-like receptor 3 | |
1ziw[1] | N |
GOL
GLYCEROL[6 atoms] |
A | 100.0 /100.0 |
2 /2 |
TLR3_HUMAN Toll-like receptor 3 | |
1ziw[1] | O |
GOL
GLYCEROL[6 atoms] |
A | 100.0 /100.0 |
3 /3 |
TLR3_HUMAN Toll-like receptor 3 | |
1ziw[1] | P |
GOL
GLYCEROL[6 atoms] |
A | 100.0 /100.0 |
6 /6 |
TLR3_HUMAN Toll-like receptor 3 | |
1ziw[1] | Q |
GOL
GLYCEROL[6 atoms] |
A | 100.0 /100.0 |
2 /2 |
TLR3_HUMAN Toll-like receptor 3 | |
2a0z[1] | R |
BME
BETA-MERCAPTOETHANOL[4 atoms] |
A | 100.0 /100.0 |
2 /2 |
TLR3_HUMAN Toll-like receptor 3 | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. |