Contact Molecules for Homologous Proteins
[Summary Bars]	[Full Bars]	Site Table[95 %]	[Back to Search Page]	[Back to HOMCOS]
[Sites by Variants]	[SupCon3D]	[help]	seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]	[show] [download] [help]

PID	QueryLength	Homolgous Sequence in PDB	UniProt Query	TITLE
6148	76	14	P59637(VEMP_SARS)	RecName: Full=Envelope small membrane protein ; Short=E protein ; Short=sM protein ;
QUERYSEQ	MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPTVYVYSRVKNLNSSEGVPDLLV

  [n]:site number of query sequence.  [a]:amino acid of query sequence.  [s]:predicted secondary structure.
  [e]:predicted exposed/buried.  [acc]:predicted relative accesssibility(%).  [pdb]:PDB code of homologous structure.
  [contact_mols]:predicted binding molecules  [observed aa]:Observed amino acids among homologous sequences.  [feature table]:UniProt Feature Table
  [variant]:UniProt Human Variant.

n	a	s	e	acc	pdb	contact_mols	observed aa	feature table	variant
1	M	-	-	-	-		M	TOPO_DOM /note="Virion surface" TOPO_DOM /note="Virion surface"
2	Y	-	-	-	-		LY	TOPO_DOM /note="Virion surface" TOPO_DOM /note="Virion surface"
3	S	-	-	-	-		PS	TOPO_DOM /note="Virion surface" TOPO_DOM /note="Virion surface"
4	F	-	-	-	-		F	TOPO_DOM /note="Virion surface" TOPO_DOM /note="Virion surface"
5	V	-	-	-	-		V	TOPO_DOM /note="Virion surface" TOPO_DOM /note="Virion surface"
6	S	-	-	-	-		SQH	TOPO_DOM /note="Virion surface" TOPO_DOM /note="Virion surface"
7	E	-	-	-	-		E	TOPO_DOM /note="Virion surface" TOPO_DOM /note="Virion surface"
8	E		e	98.5	8suz_E		EQDR	TOPO_DOM /note="Virion surface" TOPO_DOM /note="Virion surface"
9	T	H	e	77.3	8suz_E		TI	TOPO_DOM /note="Virion surface" TOPO_DOM /note="Virion surface"
10	G	H	e	26.2	8suz_E		GA	TOPO_DOM /note="Virion surface" TOPO_DOM /note="Virion surface"
11	T	H	e	79.2	8suz_E	homo	TWAL	TOPO_DOM /note="Virion surface" TOPO_DOM /note="Virion surface"
12	L	H	e	86.5	8suz_E	homo	FLYI	TOPO_DOM /note="Virion surface" TOPO_DOM /note="Virion surface"
13	I	H	e	78.4	8suz_E	homo	IV	TOPO_DOM /note="Virion surface" TOPO_DOM /note="Virion surface"
14	V	H	e	68.7	8suz_E	homo	VG	TOPO_DOM /note="Virion surface" TOPO_DOM /note="Virion surface"
15	N	H	e	57.0	8suz_E	homo	NQ	TOPO_DOM /note="Virion surface" TOPO_DOM /note="Virion surface"
16	S	H	e	49.2	8suz_E		FSI	TOPO_DOM /note="Virion surface" TOPO_DOM /note="Virion surface"
17	V	H	e	76.0	8suz_E	homo	FV	TRANSMEM /note="Helical" TRANSMEM /note="Helical"
18	L	H	e	60.1	8suz_E	homo	ILF	TRANSMEM /note="Helical" TRANSMEM /note="Helical"
19	L	H	e	73.0	8suz_E	homo	LF	TRANSMEM /note="Helical" TRANSMEM /note="Helical"
20	F	H	e	58.9	8suz_E	homo	FTVS	TRANSMEM /note="Helical" TRANSMEM /note="Helical"
21	L	H	e	48.3	8suz_E	homo	LVF	TRANSMEM /note="Helical" TRANSMEM /note="Helical"
22	A	H	e	49.1	8suz_E		VAS	TRANSMEM /note="Helical" TRANSMEM /note="Helical"
23	F	H	e	48.8	8suz_E		CF	TRANSMEM /note="Helical" TRANSMEM /note="Helical"
24	V	H	e	52.7	8suz_E	homo	VA	TRANSMEM /note="Helical" TRANSMEM /note="Helical"
25	V	H	e	55.3	8suz_E	homo	IV	TRANSMEM /note="Helical" TRANSMEM /note="Helical"
26	F	H	e	65.1	8suz_E	homo	FT	TRANSMEM /note="Helical" TRANSMEM /note="Helical"
27	L	H	e	57.3	8suz_E	homo	L	TRANSMEM /note="Helical" TRANSMEM /note="Helical"
28	L	H	e	69.1	8suz_E	homo	LIV	TRANSMEM /note="Helical" TRANSMEM /note="Helical"
29	V	H	e	60.7	8suz_E	homo	VF	TRANSMEM /note="Helical" TRANSMEM /note="Helical"
30	T	H	e	33.1	8suz_E		CTV	TRANSMEM /note="Helical" TRANSMEM /note="Helical"
31	L	H	e	72.5	8suz_E	homo	LVM	TRANSMEM /note="Helical" TRANSMEM /note="Helical"
32	A	H	e	43.8	8suz_E		A	TRANSMEM /note="Helical" TRANSMEM /note="Helical"
33	I	H	e	77.8	8suz_E	homo	ILFV	TRANSMEM /note="Helical" TRANSMEM /note="Helical"
34	L	H	e	61.8	8suz_E		L	TRANSMEM /note="Helical" TRANSMEM /note="Helical"
35	T	H	e	75.3	8suz_E	homo	TA	TRANSMEM /note="Helical" TRANSMEM /note="Helical"
36	A	T	e	48.2	8suz_E	homo	AT	TRANSMEM /note="Helical" TRANSMEM /note="Helical"
37	L		e	97.8	8suz_E	homo	ILT	TRANSMEM /note="Helical" TRANSMEM /note="Helical"
38	R		e	119.8	8suz_E	homo	RK	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
39	L	-	-	-	-		L	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
40	C	-	-	-	-		C	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
41	A	-	-	-	-		VAI	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
42	Y	-	-	-	-		QY	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
43	C	-	-	-	-		CI	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
44	C	-	-	-	-		CMVA	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
45	N	-	-	-	-		NSGT	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
46	I	-	-	-	-		GIF	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
47	V	-	-	-	-		VCF	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
48	N	-	-	-	-		NH	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
49	V	-	-	-	-		TVI	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
50	S	-	-	-	-		LSF	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
51	L	-	-	-	-		LIV	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
52	V	-	-	-	-		VFI	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
53	K	-	-	-	-		KSLQV	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
54	P	-	-	-	-		P	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
55	T	-	-	-	-		AST	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
56	V	-	-	-	-		VAFL	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
57	Y	-	-	-	-		YH	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
58	V	-	-	-	-		VIL	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
59	Y	-	-	-	-		Y	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
60	S	-	-	-	-		NSG	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
61	R	-	-	-	-		RT	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
62	V	-	-	-	-		VGA	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
63	K	-	-	-	-		KRA	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
64	N	-	-	-	-		NQFY	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
65	L	-	-	-	-		LQV	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
66	N	-	-	-	-		NYDK	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
67	S	-	-	-	-		SKF	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
68	S	-	-	-	-		SKQ	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
69	E	-	-	-	-		EPR	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
70	G		e	148.8	7ntj_D		GSPADEFIKLNQRTVY	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
71	V		e	114.0	7ntj_D		VHL	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
72	P		e	85.3	7ntj_D		P	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
73	D		e	137.0	7ntj_B	hetero MPP5_HUMAN	DP	MOTIF /note="PDZ-binding; required for interaction with human PALS1" MUTAGEN /note="Missing: Abolishes interaction with PDZ domain of human PALS1; loss of accumulation in host perinuclear compartment." TOPO_DOM /note="Intravirion" MOTIF /note="PDZ-binding; required for interaction with human PALS1" MUTAGEN /note="Missing: Abolishes interaction with PDZ domain of human PALS1; loss of accumulation in host perinuclear compartment." TOPO_DOM /note="Intravirion"
74	L		e	108.4	7ntj_B	hetero MPP5_HUMAN	L	MOTIF /note="PDZ-binding; required for interaction with human PALS1" MUTAGEN /note="Missing: Abolishes interaction with PDZ domain of human PALS1; loss of accumulation in host perinuclear compartment." TOPO_DOM /note="Intravirion" MOTIF /note="PDZ-binding; required for interaction with human PALS1" MUTAGEN /note="Missing: Abolishes interaction with PDZ domain of human PALS1; loss of accumulation in host perinuclear compartment." TOPO_DOM /note="Intravirion"
75	L		e	112.4	7ntj_B	hetero MPP5_HUMAN	L	MOTIF /note="PDZ-binding; required for interaction with human PALS1" MUTAGEN /note="Missing: Abolishes interaction with PDZ domain of human PALS1; loss of accumulation in host perinuclear compartment." TOPO_DOM /note="Intravirion" MOTIF /note="PDZ-binding; required for interaction with human PALS1" MUTAGEN /note="Missing: Abolishes interaction with PDZ domain of human PALS1; loss of accumulation in host perinuclear compartment." TOPO_DOM /note="Intravirion"
76	V		e	136.0	7ntj_B	hetero MPP5_HUMAN	V	MOTIF /note="PDZ-binding; required for interaction with human PALS1" MUTAGEN /note="Missing: Abolishes interaction with PDZ domain of human PALS1; loss of accumulation in host perinuclear compartment." TOPO_DOM /note="Intravirion" MOTIF /note="PDZ-binding; required for interaction with human PALS1" MUTAGEN /note="Missing: Abolishes interaction with PDZ domain of human PALS1; loss of accumulation in host perinuclear compartment." TOPO_DOM /note="Intravirion"