[All Sites]

Contact Molecules for Homologous Proteins


[Summary Bars]

[Full Bars]


Sites by Variants[80 %]


[Back to Search Page]

[Back to HOMCOS]

[SupCon3D]

[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
6148 76 20 P59637(VEMP_SARS) RecName: Full=Envelope small membrane protein ; Short=E protein ; Short=sM protein ;
QUERYSEQ
MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPTVYVYSRVKNLNSSEGVPDLLV
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

Statistics of sites in view of Disease classification

All
Number of sites 76
Buired or ExposedBuried 3.1 (%) [2]
Exposed 96.9 (%) [63]
Ave relacc 68.2 %
SD relacc 28.27 %
Contact Molhetero 5.3 (%) [4]
nucleotide 0.0 (%) [0]
compound 0.0 (%) [0]
metal 0.0 (%) [0]
otherpoly 0.0 (%) [0]
homo 46.1 (%) [35]
precipitant 0.0 (%) [0]
Number of variants 0
N_Freq(AAvariant)==0 %
N_Freq(AAvariant)>0 %
Ave Freq(AAvariant)
SD Freq(AAvariant)