Contact Molecules for Homologous Proteins | ||||
[Summary Bars] |
[Full Bars] |
|
[Back to Search Page] |
[Back to HOMCOS] |
[Sites by Variants] |
[SupCon3D] |
[help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
6148 | 76 | 20 | P59637(VEMP_SARS) | RecName: Full=Envelope small membrane protein ; Short=E protein ; Short=sM protein ; |
QUERYSEQ |
MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPTVYVYSRVKNLNSSEGVPDLLV |
[n]:site number of query sequence. [a]:amino acid of query sequence. [s]:predicted secondary structure. [e]:predicted exposed/buried. [acc]:predicted relative accesssibility(%). [pdb]:PDB code of homologous structure. [contact_mols]:predicted binding molecules [observed aa]:Observed amino acids among homologous sequences. [feature table]:UniProt Feature Table [variant]:UniProt Human Variant.
n | a | s | e | acc | pdb | contact_mols | observed aa | feature table | variant |
1 | M | - | - | - | - | M |
TOPO_DOM /note="Virion surface" TOPO_DOM /note="Virion surface" | ||
2 | Y | - | - | - | - | LY |
TOPO_DOM /note="Virion surface" TOPO_DOM /note="Virion surface" | ||
3 | S | - | - | - | - | PS |
TOPO_DOM /note="Virion surface" TOPO_DOM /note="Virion surface" | ||
4 | F | - | - | - | - | F |
TOPO_DOM /note="Virion surface" TOPO_DOM /note="Virion surface" | ||
5 | V | - | - | - | - | V |
TOPO_DOM /note="Virion surface" TOPO_DOM /note="Virion surface" | ||
6 | S | - | - | - | - | SQH |
TOPO_DOM /note="Virion surface" TOPO_DOM /note="Virion surface" | ||
7 | E | - | - | - | - | E |
TOPO_DOM /note="Virion surface" TOPO_DOM /note="Virion surface" | ||
8 | E | e | 84.9 | 2mm4_A | EQDR |
TOPO_DOM /note="Virion surface" TOPO_DOM /note="Virion surface" | |||
9 | T | e | 108.4 | 2mm4_A | TI |
TOPO_DOM /note="Virion surface" TOPO_DOM /note="Virion surface" | |||
10 | G | S | e | 58.3 | 2mm4_A | GA |
TOPO_DOM /note="Virion surface" TOPO_DOM /note="Virion surface" | ||
11 | T | e | 23.4 | 2mm4_A | TWAL |
TOPO_DOM /note="Virion surface" TOPO_DOM /note="Virion surface" | |||
12 | L | e | 99.4 | 2mm4_A | FLYI |
TOPO_DOM /note="Virion surface" TOPO_DOM /note="Virion surface" | |||
13 | I | S | e | 88.9 | 2mm4_A | IV |
TOPO_DOM /note="Virion surface" TOPO_DOM /note="Virion surface" | ||
14 | V | H | e | 50.7 | 2mm4_A | VG |
TOPO_DOM /note="Virion surface" TOPO_DOM /note="Virion surface" | ||
15 | N | H | e | 67.3 | 2mm4_A | NQ |
TOPO_DOM /note="Virion surface" TOPO_DOM /note="Virion surface" | ||
16 | S | H | e | 44.5 | 2mm4_A | FSI |
TOPO_DOM /note="Virion surface" TOPO_DOM /note="Virion surface" | ||
17 | V | H | e | 54.7 | 2mm4_A | FV |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | ||
18 | L | H | e | 86.0 | 2mm4_A | ILF |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | ||
19 | L | H | e | 74.7 | 2mm4_A | LF |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | ||
20 | F | H | e | 58.4 | 2mm4_A | FTVS |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | ||
21 | L | H | e | 68.0 | 2mm4_A | LVF |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | ||
22 | A | H | e | 36.6 | 2mm4_A | VAS |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | ||
23 | F | H | e | 36.8 | 2mm4_A | CF |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | ||
24 | V | H | e | 36.7 | 2mm4_A | VA |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | ||
25 | V | H | e | 62.7 | 2mm4_A | IV |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | ||
26 | F | H | e | 61.7 | 2mm4_A | FT |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | ||
27 | L | H | e | 53.9 | 2mm4_A | L |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | ||
28 | L | H | e | 69.1 | 2mm4_A | LIV |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | ||
29 | V | H | e | 83.3 | 2mm4_A | VF |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | ||
30 | T | H | e | 43.5 | 2mm4_A | CTV |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | ||
31 | L | H | e | 66.9 | 2mm4_A | LVM |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | ||
32 | A | H | e | 57.1 | 2mm4_A | A |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | ||
33 | I | H | e | 77.2 | 2mm4_A | ILFV |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | ||
34 | L | H | e | 52.8 | 2mm4_A | L |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | ||
35 | T | H | e | 34.4 | 2mm4_A | TA |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | ||
36 | A | H | e | 47.3 | 2mm4_A | AT |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | ||
37 | L | H | e | 82.6 | 2mm4_A | ILT |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | ||
38 | R | H | e | 58.9 | 2mm4_A | RK |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | ||
39 | L | H | e | 28.1 | 2mm4_A | L |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | ||
40 | C | H | e | 41.1 | 2mm4_A | C |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | ||
41 | A | H | e | 60.7 | 2mm4_A | VAI |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | ||
42 | Y | H | e | 37.4 | 2mm4_A | QY |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | ||
43 | C | T | e | 36.6 | 2mm4_A | CI |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | ||
44 | C | T | e | 87.5 | 2mm4_A | CMVA |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | ||
45 | N | T | e | 84.8 | 2mm4_A | NSGT |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | ||
46 | I | S | e | 92.4 | 2mm4_A | GIF |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | ||
47 | V | e | 61.3 | 2mm4_A | VCF |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | |||
48 | N | S | e | 70.3 | 2mm4_A | NH |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | ||
49 | V | e | 58.0 | 2mm4_A | TVI |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | |||
50 | S | b | 3.9 | 2mm4_A | LSF |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | |||
51 | L | e | 78.1 | 2mm4_A | LIV |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | |||
52 | V | S | e | 76.0 | 2mm4_A | VFI |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | ||
53 | K | S | e | 62.7 | 2mm4_A | KSLQV |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | ||
54 | P | T | e | 52.7 | 2mm4_A | P |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | ||
55 | T | T | b | 17.5 | 2mm4_A | AST |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | ||
56 | V | H | e | 66.7 | 2mm4_A | VAFL |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | ||
57 | Y | H | e | 53.0 | 2mm4_A | YH |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | ||
58 | V | H | e | 52.0 | 2mm4_A | VIL |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | ||
59 | Y | H | e | 73.5 | 2mm4_A | Y |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | ||
60 | S | H | e | 45.3 | 2mm4_A | NSG |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | ||
61 | R | H | e | 74.7 | 2mm4_A | RT |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | ||
62 | V | H | e | 78.0 | 2mm4_A | VGA |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | ||
63 | K | H | e | 73.1 | 2mm4_A | KRA |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | ||
64 | N | H | e | 78.2 | 2mm4_A | NQFY |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | ||
65 | L | e | 119.7 | 2mm4_A | LQV |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | |||
66 | N | - | - | - | - | NYDK |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | ||
67 | S | - | - | - | - | SKF |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | ||
68 | S | - | - | - | - | SKQ |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | ||
69 | E | - | - | - | - | EPR |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | ||
70 | G | e | 148.8 | 7ntj_D | GSPADEFIKLNQRTVY |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | |||
71 | V | e | 114.0 | 7ntj_D | VHL |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | |||
72 | P | e | 85.3 | 7ntj_D | P |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | |||
73 | D | e | 98.8 | 7ntj_D | hetero MPP5_HUMAN | DP |
MOTIF /note="PDZ-binding; required for interaction with human PALS1" MUTAGEN /note="Missing: Abolishes interaction with PDZ domain of human PALS1; loss of accumulation in host perinuclear compartment." TOPO_DOM /note="Intravirion" MOTIF /note="PDZ-binding; required for interaction with human PALS1" MUTAGEN /note="Missing: Abolishes interaction with PDZ domain of human PALS1; loss of accumulation in host perinuclear compartment." TOPO_DOM /note="Intravirion" | ||
74 | L | e | 107.9 | 7ntj_D | hetero MPP5_HUMAN | L |
MOTIF /note="PDZ-binding; required for interaction with human PALS1" MUTAGEN /note="Missing: Abolishes interaction with PDZ domain of human PALS1; loss of accumulation in host perinuclear compartment." TOPO_DOM /note="Intravirion" MOTIF /note="PDZ-binding; required for interaction with human PALS1" MUTAGEN /note="Missing: Abolishes interaction with PDZ domain of human PALS1; loss of accumulation in host perinuclear compartment." TOPO_DOM /note="Intravirion" | ||
75 | L | e | 114.6 | 7ntj_D | hetero MPP5_HUMAN | L |
MOTIF /note="PDZ-binding; required for interaction with human PALS1" MUTAGEN /note="Missing: Abolishes interaction with PDZ domain of human PALS1; loss of accumulation in host perinuclear compartment." TOPO_DOM /note="Intravirion" MOTIF /note="PDZ-binding; required for interaction with human PALS1" MUTAGEN /note="Missing: Abolishes interaction with PDZ domain of human PALS1; loss of accumulation in host perinuclear compartment." TOPO_DOM /note="Intravirion" | ||
76 | V | e | 141.3 | 7ntj_D | hetero MPP5_HUMAN | V |
MOTIF /note="PDZ-binding; required for interaction with human PALS1" MUTAGEN /note="Missing: Abolishes interaction with PDZ domain of human PALS1; loss of accumulation in host perinuclear compartment." TOPO_DOM /note="Intravirion" MOTIF /note="PDZ-binding; required for interaction with human PALS1" MUTAGEN /note="Missing: Abolishes interaction with PDZ domain of human PALS1; loss of accumulation in host perinuclear compartment." TOPO_DOM /note="Intravirion" |