Contact Molecules for Homologous Proteins | ||||
[Summary Bars] |
[Full Bars] |
|
[Back to Search Page] |
[Back to HOMCOS] |
[Sites by Variants] |
[SupCon3D] |
[help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
2851321 | 76 | 14 | P59637(VEMP_SARS) | RecName: Full=Envelope small membrane protein ; Short=E protein ; Short=sM protein ; |
QUERYSEQ |
MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPTVYVYSRVKNLNSSEGVPDLLV |
[n]:site number of query sequence. [a]:amino acid of query sequence. [s]:predicted secondary structure. [e]:predicted exposed/buried. [acc]:predicted relative accesssibility(%). [pdb]:PDB code of homologous structure. [contact_mols]:predicted binding molecules [observed aa]:Observed amino acids among homologous sequences. [feature table]:UniProt Feature Table [variant]:UniProt Human Variant.
n | a | s | e | acc | pdb | contact_mols | observed aa | feature table | variant |
1 | M | - | - | - | - | M |
TOPO_DOM /note="Virion surface" TOPO_DOM /note="Virion surface" | ||
2 | Y | - | - | - | - | LY |
TOPO_DOM /note="Virion surface" TOPO_DOM /note="Virion surface" | ||
3 | S | - | - | - | - | PS |
TOPO_DOM /note="Virion surface" TOPO_DOM /note="Virion surface" | ||
4 | F | - | - | - | - | F |
TOPO_DOM /note="Virion surface" TOPO_DOM /note="Virion surface" | ||
5 | V | - | - | - | - | V |
TOPO_DOM /note="Virion surface" TOPO_DOM /note="Virion surface" | ||
6 | S | - | - | - | - | SQH |
TOPO_DOM /note="Virion surface" TOPO_DOM /note="Virion surface" | ||
7 | E | - | - | - | - | E |
TOPO_DOM /note="Virion surface" TOPO_DOM /note="Virion surface" | ||
8 | E | e | 98.5 | 8suz_E | EQDR |
TOPO_DOM /note="Virion surface" TOPO_DOM /note="Virion surface" | |||
9 | T | H | e | 77.3 | 8suz_E | TI |
TOPO_DOM /note="Virion surface" TOPO_DOM /note="Virion surface" | ||
10 | G | H | e | 26.2 | 8suz_E | GA |
TOPO_DOM /note="Virion surface" TOPO_DOM /note="Virion surface" | ||
11 | T | H | e | 79.2 | 8suz_E | homo | TWAL |
TOPO_DOM /note="Virion surface" TOPO_DOM /note="Virion surface" | |
12 | L | H | e | 86.5 | 8suz_E | homo | FLYI |
TOPO_DOM /note="Virion surface" TOPO_DOM /note="Virion surface" | |
13 | I | H | e | 78.4 | 8suz_E | homo | IV |
TOPO_DOM /note="Virion surface" TOPO_DOM /note="Virion surface" | |
14 | V | H | e | 68.7 | 8suz_E | homo | VG |
TOPO_DOM /note="Virion surface" TOPO_DOM /note="Virion surface" | |
15 | N | H | e | 57.0 | 8suz_E | homo | NQ |
TOPO_DOM /note="Virion surface" TOPO_DOM /note="Virion surface" | |
16 | S | H | e | 49.2 | 8suz_E | FSI |
TOPO_DOM /note="Virion surface" TOPO_DOM /note="Virion surface" | ||
17 | V | H | e | 76.0 | 8suz_E | homo | FV |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | |
18 | L | H | e | 60.1 | 8suz_E | homo | ILF |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | |
19 | L | H | e | 73.0 | 8suz_E | homo | LF |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | |
20 | F | H | e | 58.9 | 8suz_E | homo | FTVS |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | |
21 | L | H | e | 48.3 | 8suz_E | homo | LVF |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | |
22 | A | H | e | 49.1 | 8suz_E | VAS |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | ||
23 | F | H | e | 48.8 | 8suz_E | CF |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | ||
24 | V | H | e | 52.7 | 8suz_E | homo | VA |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | |
25 | V | H | e | 55.3 | 8suz_E | homo | IV |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | |
26 | F | H | e | 65.1 | 8suz_E | homo | FT |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | |
27 | L | H | e | 57.3 | 8suz_E | homo | L |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | |
28 | L | H | e | 69.1 | 8suz_E | homo | LIV |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | |
29 | V | H | e | 60.7 | 8suz_E | homo | VF |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | |
30 | T | H | e | 33.1 | 8suz_E | CTV |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | ||
31 | L | H | e | 72.5 | 8suz_E | homo | LVM |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | |
32 | A | H | e | 43.8 | 8suz_E | A |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | ||
33 | I | H | e | 77.8 | 8suz_E | homo | ILFV |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | |
34 | L | H | e | 61.8 | 8suz_E | L |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | ||
35 | T | H | e | 75.3 | 8suz_E | homo | TA |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | |
36 | A | T | e | 48.2 | 8suz_E | homo | AT |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | |
37 | L | e | 97.8 | 8suz_E | homo | ILT |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | ||
38 | R | e | 119.8 | 8suz_E | homo | RK |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | ||
39 | L | - | - | - | - | L |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | ||
40 | C | - | - | - | - | C |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | ||
41 | A | - | - | - | - | VAI |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | ||
42 | Y | - | - | - | - | QY |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | ||
43 | C | - | - | - | - | CI |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | ||
44 | C | - | - | - | - | CMVA |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | ||
45 | N | - | - | - | - | NSGT |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | ||
46 | I | - | - | - | - | GIF |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | ||
47 | V | - | - | - | - | VCF |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | ||
48 | N | - | - | - | - | NH |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | ||
49 | V | - | - | - | - | TVI |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | ||
50 | S | - | - | - | - | LSF |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | ||
51 | L | - | - | - | - | LIV |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | ||
52 | V | - | - | - | - | VFI |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | ||
53 | K | - | - | - | - | KSLQV |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | ||
54 | P | - | - | - | - | P |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | ||
55 | T | - | - | - | - | AST |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | ||
56 | V | - | - | - | - | VAFL |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | ||
57 | Y | - | - | - | - | YH |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | ||
58 | V | - | - | - | - | VIL |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | ||
59 | Y | - | - | - | - | Y |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | ||
60 | S | - | - | - | - | NSG |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | ||
61 | R | - | - | - | - | RT |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | ||
62 | V | - | - | - | - | VGA |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | ||
63 | K | - | - | - | - | KRA |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | ||
64 | N | - | - | - | - | NQFY |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | ||
65 | L | - | - | - | - | LQV |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | ||
66 | N | - | - | - | - | NYDK |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | ||
67 | S | - | - | - | - | SKF |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | ||
68 | S | - | - | - | - | SKQ |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | ||
69 | E | - | - | - | - | EPR |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | ||
70 | G | e | 148.8 | 7ntj_D | GSPADEFIKLNQRTVY |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | |||
71 | V | e | 114.0 | 7ntj_D | VHL |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | |||
72 | P | e | 85.3 | 7ntj_D | P |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | |||
73 | D | e | 137.0 | 7ntj_B | hetero MPP5_HUMAN | DP |
MOTIF /note="PDZ-binding; required for interaction with human PALS1" MUTAGEN /note="Missing: Abolishes interaction with PDZ domain of human PALS1; loss of accumulation in host perinuclear compartment." TOPO_DOM /note="Intravirion" MOTIF /note="PDZ-binding; required for interaction with human PALS1" MUTAGEN /note="Missing: Abolishes interaction with PDZ domain of human PALS1; loss of accumulation in host perinuclear compartment." TOPO_DOM /note="Intravirion" | ||
74 | L | e | 108.4 | 7ntj_B | hetero MPP5_HUMAN | L |
MOTIF /note="PDZ-binding; required for interaction with human PALS1" MUTAGEN /note="Missing: Abolishes interaction with PDZ domain of human PALS1; loss of accumulation in host perinuclear compartment." TOPO_DOM /note="Intravirion" MOTIF /note="PDZ-binding; required for interaction with human PALS1" MUTAGEN /note="Missing: Abolishes interaction with PDZ domain of human PALS1; loss of accumulation in host perinuclear compartment." TOPO_DOM /note="Intravirion" | ||
75 | L | e | 112.4 | 7ntj_B | hetero MPP5_HUMAN | L |
MOTIF /note="PDZ-binding; required for interaction with human PALS1" MUTAGEN /note="Missing: Abolishes interaction with PDZ domain of human PALS1; loss of accumulation in host perinuclear compartment." TOPO_DOM /note="Intravirion" MOTIF /note="PDZ-binding; required for interaction with human PALS1" MUTAGEN /note="Missing: Abolishes interaction with PDZ domain of human PALS1; loss of accumulation in host perinuclear compartment." TOPO_DOM /note="Intravirion" | ||
76 | V | e | 136.0 | 7ntj_B | hetero MPP5_HUMAN | V |
MOTIF /note="PDZ-binding; required for interaction with human PALS1" MUTAGEN /note="Missing: Abolishes interaction with PDZ domain of human PALS1; loss of accumulation in host perinuclear compartment." TOPO_DOM /note="Intravirion" MOTIF /note="PDZ-binding; required for interaction with human PALS1" MUTAGEN /note="Missing: Abolishes interaction with PDZ domain of human PALS1; loss of accumulation in host perinuclear compartment." TOPO_DOM /note="Intravirion" |