Contact Molecules for Homologous Proteins | ||||
![]() [Summary Bars] |
![]() [Full Bars] |
|
![]() [Back to Search Page] |
![]() [Back to HOMCOS] |
![]() [Sites by Variants] |
![]() [SupCon3D] |
![]() [help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | ![]() [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
20155 | 76 | 20 | P59637(VEMP_SARS) | RecName: Full=Envelope small membrane protein ; Short=E protein ; Short=sM protein ; |
QUERYSEQ |
MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPTVYVYSRVKNLNSSEGVPDLLV |
[n]:site number of query sequence. [a]:amino acid of query sequence. [s]:predicted secondary structure. [e]:predicted exposed/buried. [acc]:predicted relative accesssibility(%). [pdb]:PDB code of homologous structure. [contact_mols]:predicted binding molecules [observed aa]:Observed amino acids among homologous sequences. [feature table]:UniProt Feature Table [variant]:UniProt Human Variant.
n | a | s | e | acc | pdb | contact_mols | observed aa | feature table | variant |
![]() | M | - | - | - | - | M |
TOPO_DOM /note="Virion surface" TOPO_DOM /note="Virion surface" | ||
![]() | Y | - | - | - | - | LY |
TOPO_DOM /note="Virion surface" TOPO_DOM /note="Virion surface" | ||
![]() | S | - | - | - | - | PS |
TOPO_DOM /note="Virion surface" TOPO_DOM /note="Virion surface" | ||
![]() | F | - | - | - | - | F |
TOPO_DOM /note="Virion surface" TOPO_DOM /note="Virion surface" | ||
![]() | V | - | - | - | - | V |
TOPO_DOM /note="Virion surface" TOPO_DOM /note="Virion surface" | ||
![]() | S | - | - | - | - | SQH |
TOPO_DOM /note="Virion surface" TOPO_DOM /note="Virion surface" | ||
![]() | E | - | - | - | - | E |
TOPO_DOM /note="Virion surface" TOPO_DOM /note="Virion surface" | ||
![]() | E | e | 84.9 | ![]() |
homo | EQDR |
TOPO_DOM /note="Virion surface" TOPO_DOM /note="Virion surface" | ||
![]() | T | e | 108.4 | ![]() |
TI |
TOPO_DOM /note="Virion surface" TOPO_DOM /note="Virion surface" | |||
![]() | G | S | e | 58.3 | ![]() |
GA |
TOPO_DOM /note="Virion surface" TOPO_DOM /note="Virion surface" | ||
![]() | T | e | 23.4 | ![]() |
homo | TWAL |
TOPO_DOM /note="Virion surface" TOPO_DOM /note="Virion surface" | ||
![]() | L | e | 99.4 | ![]() |
homo | FLYI |
TOPO_DOM /note="Virion surface" TOPO_DOM /note="Virion surface" | ||
![]() | I | S | e | 88.9 | ![]() |
homo | IV |
TOPO_DOM /note="Virion surface" TOPO_DOM /note="Virion surface" | |
![]() | V | H | e | 50.7 | ![]() |
homo | VG |
TOPO_DOM /note="Virion surface" TOPO_DOM /note="Virion surface" | |
![]() | N | H | e | 67.3 | ![]() |
homo | NQ |
TOPO_DOM /note="Virion surface" TOPO_DOM /note="Virion surface" | |
![]() | S | H | e | 44.5 | ![]() |
homo | FSI |
TOPO_DOM /note="Virion surface" TOPO_DOM /note="Virion surface" | |
![]() | V | H | e | 54.7 | ![]() |
homo | FV |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | |
![]() | L | H | e | 86.0 | ![]() |
homo | ILF |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | |
![]() | L | H | e | 74.7 | ![]() |
homo | LF |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | |
![]() | F | H | e | 58.4 | ![]() |
homo | FTVS |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | |
![]() | L | H | e | 68.0 | ![]() |
homo | LVF |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | |
![]() | A | H | e | 36.6 | ![]() |
homo | VAS |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | |
![]() | F | H | e | 36.8 | ![]() |
homo | CF |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | |
![]() | V | H | e | 36.7 | ![]() |
homo | VA |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | |
![]() | V | H | e | 62.7 | ![]() |
homo | IV |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | |
![]() | F | H | e | 61.7 | ![]() |
homo | FT |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | |
![]() | L | H | e | 53.9 | ![]() |
homo | L |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | |
![]() | L | H | e | 69.1 | ![]() |
homo | LIV |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | |
![]() | V | H | e | 83.3 | ![]() |
homo | VF |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | |
![]() | T | H | e | 43.5 | ![]() |
CTV |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | ||
![]() | L | H | e | 66.9 | ![]() |
homo | LVM |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | |
![]() | A | H | e | 57.1 | ![]() |
A |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | ||
![]() | I | H | e | 77.2 | ![]() |
homo | ILFV |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | |
![]() | L | H | e | 52.8 | ![]() |
L |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | ||
![]() | T | H | e | 34.4 | ![]() |
homo | TA |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | |
![]() | A | H | e | 47.3 | ![]() |
homo | AT |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | |
![]() | L | H | e | 82.6 | ![]() |
homo | ILT |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | |
![]() | R | H | e | 58.9 | ![]() |
homo | RK |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | |
![]() | L | H | e | 28.1 | ![]() |
L |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | ||
![]() | C | H | e | 41.1 | ![]() |
C |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | ||
![]() | A | H | e | 60.7 | ![]() |
VAI |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | ||
![]() | Y | H | e | 37.4 | ![]() |
QY |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | ||
![]() | C | T | e | 36.6 | ![]() |
CI |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | ||
![]() | C | T | e | 87.5 | ![]() |
CMVA |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | ||
![]() | N | T | e | 84.8 | ![]() |
NSGT |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | ||
![]() | I | S | e | 92.4 | ![]() |
GIF |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | ||
![]() | V | e | 61.3 | ![]() |
homo | VCF |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | ||
![]() | N | S | e | 70.3 | ![]() |
homo | NH |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | |
![]() | V | e | 58.0 | ![]() |
homo | TVI |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | ||
![]() | S | b | 3.9 | ![]() |
LSF |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | |||
![]() | L | e | 78.1 | ![]() |
LIV |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | |||
![]() | V | S | e | 76.0 | ![]() |
VFI |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | ||
![]() | K | S | e | 62.7 | ![]() |
KSLQV |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | ||
![]() | P | T | e | 52.7 | ![]() |
P |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | ||
![]() | T | T | b | 17.5 | ![]() |
AST |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | ||
![]() | V | H | e | 66.7 | ![]() |
VAFL |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | ||
![]() | Y | H | e | 53.0 | ![]() |
homo | YH |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | |
![]() | V | H | e | 52.0 | ![]() |
VIL |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | ||
![]() | Y | H | e | 73.5 | ![]() |
Y |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | ||
![]() | S | H | e | 45.3 | ![]() |
homo | NSG |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | |
![]() | R | H | e | 74.7 | ![]() |
homo | RT |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | |
![]() | V | H | e | 78.0 | ![]() |
VGA |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | ||
![]() | K | H | e | 73.1 | ![]() |
homo | KRA |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | |
![]() | N | H | e | 78.2 | ![]() |
homo | NQFY |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | |
![]() | L | e | 119.7 | ![]() |
homo | LQV |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | ||
![]() | N | - | - | - | - | NYDK |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | ||
![]() | S | - | - | - | - | SKF |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | ||
![]() | S | - | - | - | - | SKQ |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | ||
![]() | E | - | - | - | - | EPR |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | ||
![]() | G | e | 148.8 | ![]() |
GSPADEFIKLNQRTVY |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | |||
![]() | V | e | 114.0 | ![]() |
VHL |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | |||
![]() | P | e | 85.3 | ![]() |
P |
TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion" | |||
![]() | D | e | 137.0 | ![]() |
hetero MPP5_HUMAN | DP |
MOTIF /note="PDZ-binding; required for interaction with human PALS1" MUTAGEN /note="Missing: Abolishes interaction with PDZ domain of human PALS1; loss of accumulation in host perinuclear compartment." TOPO_DOM /note="Intravirion" MOTIF /note="PDZ-binding; required for interaction with human PALS1" MUTAGEN /note="Missing: Abolishes interaction with PDZ domain of human PALS1; loss of accumulation in host perinuclear compartment." TOPO_DOM /note="Intravirion" | ||
![]() | L | e | 108.4 | ![]() |
hetero MPP5_HUMAN | L |
MOTIF /note="PDZ-binding; required for interaction with human PALS1" MUTAGEN /note="Missing: Abolishes interaction with PDZ domain of human PALS1; loss of accumulation in host perinuclear compartment." TOPO_DOM /note="Intravirion" MOTIF /note="PDZ-binding; required for interaction with human PALS1" MUTAGEN /note="Missing: Abolishes interaction with PDZ domain of human PALS1; loss of accumulation in host perinuclear compartment." TOPO_DOM /note="Intravirion" | ||
![]() | L | e | 112.4 | ![]() |
hetero MPP5_HUMAN | L |
MOTIF /note="PDZ-binding; required for interaction with human PALS1" MUTAGEN /note="Missing: Abolishes interaction with PDZ domain of human PALS1; loss of accumulation in host perinuclear compartment." TOPO_DOM /note="Intravirion" MOTIF /note="PDZ-binding; required for interaction with human PALS1" MUTAGEN /note="Missing: Abolishes interaction with PDZ domain of human PALS1; loss of accumulation in host perinuclear compartment." TOPO_DOM /note="Intravirion" | ||
![]() | V | e | 136.0 | ![]() |
hetero MPP5_HUMAN | V |
MOTIF /note="PDZ-binding; required for interaction with human PALS1" MUTAGEN /note="Missing: Abolishes interaction with PDZ domain of human PALS1; loss of accumulation in host perinuclear compartment." TOPO_DOM /note="Intravirion" MOTIF /note="PDZ-binding; required for interaction with human PALS1" MUTAGEN /note="Missing: Abolishes interaction with PDZ domain of human PALS1; loss of accumulation in host perinuclear compartment." TOPO_DOM /note="Intravirion" |