Contact Molecules for Homologous Proteins | ||||
[Summary Bars] |
[Full Bars] |
|
[Back to Search Page] |
[Back to HOMCOS] |
[SupCon3D] |
[help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
19278 | 113 | 66 | YP_009725305.1() | |
QUERYSEQ |
NNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ |
All | ||
Number of sites | 113 | |
Buired or Exposed | Buried | 31.0 (%) [35] |
Exposed | 69.0 (%) [78] | |
Ave relacc | 39.1 % | |
SD relacc | 27.29 % | |
Contact Mol | hetero | 34.5 (%) [39] |
nucleotide | 0.9 (%) [1] | |
compound | 15.0 (%) [17] | |
metal | 0.9 (%) [1] | |
otherpoly | 0.0 (%) [0] | |
homo | 68.1 (%) [77] | |
precipitant | 53.1 (%) [60] | |
Number of variants | 0 | |
N_Freq(AAvariant)==0 % | ||
N_Freq(AAvariant)>0 % | ||
Ave Freq(AAvariant) | ||
SD Freq(AAvariant) |