Contact Molecules for Homologous Proteins | ||||
[Summary Bars] |
[Full Bars] |
|
[Back to Search Page] |
[Back to HOMCOS] |
[SupCon3D] |
[help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
5837 | 76 | 14 | P59637(VEMP_SARS) | RecName: Full=Envelope small membrane protein ; Short=E protein ; Short=sM protein ; |
QUERYSEQ |
MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPTVYVYSRVKNLNSSEGVPDLLV |
All | ||
Number of sites | 76 | |
Buired or Exposed | Buried | 0.0 (%) [0] |
Exposed | 100.0 (%) [38] | |
Ave relacc | 75.5 % | |
SD relacc | 28.81 % | |
Contact Mol | hetero | 5.3 (%) [4] |
nucleotide | 0.0 (%) [0] | |
compound | 0.0 (%) [0] | |
metal | 0.0 (%) [0] | |
otherpoly | 0.0 (%) [0] | |
homo | 28.9 (%) [22] | |
precipitant | 0.0 (%) [0] | |
Number of variants | 0 | |
N_Freq(AAvariant)==0 % | ||
N_Freq(AAvariant)>0 % | ||
Ave Freq(AAvariant) | ||
SD Freq(AAvariant) |