Contact Molecules for Homologous Proteins | ||||
[Full Bars] |
[SiteTable] |
|
[Back to Search Page] |
[Back to HOMCOS] |
[SupCon3D] |
[help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
2624989 | 215 | 33 | P09429(HMGB1_HUMAN) | RecName: Full=High mobility group protein B1;AltName: Full=High mobility group protein 1; Short=HMG-1; |
QUERYSEQ |
MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAK LKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE |
215 | region | name | description |
1-215 | CHAIN | /note="High mobility group protein B1" /id="PRO_0000048526" | |
9-79 | DNA_BIND | /note="HMG box 1" | |
95-163 | DNA_BIND | /note="HMG box 2" | |
1-97 | REGION | /note="Sufficient for interaction with HAVCR2" | |
3-15 | REGION | /note="LPS binding (delipidated)" | |
76-95 | REGION | /note="Disordered" | |
80-96 | REGION | /note="LPS binding (Lipid A)" | |
89-108 | REGION | /note="Cytokine-stimulating activity" | |
150-183 | REGION | /note="Binding to AGER/RAGE" | |
161-215 | REGION | /note="Disordered" | |
76-94 | COMPBIAS | /note="Basic and acidic residues" | |
161-187 | COMPBIAS | /note="Basic and acidic residues" | |
188-215 | COMPBIAS | /note="Acidic residues" | |
1-10 | BINDING | /ligand="heparin" /ligand_id="ChEBI:CHEBI:28304" | |
1-215 | DISORDER | predicted by DISOPRED |
MONOMER | |||||||
215 | |||||||
pdb_id | a1 | identity[%]2 | description | ||||
2yrq | A | 100.0 | HMGB1_HUMAN High mobility group protein B1 | ||||
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue. |
HETERO | |||||||
215 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
2ly4[1] | B | P53_HUMAN Cellular tumor antigen p53[47 aa] | A | 100.0 /100.0 |
17 /17 |
HMGB1_HUMAN High mobility group protein B1 | |
6cij[2] | A | RAG1_MOUSE V(D)J recombination-activating protein 1[614 aa] | G | 100.0 /100.0 |
3 /3 |
HMGB1_HUMAN High mobility group protein B1 | |
8i9m[1] | B | RAGE_HUMAN Advanced glycosylation end product-specific recept.. | A | 100.0 /100.0 |
14 /14 |
HMGB1_HUMAN High mobility group protein B1 | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
NUCLEOTIDE | |||||||
215 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
1ckt[1] | A | DNA (5'-D(*CP*CP*(5IU)P*CP*TP*CP*TP*GP*GP*AP*CP*CP.. | C | 100.0 /100.0 |
9 /9 |
HMG1_RAT HIGH MOBILITY GROUP 1 PROTEIN | |
1ckt[1] | B | DNA (5'-D(*GP*GP*AP*AP*GP*GP*TP*CP*CP*AP*GP*AP*GP*.. | C | 100.0 /100.0 |
10 /10 |
HMG1_RAT HIGH MOBILITY GROUP 1 PROTEIN | |
4qr9[2] | C | DNA (5'-D(*AP*TP*AP*TP*CP*GP*AP*TP*AP*T)-3') | A | 100.0 /100.0 |
11 /11 |
HMGB1_RAT High mobility group protein B1 | |
4qr9[2] | D | DNA (5'-D(*AP*TP*AP*TP*CP*GP*AP*TP*AP*T)-3') | A | 100.0 /100.0 |
10 /11 |
HMGB1_RAT High mobility group protein B1 | |
4qr9[1] | F | DNA (5'-D(*AP*TP*AP*TP*CP*GP*AP*TP*AP*T)-3') | A | 100.0 /100.0 |
2 /4 |
HMGB1_RAT High mobility group protein B1 | |
5zdz[3] | I | DNA (39-MER) | E | 100.0 /100.0 |
10 /10 |
HMGB1_MOUSE HMGB1 A-B box | |
5zdz[3] | K | DNA chain M | E | 100.0 /100.0 |
11 /11 |
HMGB1_MOUSE HMGB1 A-B box | |
5ze2[1] | H | DNA (40-MER) | E | 100.0 /100.0 |
7 /7 |
HMGB1_MOUSE HMGB1 A-B box | |
5ze2[1] | J | DNA (40-MER) | E | 100.0 /100.0 |
10 /10 |
HMGB1_MOUSE HMGB1 A-B box | |
6cg0[1] | H | DNA (60-MER) | K | 100.0 /100.0 |
12 /12 |
HMGB1_HUMAN High mobility group protein B1 | |
6cg0[1] | J | DNA (41-MER) | K | 100.0 /100.0 |
11 /11 |
HMGB1_HUMAN High mobility group protein B1 | |
6cij[1] | K | DNA (41-MER) | G | 100.0 /100.0 |
12 /12 |
HMGB1_HUMAN High mobility group protein B1 | |
6cij[1] | F | DNA (60-MER) | G | 100.0 /100.0 |
10 /10 |
HMGB1_HUMAN High mobility group protein B1 | |
6cik[1] | H | Nicked 23RSS intermediate reverse strand | E | 100.0 /100.0 |
10 /10 |
HMGB1_HUMAN High mobility group protein B1 | |
6cik[1] | J | Nicked 23RSS intermediate forward strand | E | 100.0 /100.0 |
6 /6 |
HMGB1_HUMAN High mobility group protein B1 | |
6cil[1] | H | Intact 23RSS substrate reverse strand | E | 100.0 /100.0 |
5 /5 |
HMGB1_HUMAN High mobility group protein B1 | |
6cim[1] | I | Intact 23RSS substrate reverse strand | E | 100.0 /100.0 |
10 /10 |
HMGB1_HUMAN High mobility group protein B1 | |
6cim[1] | J | Intact 23RSS substrate forward strand | E | 100.0 /100.0 |
5 /5 |
HMGB1_HUMAN High mobility group protein B1 | |
6oem[1] | E | DNA (57-MER) | I | 100.0 /100.0 |
7 /7 |
HMGB1_HUMAN High mobility group protein B1 | |
6oen[1] | E | DNA (57-MER) | I | 100.0 /100.0 |
7 /7 |
HMGB1_HUMAN High mobility group protein B1 | |
6oem[1] | H | DNA (57-MER) | I | 100.0 /100.0 |
7 /7 |
HMGB1_HUMAN High mobility group protein B1 | |
6oen[2] | H | DNA (57-MER) | I | 100.0 /100.0 |
8 /8 |
HMGB1_HUMAN High mobility group protein B1 | |
6oem[1] | F | DNA (46-MER) | J | 100.0 /100.0 |
8 /8 |
HMGB1_HUMAN High mobility group protein B1 | |
6oen[2] | F | DNA (46-MER) | J | 100.0 /100.0 |
8 /8 |
HMGB1_HUMAN High mobility group protein B1 | |
6oem[1] | G | DNA (46-MER) | J | 100.0 /100.0 |
5 /5 |
HMGB1_HUMAN High mobility group protein B1 | |
6oen[2] | G | DNA (46-MER) | J | 100.0 /100.0 |
3 /3 |
HMGB1_HUMAN High mobility group protein B1 | |
6oer[1] | G | DNA (57-MER) | I | 100.0 /100.0 |
5 /5 |
HMGB1_HORSE High mobility group protein B1 | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
HOMO | |||||||
215 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
4qr9[2] | B | HMGB1_RAT High mobility group protein B1[75 aa] | A | 100.0 /100.0 |
5 /5 |
HMGB1_RAT High mobility group protein B1 | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
PRECIPITANT | |||||||
215 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
1hsm[2] | B |
BME
BETA-MERCAPTOETHANOL[4 atoms] |
A | 100.0 /100.0 |
4 /4 |
HMG1_CRIGR HIGH MOBILITY GROUP PROTEIN 1 | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. |