Contact Molecules for Homologous Proteins

[Full Bars]
[SiteTable]


Summary Bars[60 %]


[Back to Search Page]
[Back to HOMCOS]

[SupCon3D]
[help] 		seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
2691701 207 37 P51149(RAB7A_HUMAN) RecName: Full=Ras-related protein Rab-7a ; EC=3.6.5.2 ;
QUERYSEQ 
MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQIWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPFVVLGNKIDLENRQVATKRAQAWCYSKNNIP
YFETSAKEAINVEQAFQTIARNALKQETEVELYNEFPEPIKLDKNDRAKASAESCSC
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [P51149(RAB7A_HUMAN)]

207
region name description
2-207 CHAIN /note="Ras-related protein Rab-7a" /id="PRO_0000121121"
15-22 BINDING /ligand="GTP" /ligand_id="ChEBI:CHEBI:37565" ECO:0000269|PubMed:20028791"
34-40 BINDING /ligand="GTP" /ligand_id="ChEBI:CHEBI:37565" ECO:0000269|PubMed:20028791"
63-67 BINDING /ligand="GTP" /ligand_id="ChEBI:CHEBI:37565" ECO:0000269|PubMed:20028791"
125-128 BINDING /ligand="GTP" /ligand_id="ChEBI:CHEBI:37565" ECO:0000269|PubMed:20028791"
156-157 BINDING /ligand="GTP" /ligand_id="ChEBI:CHEBI:37565" ECO:0000269|PubMed:20028791"
205-205 LIPID /note="S-geranylgeranyl cysteine"
207-207 LIPID /note="S-geranylgeranyl cysteine"
1-207 DISORDER predicted by DISOPRED

MONOMER
207
pdb_id a1 identity[%]2 description
1vg8 A 100.0 RAB7_RAT Ras-related protein Rab-7 
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HETERO
207 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
1vg0[1] A RAE1_RAT Rab proteins geranylgeranyltransferase component A.. B 100.0
/100.0		 24
/24		 RAB7_RAT Ras-related protein Rab-7
1vg9[4] A RAE1_RAT Rab proteins geranylgeranyltransferase component A.. B 100.0
/100.0		 19
/19		 RAB7_RAT Ras-related protein Rab-7
1yhn[2] B RILP_HUMAN Rab interacting lysosomal protein[65 aa] A 100.0
/99.5		 13
/13		 RAB7_HUMAN Ras-related protein Rab-7
1yhn[2] B RILP_HUMAN Rab interacting lysosomal protein[65 aa] A 100.0
/99.5		 17
/17		 RAB7_HUMAN Ras-related protein Rab-7
6wcw[1] B RUBIC_HUMAN Run domain Beclin-1-interacting and cysteine-rich .. A 100.0
/99.4		 18
/18		 RAB7A_HUMAN Ras-related protein Rab-7a
7f6j[2] C PDZD8_HUMAN PDZ domain-containing protein 8[106 aa] A 100.0
/99.4		 26
/26		 RAB7A_HUMAN Ras-related protein Rab-7a
6iyb[2] B OSBL1_HUMAN Oxysterol-binding protein-related protein 1[135 aa.. A 100.0
/99.4		 12
/12		 RAB7A_HUMAN Ras-related protein Rab-7a
5z2m[1] A OSBL1_MOUSE Oxysterol-binding protein-related protein 1[137 aa.. B 88.9
/99.4		 9
/9		 RAB7A_MOUSE Ras-related protein Rab-7a
5z2m[1] D OSBL1_MOUSE Oxysterol-binding protein-related protein 1[136 aa.. C 100.0
/99.4		 7
/7		 RAB7A_MOUSE Ras-related protein Rab-7a
5ldd[2] A G0SGS3_CHATD Mon1[155 aa] C 95.0
/85.1		 20
/20		 G0SGE1_CHATD Rab small monomeric GTPase-like protein
5ldd[2] B G0SD94_CHATD Ccz1[166 aa] C 100.0
/85.1		 6
/6		 G0SGE1_CHATD Rab small monomeric GTPase-like protein
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
COMPOUND
207 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
1ky3[7] C GDP
GUANOSINE-5'-DIPHOSPHATE[28 atoms] 		A 93.3
/67.3		 15
/15		 YPT7_YEAST GTP-BINDING PROTEIN YPT7P
1ky2[10] C GNP
PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER[32 ato.. 		A 90.0
/70.1		 20
/20		 YPT7_YEAST GTP-BINDING PROTEIN YPT7P
1t91[13] F GTP
GUANOSINE-5'-TRIPHOSPHATE[32 atoms] 		A 100.0
/99.4		 23
/23		 RAB7_HUMAN Ras-related protein Rab-7
4phh[4] E 2UK
5'-O-[(R)-hydroxy{[(S)-hydroxy(phosphonoamino)phos.. 		A 90.0
/69.5		 20
/20		 YPT7_YEAST GTP-binding protein YPT7
4phg[1] C 2UJ
N-[3-(propanoylamino)propyl]guanosine 5'-(tetrahyd.. 		A 91.3
/68.4		 23
/23		 YPT7_YEAST GTP-binding protein YPT7
4phf[1] B 2UH
N-[3-(propanoylamino)propyl]guanosine 5'-(trihydro.. 		A 87.5
/67.3		 16
/16		 YPT7_YEAST GTP-binding protein YPT7
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
METAL
207 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
1vg9[4] J K
POTASSIUM ION[1 atoms] 		B 100.0
/100.0		 1
/1		 RAB7_RAT Ras-related protein Rab-7
1ky2[24] B MG
MAGNESIUM ION[1 atoms] 		A 100.0
/70.1		 2
/2		 YPT7_YEAST GTP-BINDING PROTEIN YPT7P
4phf[7] C MG
MAGNESIUM ION[1 atoms] 		A 100.0
/67.3		 1
/1		 YPT7_YEAST GTP-binding protein YPT7
6iyb[4] E MG
MAGNESIUM ION[1 atoms] 		A 100.0
/99.4		 2
/2		 RAB7A_HUMAN Ras-related protein Rab-7a
4phh[1] G CL
CHLORIDE ION[1 atoms] 		A 0.0
/69.5		 1
/1		 YPT7_YEAST GTP-binding protein YPT7
4phh[2] J CL
CHLORIDE ION[1 atoms] 		B 80.0
/69.3		 5
/5		 YPT7_YEAST GTP-binding protein YPT7
4phg[1] D YT3
YTTRIUM (III) ION[1 atoms] 		A 0.0
/68.4		 1
/1		 YPT7_YEAST GTP-binding protein YPT7
4phg[1] E YT3
YTTRIUM (III) ION[1 atoms] 		A 100.0
/68.4		 2
/2		 YPT7_YEAST GTP-binding protein YPT7
4phg[1] F YT3
YTTRIUM (III) ION[1 atoms] 		A 100.0
/68.4		 1
/1		 YPT7_YEAST GTP-binding protein YPT7
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
207 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
1vg0[1] G PG4
TETRAETHYLENE GLYCOL[13 atoms] 		B 100.0
/100.0		 4
/4		 RAB7_RAT Ras-related protein Rab-7
1vg9[4] L P33
3,6,9,12,15,18-HEXAOXAICOSANE-1,20-DIOL[22 atoms] 		B 100.0
/100.0		 5
/5		 RAB7_RAT Ras-related protein Rab-7
5ldd[2] G SO4
SULFATE ION[5 atoms] 		C 100.0
/85.1		 8
/8		 G0SGE1_CHATD Rab small monomeric GTPase-like protein
5ldd[1] H SO4
SULFATE ION[5 atoms] 		C 80.0
/85.1		 5
/5		 G0SGE1_CHATD Rab small monomeric GTPase-like protein
4phf[1] D NO3
NITRATE ION[4 atoms] 		A 66.7
/67.3		 6
/6		 YPT7_YEAST GTP-binding protein YPT7
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.