Contact Molecules for Homologous Proteins

[Full Bars]
[SiteTable]


Summary Bars[100 %]


[Back to Search Page]
[Back to HOMCOS]

[SupCon3D]
[help] 		seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
2691701 207 10 P51149(RAB7A_HUMAN) RecName: Full=Ras-related protein Rab-7a ; EC=3.6.5.2 ;
QUERYSEQ 
MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQIWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPFVVLGNKIDLENRQVATKRAQAWCYSKNNIP
YFETSAKEAINVEQAFQTIARNALKQETEVELYNEFPEPIKLDKNDRAKASAESCSC
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [P51149(RAB7A_HUMAN)]

207
region name description
2-207 CHAIN /note="Ras-related protein Rab-7a" /id="PRO_0000121121"
15-22 BINDING /ligand="GTP" /ligand_id="ChEBI:CHEBI:37565" ECO:0000269|PubMed:20028791"
34-40 BINDING /ligand="GTP" /ligand_id="ChEBI:CHEBI:37565" ECO:0000269|PubMed:20028791"
63-67 BINDING /ligand="GTP" /ligand_id="ChEBI:CHEBI:37565" ECO:0000269|PubMed:20028791"
125-128 BINDING /ligand="GTP" /ligand_id="ChEBI:CHEBI:37565" ECO:0000269|PubMed:20028791"
156-157 BINDING /ligand="GTP" /ligand_id="ChEBI:CHEBI:37565" ECO:0000269|PubMed:20028791"
205-205 LIPID /note="S-geranylgeranyl cysteine"
207-207 LIPID /note="S-geranylgeranyl cysteine"
1-207 DISORDER predicted by DISOPRED

MONOMER
207
pdb_id a1 identity[%]2 description
1vg8 A 100.0 RAB7_RAT Ras-related protein Rab-7 
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HETERO
207 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
1vg0[1] A RAE1_RAT Rab proteins geranylgeranyltransferase component A.. B 100.0
/100.0		 24
/24		 RAB7_RAT Ras-related protein Rab-7
1vg9[4] A RAE1_RAT Rab proteins geranylgeranyltransferase component A.. B 100.0
/100.0		 19
/19		 RAB7_RAT Ras-related protein Rab-7
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
COMPOUND
207 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
1vg0[6] F GDP
GUANOSINE-5'-DIPHOSPHATE[28 atoms] 		B 100.0
/100.0		 17
/17		 RAB7_RAT Ras-related protein Rab-7
1vg8[4] F GNP
PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER[32 ato.. 		A 100.0
/100.0		 22
/22		 RAB7_RAT Ras-related protein Rab-7
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
METAL
207 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
1vg0[10] E MG
MAGNESIUM ION[1 atoms] 		B 100.0
/100.0		 2
/2		 RAB7_RAT Ras-related protein Rab-7
1vg9[4] J K
POTASSIUM ION[1 atoms] 		B 100.0
/100.0		 1
/1		 RAB7_RAT Ras-related protein Rab-7
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
207 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
1vg0[1] G PG4
TETRAETHYLENE GLYCOL[13 atoms] 		B 100.0
/100.0		 4
/4		 RAB7_RAT Ras-related protein Rab-7
1vg9[4] L P33
3,6,9,12,15,18-HEXAOXAICOSANE-1,20-DIOL[22 atoms] 		B 100.0
/100.0		 5
/5		 RAB7_RAT Ras-related protein Rab-7
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.