Contact Molecules for Homologous Proteins | ||||
[Full Bars] |
[SiteTable] |
|
[Back to Search Page] |
[Back to HOMCOS] |
[SupCon3D] |
[help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
9058 | 422 | 14 | P59595(NCAP_SARS) | RecName: Full=Nucleoprotein ;AltName: Full=Nucleocapsid protein ; Short=NC ; Short=Protein N ; |
QUERYSEQ |
MSDNGPQSNQRSAPRITFGGPTDSTDNNQNGGRNGARPKQRRPQGLPNNTASWFTALTQHGKEELRFPRGQGVPINTNSGPDDQIGYYRRATRRVRGGDGKMKELSPRWYFYYLGTGPEASLPYGANKEGIVWVATEGALNTPKDHIGTR NPNNNAATVLQLPQGTTLPKGFYAEGSRGGSQASSRSSSRSRGNSRNSTPGSSRGNSPARMASGGGETALALLLLDRLNQLESKVSGKGQQQQGQTVTKKSAAEASKKPRQKRTATKQYNVTQAFGRRGPEQTQGNFGDQDLIRQGTDYK HWPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYHGAIKLDDKDPQFKDNVILLNKHIDAYKTFPPTEPKKDKKKKTDEAQPLPQRQKKQPTVTLLPAADMDDFSRQLQNSMSGASADSTQA |
422 | region | name | description |
1-422 | CHAIN | /note="Nucleoprotein" /id="PRO_0000106003" | |
49-176 | DOMAIN | /note="CoV N NTD" | |
248-365 | DOMAIN | /note="CoV N CTD" | |
1-52 | REGION | /note="Disordered" | |
42-187 | REGION | /note="RNA-binding" | |
45-181 | REGION | /note="RNA-binding" | |
167-214 | REGION | /note="Disordered" | |
177-204 | REGION | /note="SR region" | |
234-287 | REGION | /note="Disordered" | |
259-362 | REGION | /note="Dimerization" | |
362-422 | REGION | /note="Disordered" | |
1-35 | COMPBIAS | /note="Polar residues" | |
178-209 | COMPBIAS | /note="Polar residues" | |
234-252 | COMPBIAS | /note="Polar residues" | |
265-287 | COMPBIAS | /note="Polar residues" | |
363-383 | COMPBIAS | /note="Basic and acidic residues" | |
404-422 | COMPBIAS | /note="Polar residues" | |
93-93 | BINDING | /ligand="RNA" /ligand_id="ChEBI:CHEBI:33697" | |
108-108 | BINDING | /ligand="RNA" /ligand_id="ChEBI:CHEBI:33697" | |
150-150 | BINDING | /ligand="RNA" /ligand_id="ChEBI:CHEBI:33697" | |
1-422 | DISORDER | predicted by DISOPRED |
MONOMER | |||||||
422 | |||||||
pdb_id | a1 | identity[%]2 | description | ||||
2ofz | A | 100.0 | NCAP_CVHSA Nucleocapsid protein | ||||
2jw8 | B | 100.0 | NCAP_CVHSA Nucleocapsid protein | ||||
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue. |
HOMO | |||||||
422 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
2cjr[16] | B | NCAP_CVHSA NUCLEOCAPSID PROTEIN[113 aa] | A | 100.0 /100.0 |
52 /52 |
NCAP_CVHSA NUCLEOCAPSID PROTEIN | |
2gib[2] | A | NCAP_CVHSA Nucleocapsid protein[97 aa] | A | 100.0 /100.0 |
8 /8 |
NCAP_CVHSA Nucleocapsid protein | |
2gib[2] | A | NCAP_CVHSA Nucleocapsid protein[97 aa] | A | 100.0 /100.0 |
6 /6 |
NCAP_CVHSA Nucleocapsid protein | |
2gib[2] | B | NCAP_CVHSA Nucleocapsid protein[96 aa] | A | 100.0 /100.0 |
1 /1 |
NCAP_CVHSA Nucleocapsid protein | |
2gib[2] | A | NCAP_CVHSA Nucleocapsid protein[97 aa] | B | 100.0 /100.0 |
3 /3 |
NCAP_CVHSA Nucleocapsid protein | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
PRECIPITANT | |||||||
422 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
2gib[5] | C |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /100.0 |
2 /2 |
NCAP_CVHSA Nucleocapsid protein | |
2ofz[1] | B |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
2 /2 |
NCAP_CVHSA Nucleocapsid protein | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. |