Contact Molecules for Homologous Proteins | ||||
[Full Bars] |
[SiteTable] |
|
[Back to Search Page] |
[Back to HOMCOS] |
[SupCon3D] |
[help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
6937 | 113 | 44 | YP_009725305.1() | |
QUERYSEQ |
NNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ |
113 | region | name | description |
1-8 | DISORDER | predicted by DISOPRED |
MONOMER | |||||||
113 | |||||||
pdb_id | a1 | identity[%]2 | description | ||||
6w4b | B | 100.0 | R1AB_SARS2 Non-structural protein 9 | ||||
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue. |
HETERO | |||||||
113 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
7cyq[18] | A | R1AB_SARS2 RNA-directed RNA polymerase[926 aa] | I | 100.0 /100.0 |
12 /12 |
R1AB_SARS2 Non-structural protein 9 | |
7egq[2] | G | R1AB_SARS2 Non-structural protein 10[131 aa] | F | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 9 | |
7egq[2] | H | R1AB_SARS2 Proofreading exoribonuclease[523 aa] | F | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 9 | |
7eiz[1] | I | R1AB_SARS2 Proofreading exoribonuclease[523 aa] | E | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 9 | |
8dqu[12] | A | Nanobody[127 aa] | C | 100.0 /100.0 |
15 /15 |
R1AB_SARS2 Non-structural protein 9 | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
NUCLEOTIDE | |||||||
113 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
8gwb[1] | H | RNA (5'-R(P*AP*U)-3') | G | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 9 | |
8gwe[1] | H | RNA (5'-R(P*AP*UP*UP*A)-3') | G | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 9 | |
8sqj[1] | H | SARS-CoV-2 5' UTR | E | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 9 | |
8sqk[1] | H | SARS-CoV-2 5' UTR | E | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 9 | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
COMPOUND | |||||||
113 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
7cyq[1] | L |
GDP
GUANOSINE-5'-DIPHOSPHATE[28 atoms] |
I | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 9 | |
7kri[12] | E |
X0Y
1,3-dimethyl-1H-pyrrolo[3,4-d]pyrimidine-2,4(3H,6H.. |
A | 100.0 /100.0 |
6 /7 |
R1AB_SARS2 Non-structural protein 9 | |
7n3k[8] | I |
ODN
(1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14.. |
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 9 | |
7n3k[8] | J |
ODN
(1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14.. |
A | 100.0 /100.0 |
2 /3 |
R1AB_SARS2 Non-structural protein 9 | |
8gw1[2] | T |
U5P
URIDINE-5'-MONOPHOSPHATE[20 atoms] |
I | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 9 | |
8gwf[2] | L |
GTP
GUANOSINE-5'-TRIPHOSPHATE[32 atoms] |
I | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 9 | |
8gwi[1] | L |
GTP
GUANOSINE-5'-TRIPHOSPHATE[32 atoms] |
I | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 9 | |
8gwk[1] | T |
F86
[(2~{R},3~{S},4~{R},5~{R})-5-(4-azanylpyrrolo[2,1-.. |
I | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 9 | |
8gwm[1] | S |
6GS
2'-deoxy-2'-fluoro-2'-methyluridine 5'-(trihydroge.. |
G | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 9 | |
8sq9[1] | O |
WSB
5'-O-[(S)-hydroxy{[(S)-hydroxy(phosphonooxy)phosph.. |
E | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 9 | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
METAL | |||||||
113 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
7cyq[1] | M |
MG
MAGNESIUM ION[1 atoms] |
I | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 9 | |
8sq9[1] | N |
MG
MAGNESIUM ION[1 atoms] |
E | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 9 | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
HOMO | |||||||
113 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
6w4b[12] | B | R1AB_SARS2 Non-structural protein 9[116 aa] | A | 100.0 /100.0 |
16 /16 |
R1AB_SARS2 Non-structural protein 9 | |
6w9q[16] | A | R1AB_SARS2 3C-like proteinase peptide, Non-structural protein.. | A | 100.0 /100.0 |
20 /24 |
R1AB_SARS2 3C-like proteinase peptide, Non-structural protein.. | |
7kri[6] | B | R1AB_SARS2 Non-structural protein 9[127 aa] | A | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 9 | |
7kri[6] | C | R1AB_SARS2 Non-structural protein 9[123 aa] | A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 9 | |
7kri[6] | C | R1AB_SARS2 Non-structural protein 9[123 aa] | A | 100.0 /100.0 |
15 /18 |
R1AB_SARS2 Non-structural protein 9 | |
8dqu[12] | D | R1AB_SARS2 Non-structural protein 9[74 aa] | C | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 Non-structural protein 9 | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
PRECIPITANT | |||||||
113 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
6w9q[2] | B |
PO4
PHOSPHATE ION[5 atoms] |
A | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 3C-like proteinase peptide, Non-structural protein.. | |
6wc1[2] | C |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /100.0 |
2 /2 |
SARS-coV-2 Non-structural protein 9 | |
6wxd[1] | D |
SO4
SULFATE ION[5 atoms] |
B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 9 | |
6wxd[1] | E |
SO4
SULFATE ION[5 atoms] |
B | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Non-structural protein 9 | |
7bwq[2] | G |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /100.0 |
3 /3 |
Nsp9 | |
7bwq[2] | H |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /100.0 |
5 /5 |
Nsp9 | |
7bwq[6] | I |
SO4
SULFATE ION[5 atoms] |
B | 100.0 /100.0 |
4 /4 |
Nsp9 | |
7bwq[1] | K |
SO4
SULFATE ION[5 atoms] |
F | 100.0 /100.0 |
2 /2 |
Nsp9 | |
7kri[2] | J |
SO4
SULFATE ION[5 atoms] |
C | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 9 | |
7n3k[8] | K |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 9 | |
7kri[8] | K |
MLI
MALONATE ION[7 atoms] |
A | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 9 | |
7thm[1] | I |
POP
PYROPHOSPHATE 2-[9 atoms] |
E | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 9 | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. |