Contact Molecules for Homologous Proteins

[Summary Bars]
[SiteTable]


Full Bars[80 %]


[Back to Search Page]
[Back to HOMCOS]

[SupCon3D]
[help] 		seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
9058 422 188 P59595(NCAP_SARS) RecName: Full=Nucleoprotein ;AltName: Full=Nucleocapsid protein ; Short=NC ; Short=Protein N ;
QUERYSEQ 
MSDNGPQSNQRSAPRITFGGPTDSTDNNQNGGRNGARPKQRRPQGLPNNTASWFTALTQHGKEELRFPRGQGVPINTNSGPDDQIGYYRRATRRVRGGDGKMKELSPRWYFYYLGTGPEASLPYGANKEGIVWVATEGALNTPKDHIGTR
NPNNNAATVLQLPQGTTLPKGFYAEGSRGGSQASSRSSSRSRGNSRNSTPGSSRGNSPARMASGGGETALALLLLDRLNQLESKVSGKGQQQQGQTVTKKSAAEASKKPRQKRTATKQYNVTQAFGRRGPEQTQGNFGDQDLIRQGTDYK
HWPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYHGAIKLDDKDPQFKDNVILLNKHIDAYKTFPPTEPKKDKKKKTDEAQPLPQRQKKQPTVTLLPAADMDDFSRQLQNSMSGASADSTQA
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [P59595(NCAP_SARS)]

422
region name description
1-422 CHAIN /note="Nucleoprotein" /id="PRO_0000106003"
49-176 DOMAIN /note="CoV N NTD"
248-365 DOMAIN /note="CoV N CTD"
1-52 REGION /note="Disordered"
42-187 REGION /note="RNA-binding"
45-181 REGION /note="RNA-binding"
167-214 REGION /note="Disordered"
177-204 REGION /note="SR region"
234-287 REGION /note="Disordered"
259-362 REGION /note="Dimerization"
362-422 REGION /note="Disordered"
1-35 COMPBIAS /note="Polar residues"
178-209 COMPBIAS /note="Polar residues"
234-252 COMPBIAS /note="Polar residues"
265-287 COMPBIAS /note="Polar residues"
363-383 COMPBIAS /note="Basic and acidic residues"
404-422 COMPBIAS /note="Polar residues"
93-93 BINDING /ligand="RNA" /ligand_id="ChEBI:CHEBI:33697"
108-108 BINDING /ligand="RNA" /ligand_id="ChEBI:CHEBI:33697"
150-150 BINDING /ligand="RNA" /ligand_id="ChEBI:CHEBI:33697"
1-422 DISORDER predicted by DISOPRED

MONOMER
422
pdb_id a1 identity[%]2 description
8fg2 B 91.2 NCAP_SARS2 Nucleoprotein
8fg2 A 91.2 NCAP_SARS2 Nucleoprotein
8fd5 A 91.2 NCAP_SARS2 Nucleoprotein
1ssk A 99.3 NCAP_CVHSA Nucleocapsid protein
7acs A 92.0 NCAP_SARS2 Nucleoprotein
6yi3 A 92.0 NCAP_SARS2 Nucleoprotein
7act A 92.7 NCAP_SARS2 Nucleoprotein
7sd4 A 92.6 NCAP_SARS2 Nucleoprotein
2ofz A 100.0 NCAP_CVHSA Nucleocapsid protein
8x1h B 92.3 NCAP_SARS2 Nucleoprotein
7vnu A 92.2 NCAP_SARS2 Nucleoprotein
7vnu B 92.2 NCAP_SARS2 Nucleoprotein
8x1h A 92.2 NCAP_SARS2 Nucleoprotein
7cdz A 92.2 NCAP_SARS2 Nucleoprotein
8iv3 B 92.2 NCAP_SARS2 Nucleoprotein
8iqj B 92.2 NCAP_SARS2 Nucleoprotein
8j6x B 92.2 NCAP_SARS2 Nucleoprotein
8iv3 C 92.2 NCAP_SARS2 Nucleoprotein
8iqj C 92.2 NCAP_SARS2 Nucleoprotein
7n3c C 92.1 NCAP_SARS2 Nucleoprotein
7vnu C 92.1 NCAP_SARS2 Nucleoprotein
8x1h C 92.1 NCAP_SARS2 Nucleoprotein
7uw3 A 92.1 NCAP_SARS2 Nucleoprotein
7cdz D 92.1 NCAP_SARS2 Nucleoprotein
7cdz B 92.1 NCAP_SARS2 Nucleoprotein
8j6x C 92.1 NCAP_SARS2 Nucleoprotein
8j6x D 92.1 NCAP_SARS2 Nucleoprotein
8iqj D 92.1 NCAP_SARS2 Nucleoprotein
7str C 92.1 NCAP_SARS2 Nucleoprotein
7n0r A 92.1 NCAP_SARS2 Nucleoprotein
7n0r B 92.1 NCAP_SARS2 Nucleoprotein
6m3m C 92.1 NCAP_SARS2 Nucleoprotein
7uw3 C 92.1 NCAP_SARS2 Nucleoprotein
7cdz C 92.1 NCAP_SARS2 Nucleoprotein
6m3m B 92.1 NCAP_SARS2 Nucleoprotein
6m3m D 92.1 NCAP_SARS2 Nucleoprotein
8j6x A 92.1 NCAP_SARS2 Nucleoprotein
8iv3 A 92.1 NCAP_SARS2 Nucleoprotein
8iqj A 92.1 NCAP_SARS2 Nucleoprotein
7cr5 A 92.0 NCAP_SARS2 Nucleoprotein
7xx1 B 92.0 NCAP_SARS2 Nucleoprotein
7xx1 A 92.0 NCAP_SARS2 Nucleoprotein
7xx1 C 92.0 NCAP_SARS2 Nucleoprotein
2jw8 B 100.0 NCAP_CVHSA Nucleocapsid protein
2jw8 A 100.0 NCAP_CVHSA Nucleocapsid protein
6vyo D 92.0 NCAP_SARS2 Nucleoprotein
6vyo B 92.0 NCAP_SARS2 Nucleoprotein
6vyo C 92.0 NCAP_SARS2 Nucleoprotein
7sts D 92.0 NCAP_SARS2 Nucleoprotein
7wzo A 92.0 NCAP_SARS2 Nucleoprotein
6vyo A 91.9 NCAP_SARS2 Nucleoprotein
7vbd A 91.9 NCAP_SARS2 Nucleoprotein
2cjr D 100.0 NCAP_CVHSA NUCLEOCAPSID PROTEIN
2cjr A 100.0 NCAP_CVHSA NUCLEOCAPSID PROTEIN
7uw3 B 91.9 NCAP_SARS2 Nucleoprotein
2cjr C 100.0 NCAP_CVHSA NUCLEOCAPSID PROTEIN
2cjr B 100.0 NCAP_CVHSA NUCLEOCAPSID PROTEIN
7xwz B 91.7 NCAP_SARS2 Nucleoprotein
2cjr F 100.0 NCAP_CVHSA NUCLEOCAPSID PROTEIN
6wkp C 91.7 NCAP_SARS2 Nucleoprotein
7o35 B 95.8 NCAP_SARS2 Nucleoprotein
6yun B 95.8 NCAP_SARS2 Nucleoprotein
6zco A 95.8 NCAP_SARS2 Nucleoprotein
2cjr H 100.0 NCAP_CVHSA NUCLEOCAPSID PROTEIN
2cjr E 100.0 NCAP_CVHSA NUCLEOCAPSID PROTEIN
6yun A 95.7 NCAP_SARS2 Nucleoprotein
6wzq C 95.7 NCAP_SARS2 Nucleoprotein
2og3 A 100.0 NCAP_CVHSA Nucleocapsid protein
8iv3 D 92.1 NCAP_SARS2 Nucleoprotein
7de1 B 95.7 NCAP_SARS2 Nucleoprotein
2cjr G 100.0 NCAP_CVHSA NUCLEOCAPSID PROTEIN
6wzq D 95.7 NCAP_SARS2 Nucleoprotein
7ylb B 95.6 NCAP_SARS2 Nucleoprotein
6wzq A 95.6 NCAP_SARS2 Nucleoprotein
6wzq B 95.6 NCAP_SARS2 Nucleoprotein
6wkp B 92.3 NCAP_SARS2 Nucleoprotein
7c22 B 95.6 NCAP_SARS2 Nucleoprotein
7ylb H 95.6 NCAP_SARS2 Nucleoprotein
7vnu D 91.9 NCAP_SARS2 Nucleoprotein
7o36 C 95.6 NCAP_SARS2 Nucleoprotein
7c22 C 95.5 NCAP_SARS2 Nucleoprotein
7o36 A 95.5 NCAP_SARS2 Nucleoprotein
7sue L 92.2 NCAP_SARS2 Nucleoprotein
7sue F 92.2 NCAP_SARS2 Nucleoprotein
7sue E 92.2 NCAP_SARS2 Nucleoprotein
6wkp D 92.2 NCAP_SARS2 Nucleoprotein
6wzo B 95.5 NCAP_SARS2 Nucleoprotein
7ylb E 95.5 NCAP_SARS2 Nucleoprotein
7r98 C 93.0 NCAP_SARS2 Nucleoprotein
7sue K 93.0 NCAP_SARS2 Nucleoprotein
7o05 D 95.5 NCAP_SARS2 Nucleoprotein
7o05 C 95.5 NCAP_SARS2 Nucleoprotein
7o35 C 95.5 NCAP_SARS2 Nucleoprotein
7o35 A 95.5 NCAP_SARS2 Nucleoprotein
7o36 D 95.5 NCAP_SARS2 Nucleoprotein
8x1h D 91.8 NCAP_SARS2 Nucleoprotein
7uxx F 95.5 NCAP_SARS2 Nucleoprotein
7vbf B 95.5 NCAP_SARS2 Nucleoprotein
7ce0 A 95.5 NCAP_SARS2 Nucleoprotein
7ce0 D 95.5 NCAP_SARS2 Nucleoprotein
7ce0 B 95.5 NCAP_SARS2 Nucleoprotein
7ce0 C 95.5 NCAP_SARS2 Nucleoprotein
7vbf A 95.5 NCAP_SARS2 Nucleoprotein
6wzo D 95.5 NCAP_SARS2 Nucleoprotein
7ylb K 95.5 NCAP_SARS2 Nucleoprotein
7ylb D 95.5 NCAP_SARS2 Nucleoprotein
7ylb J 95.5 NCAP_SARS2 Nucleoprotein
7r98 A 92.4 NCAP_SARS2 Nucleoprotein
7xx1 D 92.4 NCAP_SARS2 Nucleoprotein
6m3m A 91.7 NCAP_SARS2 Nucleoprotein
7vbd C 92.0 NCAP_SARS2 Nucleoprotein
7uxx A 95.4 NCAP_SARS2 Nucleoprotein
7uxx D 95.4 NCAP_SARS2 Nucleoprotein
7uxz D 95.4 NCAP_SARS2 Nucleoprotein
7uxz A 95.4 NCAP_SARS2 Nucleoprotein
7uxx E 95.4 NCAP_SARS2 Nucleoprotein
7uxx C 95.4 NCAP_SARS2 Nucleoprotein
7uxx B 95.4 NCAP_SARS2 Nucleoprotein
7uxz F 95.4 NCAP_SARS2 Nucleoprotein
7uxz E 95.4 NCAP_SARS2 Nucleoprotein
7uxz C 95.4 NCAP_SARS2 Nucleoprotein
7uxz B 95.4 NCAP_SARS2 Nucleoprotein
7c22 A 95.4 NCAP_SARS2 Nucleoprotein
7xxk E 95.4 NCAP_SARS2 Nucleoprotein
7xxk D 95.4 NCAP_SARS2 Nucleoprotein
7xxk A 95.4 NCAP_SARS2 Nucleoprotein
7ylb G 95.4 NCAP_SARS2 Nucleoprotein
7o05 A 95.4 NCAP_SARS2 Nucleoprotein
7o36 B 95.4 NCAP_SARS2 Nucleoprotein
7o35 D 95.4 NCAP_SARS2 Nucleoprotein
7o05 B 95.4 NCAP_SARS2 Nucleoprotein
7vbe A 95.4 NCAP_SARS2 Nucleoprotein
7de1 A 95.4 NCAP_SARS2 Nucleoprotein
7c22 D 95.4 NCAP_SARS2 Nucleoprotein
6wji A 95.4 NCAP_SARS2 Nucleoprotein
6wzo C 95.4 NCAP_SARS2 Nucleoprotein
6wzo A 95.4 NCAP_SARS2 Nucleoprotein
6wji F 95.4 NCAP_SARS2 Nucleoprotein
6wji E 95.4 NCAP_SARS2 Nucleoprotein
6wji D 95.4 NCAP_SARS2 Nucleoprotein
6wji C 95.4 NCAP_SARS2 Nucleoprotein
6wji B 95.4 NCAP_SARS2 Nucleoprotein
7xwz A 92.0 NCAP_SARS2 Nucleoprotein
7vbd D 92.4 NCAP_SARS2 Nucleoprotein
7ylb A 95.4 NCAP_SARS2 Nucleoprotein
7sts C 92.8 NCAP_SARS2 Nucleoprotein
7vbe B 95.3 NCAP_SARS2 Nucleoprotein
7xxk B 95.3 NCAP_SARS2 Nucleoprotein
7xxk C 95.3 NCAP_SARS2 Nucleoprotein
7xxk F 95.3 NCAP_SARS2 Nucleoprotein
7f2e G 95.3 NCAP_SARS2 Nucleoprotein
7f2e D 95.3 NCAP_SARS2 Nucleoprotein
7f2e C 95.3 NCAP_SARS2 Nucleoprotein
7f2e I 95.3 NCAP_SARS2 Nucleoprotein
7r98 B 93.1 NCAP_SARS2 Nucleoprotein
7n3d C 92.7 NCAP_SARS2 Nucleoprotein
7f2b B 95.3 NCAP_SARS2 Nucleoprotein
7f2b A 95.3 NCAP_SARS2 Nucleoprotein
7f2e A 95.3 NCAP_SARS2 Nucleoprotein
7f2e J 95.3 NCAP_SARS2 Nucleoprotein
7f2e H 95.3 NCAP_SARS2 Nucleoprotein
7f2e B 95.3 NCAP_SARS2 Nucleoprotein
7vbd B 91.5 NCAP_SARS2 Nucleoprotein
7uw3 D 90.9 NCAP_SARS2 Nucleoprotein
2gib A 100.0 NCAP_CVHSA Nucleocapsid protein
2gib B 100.0 NCAP_CVHSA Nucleocapsid protein
7xwx A 96.0 NCAP_SARS2 Nucleoprotein
7xwx B 95.9 NCAP_SARS2 Nucleoprotein
7xwx G 95.9 NCAP_SARS2 Nucleoprotein
7xwx C 95.9 NCAP_SARS2 Nucleoprotein
6wkp A 93.2 NCAP_SARS2 Nucleoprotein
7n0i A 95.8 NCAP_SARS2 Nucleoprotein
7n0i B 95.8 NCAP_SARS2 Nucleoprotein
7n0i L 95.8 NCAP_SARS2 Nucleoprotein
7n0i G 95.8 NCAP_SARS2 Nucleoprotein
7n0i F 95.8 NCAP_SARS2 Nucleoprotein
7n0i E 95.8 NCAP_SARS2 Nucleoprotein
7n0i D 95.8 NCAP_SARS2 Nucleoprotein
7n0i C 95.8 NCAP_SARS2 Nucleoprotein
7xwx F 95.8 NCAP_SARS2 Nucleoprotein
7xwx D 95.8 NCAP_SARS2 Nucleoprotein
7f2e E 94.8 NCAP_SARS2 Nucleoprotein
7f2e K 94.8 NCAP_SARS2 Nucleoprotein
7f2e F 95.9 NCAP_SARS2 Nucleoprotein
7xwx E 95.7 NCAP_SARS2 Nucleoprotein
7xwx H 95.6 NCAP_SARS2 Nucleoprotein
7f2e L 95.7 NCAP_SARS2 Nucleoprotein
7pku B 89.0 A0A6G9KDV1_SARS2 Nucleoprotein 
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HETERO
422 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
7n0i H Single-domain antibody E2[136 aa] A 90.0
/95.8		 10
/10		 NCAP_SARS2 Nucleoprotein
7n0i H Single-domain antibody E2[136 aa] B 80.0
/95.8		 5
/5		 NCAP_SARS2 Nucleoprotein
7n0i I Single-domain antibody E2[135 aa] C 90.0
/95.8		 10
/10		 NCAP_SARS2 Nucleoprotein
7n0i I Single-domain antibody E2[135 aa] D 80.0
/95.8		 5
/5		 NCAP_SARS2 Nucleoprotein
7n0i J Single-domain antibody E2[130 aa] E 90.0
/95.8		 10
/10		 NCAP_SARS2 Nucleoprotein
7n0i J Single-domain antibody E2[130 aa] F 75.0
/95.8		 4
/4		 NCAP_SARS2 Nucleoprotein
7n0i K Single-domain antibody E2[131 aa] G 80.0
/95.8		 5
/5		 NCAP_SARS2 Nucleoprotein
7n0i K Single-domain antibody E2[131 aa] L 91.7
/95.8		 12
/12		 NCAP_SARS2 Nucleoprotein
7ylb C NC2[84 aa] A 92.3
/95.4		 13
/13		 NCAP_SARS2 Nucleoprotein
7ylb C NC2[84 aa] B 100.0
/95.6		 8
/8		 NCAP_SARS2 Nucleoprotein
7ylb F NC2[84 aa] D 92.3
/95.5		 13
/13		 NCAP_SARS2 Nucleoprotein
7ylb F NC2[84 aa] E 88.9
/95.5		 9
/9		 NCAP_SARS2 Nucleoprotein
7ylb I NC2[84 aa] G 92.3
/95.4		 13
/13		 NCAP_SARS2 Nucleoprotein
7ylb I NC2[84 aa] H 100.0
/95.6		 9
/9		 NCAP_SARS2 Nucleoprotein
7ylb L NC2[84 aa] J 92.9
/95.5		 14
/14		 NCAP_SARS2 Nucleoprotein
7ylb L NC2[84 aa] K 90.0
/95.5		 10
/10		 NCAP_SARS2 Nucleoprotein
7r98 D Nanobody B6[129 aa] A 100.0
/92.4		 14
/14		 NCAP_SARS2 Nucleoprotein
7r98 E Nanobody B6[130 aa] B 100.0
/93.1		 14
/14		 NCAP_SARS2 Nucleoprotein
7r98 F Nanobody B6[130 aa] C 100.0
/93.0		 14
/14		 NCAP_SARS2 Nucleoprotein
7n3d A S24-1564 Fab heavy chain[223 aa] C 100.0
/92.7		 12
/12		 NCAP_SARS2 Nucleoprotein
7n3d B S24-1564 Fab light chain[213 aa] C 87.5
/92.7		 8
/8		 NCAP_SARS2 Nucleoprotein
7sue A S24-188 Fab Light chain[212 aa] E 100.0
/92.2		 5
/5		 NCAP_SARS2 Nucleoprotein
7sue C S24-188 Fab Light chain[212 aa] F 100.0
/92.2		 4
/4		 NCAP_SARS2 Nucleoprotein
7sue B S24-188 Fab Heavy chain[227 aa] E 100.0
/92.2		 8
/8		 NCAP_SARS2 Nucleoprotein
7sue D S24-188 Fab Heavy chain[227 aa] F 100.0
/92.2		 8
/8		 NCAP_SARS2 Nucleoprotein
7sue G S24-188 Fab Light chain[109 aa] K 100.0
/93.0		 5
/5		 NCAP_SARS2 Nucleoprotein
7sue I S24-188 Fab Light chain[109 aa] L 100.0
/92.2		 5
/5		 NCAP_SARS2 Nucleoprotein
7sue H S24-188 Fab Heavy chain[129 aa] K 100.0
/93.0		 7
/7		 NCAP_SARS2 Nucleoprotein
7sue J S24-188 Fab Heavy chain[128 aa] L 100.0
/92.2		 6
/6		 NCAP_SARS2 Nucleoprotein
7n3c A S24-202 Fab heavy chain[226 aa] C 100.0
/92.1		 11
/11		 NCAP_SARS2 Nucleoprotein
7n0r C Single-domain antibody C2[123 aa] A 88.2
/92.1		 17
/17		 NCAP_SARS2 Nucleoprotein
7n0r D Single-domain antibody C2[123 aa] B 88.9
/92.1		 18
/18		 NCAP_SARS2 Nucleoprotein
7n3c B S24-202 Fab light chain[214 aa] C 80.0
/92.1		 5
/5		 NCAP_SARS2 Nucleoprotein
7str A Fab S24-1063, Light chain[214 aa] C 85.7
/92.1		 7
/7		 NCAP_SARS2 Nucleoprotein
7str B Fab S24-1063, Heavy chain[222 aa] C 100.0
/92.1		 11
/11		 NCAP_SARS2 Nucleoprotein
7cr5 B monoclonal antibody chain H[216 aa] A 100.0
/92.0		 7
/7		 NCAP_SARS2 Nucleoprotein
7cr5 C monoclonal antibody chain L[213 aa] A 93.3
/92.0		 15
/15		 NCAP_SARS2 Nucleoprotein
7pku A A0A6M4N019_SARS2 3C-like proteinase[96 aa] B 94.4
/89.0		 18
/18		 A0A6G9KDV1_SARS2 Nucleoprotein
7wzo B R1A_SARS2 nsp3[112 aa] A 90.9
/92.0		 11
/11		 NCAP_SARS2 Nucleoprotein
7wzo C R1A_SARS2 nsp3[110 aa] A 100.0
/92.0		 10
/10		 NCAP_SARS2 Nucleoprotein
7sts E Fab S24-1379, heavy chain[210 aa] C 83.3
/92.8		 6
/6		 NCAP_SARS2 Nucleoprotein
7sts A Fab S24-1379, heavy chain[204 aa] D 80.0
/92.0		 5
/5		 NCAP_SARS2 Nucleoprotein
7sts F Fab S24-1379, light chain[212 aa] C 83.3
/92.8		 6
/6		 NCAP_SARS2 Nucleoprotein
7sts B Fab S24-1379, light chain[212 aa] D 80.0
/92.0		 5
/5		 NCAP_SARS2 Nucleoprotein
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
NUCLEOTIDE
422 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
7act B ssRNA A 85.7
/92.7		 28
/28		 NCAP_SARS2 Nucleoprotein
7acs B RNA (5'-R(P*CP*AP*CP*UP*GP*AP*C)-3') A 60.0
/92.0		 5
/5		 NCAP_SARS2 Nucleoprotein
7xwz C RNA (5'-R(*CP*AP*CP*UP*GP*AP*C)-3') A 50.0
/92.0		 2
/2		 NCAP_SARS2 Nucleoprotein
7acs C RNA (5'-R(P*GP*UP*CP*AP*GP*UP*G)-3') A 81.8
/92.0		 11
/11		 NCAP_SARS2 Nucleoprotein
7xwz D RNA (5'-R(P*GP*UP*CP*AP*GP*UP*G)-3') A 100.0
/92.0		 8
/8		 NCAP_SARS2 Nucleoprotein
7xwz F RNA (5'-R(P*GP*UP*CP*AP*GP*UP*G)-3') B 100.0
/91.7		 5
/5		 NCAP_SARS2 Nucleoprotein
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
COMPOUND
422 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
7o35 E GTP
GUANOSINE-5'-TRIPHOSPHATE[32 atoms] 		C 100.0
/95.5		 4
/4		 NCAP_SARS2 Nucleoprotein
7o35 E GTP
GUANOSINE-5'-TRIPHOSPHATE[32 atoms] 		D 100.0
/95.4		 4
/4		 NCAP_SARS2 Nucleoprotein
7o36 E GTP
GUANOSINE-5'-TRIPHOSPHATE[32 atoms] 		A 100.0
/95.5		 5
/5		 NCAP_SARS2 Nucleoprotein
7o36 E GTP
GUANOSINE-5'-TRIPHOSPHATE[32 atoms] 		B 100.0
/95.4		 4
/4		 NCAP_SARS2 Nucleoprotein
7o36 G GTP
GUANOSINE-5'-TRIPHOSPHATE[32 atoms] 		C 100.0
/95.6		 4
/4		 NCAP_SARS2 Nucleoprotein
7o36 G GTP
GUANOSINE-5'-TRIPHOSPHATE[32 atoms] 		D 100.0
/95.5		 4
/4		 NCAP_SARS2 Nucleoprotein
7uxz G GKP
(2R,3R)-2,3-bis{[(2E)-3-(3,4-dihydroxyphenyl)prop-.. 		A 100.0
/95.4		 8
/8		 NCAP_SARS2 Nucleoprotein
7xxk H 5GP
GUANOSINE-5'-MONOPHOSPHATE[24 atoms] 		A 100.0
/95.4		 3
/3		 NCAP_SARS2 Nucleoprotein
7xxk I 5GP
GUANOSINE-5'-MONOPHOSPHATE[24 atoms] 		A 100.0
/95.4		 3
/3		 NCAP_SARS2 Nucleoprotein
7xxk H 5GP
GUANOSINE-5'-MONOPHOSPHATE[24 atoms] 		B 100.0
/95.3		 2
/2		 NCAP_SARS2 Nucleoprotein
7xxk I 5GP
GUANOSINE-5'-MONOPHOSPHATE[24 atoms] 		B 100.0
/95.3		 3
/3		 NCAP_SARS2 Nucleoprotein
7xxk S 5GP
GUANOSINE-5'-MONOPHOSPHATE[24 atoms] 		C 100.0
/95.3		 4
/4		 NCAP_SARS2 Nucleoprotein
7xxk S 5GP
GUANOSINE-5'-MONOPHOSPHATE[24 atoms] 		D 100.0
/95.4		 3
/3		 NCAP_SARS2 Nucleoprotein
7xxk R GUN
GUANINE[11 atoms] 		C 100.0
/95.3		 3
/3		 NCAP_SARS2 Nucleoprotein
7xxk R GUN
GUANINE[11 atoms] 		D 100.0
/95.4		 2
/2		 NCAP_SARS2 Nucleoprotein
7xxk FA GMP
GUANOSINE[20 atoms] 		E 100.0
/95.4		 3
/3		 NCAP_SARS2 Nucleoprotein
7xxk FA GMP
GUANOSINE[20 atoms] 		F 100.0
/95.3		 3
/3		 NCAP_SARS2 Nucleoprotein
8j6x E U2H
~{N}-methyl-~{N}-[(5-phenylmethoxy-1~{H}-indol-3-y.. 		A 100.0
/92.1		 2
/2		 NCAP_SARS2 Nucleoprotein
8j6x E U2H
~{N}-methyl-~{N}-[(5-phenylmethoxy-1~{H}-indol-3-y.. 		B 100.0
/92.2		 2
/2		 NCAP_SARS2 Nucleoprotein
8j6x E U2H
~{N}-methyl-~{N}-[(5-phenylmethoxy-1~{H}-indol-3-y.. 		D 100.0
/92.1		 4
/4		 NCAP_SARS2 Nucleoprotein
8iv3 E DJU
N,N-dimethyl-1-(5-phenylmethoxy-1H-indol-3-yl)meth.. 		A 66.7
/92.1		 3
/3		 NCAP_SARS2 Nucleoprotein
8iv3 E DJU
N,N-dimethyl-1-(5-phenylmethoxy-1H-indol-3-yl)meth.. 		B 100.0
/92.2		 1
/1		 NCAP_SARS2 Nucleoprotein
8iv3 E DJU
N,N-dimethyl-1-(5-phenylmethoxy-1H-indol-3-yl)meth.. 		D 100.0
/92.1		 4
/4		 NCAP_SARS2 Nucleoprotein
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
METAL
422 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
7n0i N MG
MAGNESIUM ION[1 atoms] 		D 100.0
/95.8		 3
/3		 NCAP_SARS2 Nucleoprotein
6vyo F CL
CHLORIDE ION[1 atoms] 		A 100.0
/91.9		 1
/1		 NCAP_SARS2 Nucleoprotein
6vyo I CL
CHLORIDE ION[1 atoms] 		A 66.7
/91.9		 3
/3		 NCAP_SARS2 Nucleoprotein
6vyo F CL
CHLORIDE ION[1 atoms] 		B 100.0
/92.0		 5
/5		 NCAP_SARS2 Nucleoprotein
6vyo N CL
CHLORIDE ION[1 atoms] 		B 100.0
/92.0		 1
/1		 NCAP_SARS2 Nucleoprotein
6vyo N CL
CHLORIDE ION[1 atoms] 		C 66.7
/92.0		 3
/3		 NCAP_SARS2 Nucleoprotein
6vyo O CL
CHLORIDE ION[1 atoms] 		C 100.0
/92.0		 2
/2		 NCAP_SARS2 Nucleoprotein
6vyo I CL
CHLORIDE ION[1 atoms] 		D 100.0
/92.0		 1
/1		 NCAP_SARS2 Nucleoprotein
6vyo O CL
CHLORIDE ION[1 atoms] 		D 100.0
/92.0		 5
/5		 NCAP_SARS2 Nucleoprotein
6wji G CL
CHLORIDE ION[1 atoms] 		A 100.0
/95.4		 1
/1		 NCAP_SARS2 Nucleoprotein
6wji H CL
CHLORIDE ION[1 atoms] 		A 100.0
/95.4		 1
/1		 NCAP_SARS2 Nucleoprotein
6wji G CL
CHLORIDE ION[1 atoms] 		B 100.0
/95.4		 1
/1		 NCAP_SARS2 Nucleoprotein
6wji H CL
CHLORIDE ION[1 atoms] 		B 100.0
/95.4		 1
/1		 NCAP_SARS2 Nucleoprotein
6wji I CL
CHLORIDE ION[1 atoms] 		C 100.0
/95.4		 1
/1		 NCAP_SARS2 Nucleoprotein
6wji I CL
CHLORIDE ION[1 atoms] 		D 100.0
/95.4		 1
/1		 NCAP_SARS2 Nucleoprotein
6wji J CL
CHLORIDE ION[1 atoms] 		D 100.0
/95.4		 2
/2		 NCAP_SARS2 Nucleoprotein
6wji K CL
CHLORIDE ION[1 atoms] 		D 100.0
/95.4		 2
/2		 NCAP_SARS2 Nucleoprotein
6wji L CL
CHLORIDE ION[1 atoms] 		E 100.0
/95.4		 1
/1		 NCAP_SARS2 Nucleoprotein
6wji M CL
CHLORIDE ION[1 atoms] 		E 100.0
/95.4		 2
/2		 NCAP_SARS2 Nucleoprotein
6wji N CL
CHLORIDE ION[1 atoms] 		E 100.0
/95.4		 1
/1		 NCAP_SARS2 Nucleoprotein
6wji N CL
CHLORIDE ION[1 atoms] 		F 100.0
/95.4		 1
/1		 NCAP_SARS2 Nucleoprotein
6wji O CL
CHLORIDE ION[1 atoms] 		F 100.0
/95.4		 2
/2		 NCAP_SARS2 Nucleoprotein
7f2b E CL
CHLORIDE ION[1 atoms] 		B 100.0
/95.3		 1
/1		 NCAP_SARS2 Nucleoprotein
7n3d O CL
CHLORIDE ION[1 atoms] 		C 100.0
/92.7		 2
/2		 NCAP_SARS2 Nucleoprotein
7n3d P CL
CHLORIDE ION[1 atoms] 		C 100.0
/92.7		 2
/2		 NCAP_SARS2 Nucleoprotein
7uxz L CL
CHLORIDE ION[1 atoms] 		E 100.0
/95.4		 1
/1		 NCAP_SARS2 Nucleoprotein
7xxk O CL
CHLORIDE ION[1 atoms] 		B 100.0
/95.3		 3
/3		 NCAP_SARS2 Nucleoprotein
7xxk P CL
CHLORIDE ION[1 atoms] 		B 100.0
/95.3		 1
/1		 NCAP_SARS2 Nucleoprotein
7xxk Q CL
CHLORIDE ION[1 atoms] 		B 100.0
/95.3		 3
/3		 NCAP_SARS2 Nucleoprotein
7xxk U CL
CHLORIDE ION[1 atoms] 		C 100.0
/95.3		 4
/4		 NCAP_SARS2 Nucleoprotein
7xxk V CL
CHLORIDE ION[1 atoms] 		C 100.0
/95.3		 2
/2		 NCAP_SARS2 Nucleoprotein
7xxk W CL
CHLORIDE ION[1 atoms] 		C 100.0
/95.3		 2
/2		 NCAP_SARS2 Nucleoprotein
7xxk X CL
CHLORIDE ION[1 atoms] 		C 100.0
/95.3		 2
/2		 NCAP_SARS2 Nucleoprotein
7xxk Y CL
CHLORIDE ION[1 atoms] 		C 100.0
/95.3		 2
/2		 NCAP_SARS2 Nucleoprotein
7xxk CA CL
CHLORIDE ION[1 atoms] 		D 100.0
/95.4		 3
/3		 NCAP_SARS2 Nucleoprotein
7xxk DA CL
CHLORIDE ION[1 atoms] 		E 100.0
/95.4		 3
/3		 NCAP_SARS2 Nucleoprotein
7xxk EA CL
CHLORIDE ION[1 atoms] 		E 100.0
/95.4		 3
/3		 NCAP_SARS2 Nucleoprotein
7xxk IA CL
CHLORIDE ION[1 atoms] 		E 100.0
/95.4		 1
/1		 NCAP_SARS2 Nucleoprotein
7xxk HA CL
CHLORIDE ION[1 atoms] 		F 100.0
/95.3		 2
/2		 NCAP_SARS2 Nucleoprotein
7xxk IA CL
CHLORIDE ION[1 atoms] 		F 100.0
/95.3		 1
/1		 NCAP_SARS2 Nucleoprotein
7uxz J NA
SODIUM ION[1 atoms] 		A 100.0
/95.4		 2
/2		 NCAP_SARS2 Nucleoprotein
7xxk Z NA
SODIUM ION[1 atoms] 		C 100.0
/95.3		 2
/2		 NCAP_SARS2 Nucleoprotein
7xxk JA NA
SODIUM ION[1 atoms] 		F 66.7
/95.3		 3
/3		 NCAP_SARS2 Nucleoprotein
7xxk J K
POTASSIUM ION[1 atoms] 		A 100.0
/95.4		 3
/3		 NCAP_SARS2 Nucleoprotein
7xxk K K
POTASSIUM ION[1 atoms] 		A 66.7
/95.4		 3
/3		 NCAP_SARS2 Nucleoprotein
7xxk L K
POTASSIUM ION[1 atoms] 		A 100.0
/95.4		 3
/3		 NCAP_SARS2 Nucleoprotein
7xxk M K
POTASSIUM ION[1 atoms] 		A 100.0
/95.4		 2
/2		 NCAP_SARS2 Nucleoprotein
7xxk N K
POTASSIUM ION[1 atoms] 		A 100.0
/95.4		 1
/1		 NCAP_SARS2 Nucleoprotein
7xxk J K
POTASSIUM ION[1 atoms] 		B 100.0
/95.3		 1
/1		 NCAP_SARS2 Nucleoprotein
7xxk N K
POTASSIUM ION[1 atoms] 		B 100.0
/95.3		 3
/3		 NCAP_SARS2 Nucleoprotein
7xxk AA K
POTASSIUM ION[1 atoms] 		C 100.0
/95.3		 1
/1		 NCAP_SARS2 Nucleoprotein
7xxk T K
POTASSIUM ION[1 atoms] 		C 100.0
/95.3		 3
/3		 NCAP_SARS2 Nucleoprotein
7xxk AA K
POTASSIUM ION[1 atoms] 		D 100.0
/95.4		 3
/3		 NCAP_SARS2 Nucleoprotein
7xxk BA K
POTASSIUM ION[1 atoms] 		D 100.0
/95.4		 1
/1		 NCAP_SARS2 Nucleoprotein
7xxk T K
POTASSIUM ION[1 atoms] 		D 100.0
/95.4		 1
/1		 NCAP_SARS2 Nucleoprotein
7xxk GA K
POTASSIUM ION[1 atoms] 		E 100.0
/95.4		 1
/1		 NCAP_SARS2 Nucleoprotein
7xxk GA K
POTASSIUM ION[1 atoms] 		F 100.0
/95.3		 3
/3		 NCAP_SARS2 Nucleoprotein
6vyo H ZN
ZINC ION[1 atoms] 		A 66.7
/91.9		 3
/3		 NCAP_SARS2 Nucleoprotein
6vyo J ZN
ZINC ION[1 atoms] 		A 100.0
/91.9		 1
/1		 NCAP_SARS2 Nucleoprotein
6vyo J ZN
ZINC ION[1 atoms] 		B 100.0
/92.0		 3
/3		 NCAP_SARS2 Nucleoprotein
6vyo M ZN
ZINC ION[1 atoms] 		B 100.0
/92.0		 1
/1		 NCAP_SARS2 Nucleoprotein
6vyo M ZN
ZINC ION[1 atoms] 		C 66.7
/92.0		 3
/3		 NCAP_SARS2 Nucleoprotein
6vyo R ZN
ZINC ION[1 atoms] 		C 100.0
/92.0		 1
/1		 NCAP_SARS2 Nucleoprotein
6vyo H ZN
ZINC ION[1 atoms] 		D 100.0
/92.0		 1
/1		 NCAP_SARS2 Nucleoprotein
6vyo R ZN
ZINC ION[1 atoms] 		D 100.0
/92.0		 3
/3		 NCAP_SARS2 Nucleoprotein
6wkp E ZN
ZINC ION[1 atoms] 		A 66.7
/93.2		 3
/3		 NCAP_SARS2 Nucleoprotein
6wkp G ZN
ZINC ION[1 atoms] 		A 100.0
/93.2		 1
/1		 NCAP_SARS2 Nucleoprotein
6wkp G ZN
ZINC ION[1 atoms] 		B 66.7
/92.3		 3
/3		 NCAP_SARS2 Nucleoprotein
6wkp H ZN
ZINC ION[1 atoms] 		B 100.0
/92.3		 1
/1		 NCAP_SARS2 Nucleoprotein
6wkp H ZN
ZINC ION[1 atoms] 		C 66.7
/91.7		 3
/3		 NCAP_SARS2 Nucleoprotein
6wkp J ZN
ZINC ION[1 atoms] 		C 100.0
/91.7		 1
/1		 NCAP_SARS2 Nucleoprotein
6wkp E ZN
ZINC ION[1 atoms] 		D 100.0
/92.2		 1
/1		 NCAP_SARS2 Nucleoprotein
6wkp J ZN
ZINC ION[1 atoms] 		D 66.7
/92.2		 3
/3		 NCAP_SARS2 Nucleoprotein
7cr5 D ZN
ZINC ION[1 atoms] 		A 100.0
/92.0		 1
/1		 NCAP_SARS2 Nucleoprotein
7xx1 E ZN
ZINC ION[1 atoms] 		A 100.0
/92.0		 3
/3		 NCAP_SARS2 Nucleoprotein
7xx1 J ZN
ZINC ION[1 atoms] 		A 100.0
/92.0		 1
/1		 NCAP_SARS2 Nucleoprotein
7xx1 E ZN
ZINC ION[1 atoms] 		B 100.0
/92.0		 1
/1		 NCAP_SARS2 Nucleoprotein
7xx1 F ZN
ZINC ION[1 atoms] 		B 66.7
/92.0		 3
/3		 NCAP_SARS2 Nucleoprotein
7xx1 F ZN
ZINC ION[1 atoms] 		C 100.0
/92.0		 1
/1		 NCAP_SARS2 Nucleoprotein
7xx1 I ZN
ZINC ION[1 atoms] 		C 100.0
/92.0		 3
/3		 NCAP_SARS2 Nucleoprotein
7xx1 I ZN
ZINC ION[1 atoms] 		D 100.0
/92.4		 1
/1		 NCAP_SARS2 Nucleoprotein
7xx1 J ZN
ZINC ION[1 atoms] 		D 66.7
/92.4		 3
/3		 NCAP_SARS2 Nucleoprotein
7n3c T IOD
IODIDE ION[1 atoms] 		C 66.7
/92.1		 3
/3		 NCAP_SARS2 Nucleoprotein
7n3c U IOD
IODIDE ION[1 atoms] 		C 100.0
/92.1		 2
/2		 NCAP_SARS2 Nucleoprotein
7n3c V IOD
IODIDE ION[1 atoms] 		C 100.0
/92.1		 1
/1		 NCAP_SARS2 Nucleoprotein
7n3c W IOD
IODIDE ION[1 atoms] 		C 100.0
/92.1		 4
/4		 NCAP_SARS2 Nucleoprotein
7n3c X IOD
IODIDE ION[1 atoms] 		C 100.0
/92.1		 2
/2		 NCAP_SARS2 Nucleoprotein
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
HOMO
422 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
2cjr B NCAP_CVHSA NUCLEOCAPSID PROTEIN[113 aa] A 100.0
/100.0		 52
/52		 NCAP_CVHSA NUCLEOCAPSID PROTEIN
2cjr A NCAP_CVHSA NUCLEOCAPSID PROTEIN[115 aa] B 100.0
/100.0		 50
/50		 NCAP_CVHSA NUCLEOCAPSID PROTEIN
2cjr D NCAP_CVHSA NUCLEOCAPSID PROTEIN[115 aa] C 100.0
/100.0		 51
/51		 NCAP_CVHSA NUCLEOCAPSID PROTEIN
2cjr C NCAP_CVHSA NUCLEOCAPSID PROTEIN[113 aa] D 100.0
/100.0		 53
/53		 NCAP_CVHSA NUCLEOCAPSID PROTEIN
2cjr F NCAP_CVHSA NUCLEOCAPSID PROTEIN[112 aa] E 100.0
/100.0		 51
/51		 NCAP_CVHSA NUCLEOCAPSID PROTEIN
2cjr E NCAP_CVHSA NUCLEOCAPSID PROTEIN[110 aa] F 100.0
/100.0		 50
/50		 NCAP_CVHSA NUCLEOCAPSID PROTEIN
2cjr H NCAP_CVHSA NUCLEOCAPSID PROTEIN[110 aa] G 100.0
/100.0		 49
/49		 NCAP_CVHSA NUCLEOCAPSID PROTEIN
2cjr G NCAP_CVHSA NUCLEOCAPSID PROTEIN[109 aa] H 100.0
/100.0		 49
/49		 NCAP_CVHSA NUCLEOCAPSID PROTEIN
2gib A NCAP_CVHSA Nucleocapsid protein[97 aa] A 100.0
/100.0		 8
/8		 NCAP_CVHSA Nucleocapsid protein
2gib A NCAP_CVHSA Nucleocapsid protein[97 aa] A 100.0
/100.0		 6
/6		 NCAP_CVHSA Nucleocapsid protein
2gib A NCAP_CVHSA Nucleocapsid protein[97 aa] A 100.0
/100.0		 8
/8		 NCAP_CVHSA Nucleocapsid protein
2gib A NCAP_CVHSA Nucleocapsid protein[97 aa] A 100.0
/100.0		 6
/6		 NCAP_CVHSA Nucleocapsid protein
2gib B NCAP_CVHSA Nucleocapsid protein[96 aa] A 100.0
/100.0		 45
/45		 NCAP_CVHSA Nucleocapsid protein
2gib B NCAP_CVHSA Nucleocapsid protein[96 aa] A 100.0
/100.0		 1
/1		 NCAP_CVHSA Nucleocapsid protein
2gib B NCAP_CVHSA Nucleocapsid protein[96 aa] A 100.0
/100.0		 45
/45		 NCAP_CVHSA Nucleocapsid protein
2gib B NCAP_CVHSA Nucleocapsid protein[96 aa] A 100.0
/100.0		 1
/1		 NCAP_CVHSA Nucleocapsid protein
2gib B NCAP_CVHSA Nucleocapsid protein[96 aa] A 100.0
/100.0		 45
/45		 NCAP_CVHSA Nucleocapsid protein
2gib A NCAP_CVHSA Nucleocapsid protein[97 aa] B 100.0
/100.0		 45
/45		 NCAP_CVHSA Nucleocapsid protein
2gib A NCAP_CVHSA Nucleocapsid protein[97 aa] B 100.0
/100.0		 3
/3		 NCAP_CVHSA Nucleocapsid protein
2gib A NCAP_CVHSA Nucleocapsid protein[97 aa] B 100.0
/100.0		 45
/45		 NCAP_CVHSA Nucleocapsid protein
2gib A NCAP_CVHSA Nucleocapsid protein[97 aa] B 100.0
/100.0		 3
/3		 NCAP_CVHSA Nucleocapsid protein
2gib A NCAP_CVHSA Nucleocapsid protein[97 aa] B 100.0
/100.0		 45
/45		 NCAP_CVHSA Nucleocapsid protein
2jw8 B NCAP_CVHSA Nucleocapsid protein[118 aa] A 100.0
/100.0		 45
/45		 NCAP_CVHSA Nucleocapsid protein
2jw8 A NCAP_CVHSA Nucleocapsid protein[118 aa] B 100.0
/100.0		 41
/41		 NCAP_CVHSA Nucleocapsid protein
6wji B NCAP_SARS2 Nucleoprotein[108 aa] A 98.1
/95.4		 54
/54		 NCAP_SARS2 Nucleoprotein
6wji A NCAP_SARS2 Nucleoprotein[108 aa] B 98.1
/95.4		 53
/53		 NCAP_SARS2 Nucleoprotein
6wji D NCAP_SARS2 Nucleoprotein[108 aa] C 98.1
/95.4		 54
/54		 NCAP_SARS2 Nucleoprotein
6wji C NCAP_SARS2 Nucleoprotein[108 aa] D 98.1
/95.4		 54
/54		 NCAP_SARS2 Nucleoprotein
6wji F NCAP_SARS2 Nucleoprotein[108 aa] E 98.1
/95.4		 53
/53		 NCAP_SARS2 Nucleoprotein
6wji E NCAP_SARS2 Nucleoprotein[108 aa] F 98.1
/95.4		 52
/52		 NCAP_SARS2 Nucleoprotein
6wzo B NCAP_SARS2 Nucleoprotein[111 aa] A 98.1
/95.4		 54
/54		 NCAP_SARS2 Nucleoprotein
6wzo A NCAP_SARS2 Nucleoprotein[108 aa] B 98.1
/95.5		 53
/53		 NCAP_SARS2 Nucleoprotein
6wzo D NCAP_SARS2 Nucleoprotein[110 aa] C 98.1
/95.4		 53
/53		 NCAP_SARS2 Nucleoprotein
6wzo C NCAP_SARS2 Nucleoprotein[108 aa] D 98.1
/95.5		 54
/54		 NCAP_SARS2 Nucleoprotein
6wzq B NCAP_SARS2 Nucleoprotein[114 aa] A 98.1
/95.6		 52
/52		 NCAP_SARS2 Nucleoprotein
6wzq A NCAP_SARS2 Nucleoprotein[114 aa] B 98.1
/95.6		 54
/54		 NCAP_SARS2 Nucleoprotein
6wzq D NCAP_SARS2 Nucleoprotein[115 aa] C 98.1
/95.7		 54
/54		 NCAP_SARS2 Nucleoprotein
6wzq C NCAP_SARS2 Nucleoprotein[116 aa] D 98.1
/95.7		 52
/52		 NCAP_SARS2 Nucleoprotein
6yun B NCAP_SARS2 Nucleoprotein[135 aa] A 98.2
/95.7		 55
/55		 NCAP_SARS2 Nucleoprotein
6yun A NCAP_SARS2 Nucleoprotein[116 aa] B 98.1
/95.8		 52
/52		 NCAP_SARS2 Nucleoprotein
6zco A NCAP_SARS2 Nucleoprotein[118 aa] A 98.1
/95.8		 52
/52		 NCAP_SARS2 Nucleoprotein
6zco A NCAP_SARS2 Nucleoprotein[118 aa] A 98.1
/95.8		 52
/52		 NCAP_SARS2 Nucleoprotein
7c22 B NCAP_SARS2 Nucleoprotein[113 aa] A 98.0
/95.4		 51
/51		 NCAP_SARS2 Nucleoprotein
7c22 A NCAP_SARS2 Nucleoprotein[109 aa] B 98.1
/95.6		 52
/52		 NCAP_SARS2 Nucleoprotein
7c22 D NCAP_SARS2 Nucleoprotein[108 aa] C 98.1
/95.5		 54
/54		 NCAP_SARS2 Nucleoprotein
7c22 C NCAP_SARS2 Nucleoprotein[112 aa] D 98.2
/95.4		 55
/55		 NCAP_SARS2 Nucleoprotein
7ce0 D NCAP_SARS2 Nucleoprotein[110 aa] A 98.1
/95.5		 53
/53		 NCAP_SARS2 Nucleoprotein
7ce0 C NCAP_SARS2 Nucleoprotein[110 aa] B 98.1
/95.5		 52
/52		 NCAP_SARS2 Nucleoprotein
7ce0 B NCAP_SARS2 Nucleoprotein[110 aa] C 98.1
/95.5		 53
/53		 NCAP_SARS2 Nucleoprotein
7ce0 A NCAP_SARS2 Nucleoprotein[110 aa] D 98.1
/95.5		 54
/54		 NCAP_SARS2 Nucleoprotein
7de1 B NCAP_SARS2 Nucleoprotein[115 aa] A 98.1
/95.4		 53
/53		 NCAP_SARS2 Nucleoprotein
7de1 A NCAP_SARS2 Nucleoprotein[108 aa] B 98.1
/95.7		 54
/54		 NCAP_SARS2 Nucleoprotein
7f2b B NCAP_SARS2 Nucleoprotein[106 aa] A 98.1
/95.3		 52
/52		 NCAP_SARS2 Nucleoprotein
7f2b A NCAP_SARS2 Nucleoprotein[106 aa] B 98.1
/95.3		 53
/53		 NCAP_SARS2 Nucleoprotein
7f2e B NCAP_SARS2 Nucleoprotein[106 aa] A 98.1
/95.3		 53
/53		 NCAP_SARS2 Nucleoprotein
7f2e A NCAP_SARS2 Nucleoprotein[106 aa] B 98.1
/95.3		 53
/53		 NCAP_SARS2 Nucleoprotein
7f2e D NCAP_SARS2 Nucleoprotein[107 aa] C 97.9
/95.3		 48
/48		 NCAP_SARS2 Nucleoprotein
7f2e C NCAP_SARS2 Nucleoprotein[107 aa] D 98.0
/95.3		 49
/49		 NCAP_SARS2 Nucleoprotein
7f2e E NCAP_SARS2 Nucleoprotein[96 aa] F 97.7
/95.9		 43
/43		 NCAP_SARS2 Nucleoprotein
7f2e H NCAP_SARS2 Nucleoprotein[106 aa] G 98.1
/95.3		 54
/54		 NCAP_SARS2 Nucleoprotein
7f2e G NCAP_SARS2 Nucleoprotein[107 aa] H 98.0
/95.3		 51
/51		 NCAP_SARS2 Nucleoprotein
7f2e J NCAP_SARS2 Nucleoprotein[106 aa] I 98.0
/95.3		 51
/51		 NCAP_SARS2 Nucleoprotein
7f2e I NCAP_SARS2 Nucleoprotein[107 aa] J 98.0
/95.3		 50
/50		 NCAP_SARS2 Nucleoprotein
7f2e K NCAP_SARS2 Nucleoprotein[96 aa] L 97.4
/95.7		 39
/39		 NCAP_SARS2 Nucleoprotein
7n0i B NCAP_SARS2 Nucleoprotein[96 aa] A 97.7
/95.8		 43
/43		 NCAP_SARS2 Nucleoprotein
7n0i A NCAP_SARS2 Nucleoprotein[96 aa] B 97.7
/95.8		 44
/44		 NCAP_SARS2 Nucleoprotein
7n0i D NCAP_SARS2 Nucleoprotein[96 aa] C 97.7
/95.8		 44
/44		 NCAP_SARS2 Nucleoprotein
7n0i C NCAP_SARS2 Nucleoprotein[96 aa] D 97.7
/95.8		 44
/44		 NCAP_SARS2 Nucleoprotein
7n0i F NCAP_SARS2 Nucleoprotein[96 aa] E 97.7
/95.8		 43
/43		 NCAP_SARS2 Nucleoprotein
7n0i E NCAP_SARS2 Nucleoprotein[96 aa] F 97.4
/95.8		 38
/38		 NCAP_SARS2 Nucleoprotein
7n0i L NCAP_SARS2 Nucleoprotein[96 aa] G 97.6
/95.8		 42
/42		 NCAP_SARS2 Nucleoprotein
7n0i G NCAP_SARS2 Nucleoprotein[96 aa] L 97.4
/95.8		 39
/39		 NCAP_SARS2 Nucleoprotein
7o05 C NCAP_SARS2 Nucleoprotein[111 aa] A 98.1
/95.4		 53
/53		 NCAP_SARS2 Nucleoprotein
7o05 D NCAP_SARS2 Nucleoprotein[111 aa] B 98.0
/95.4		 50
/50		 NCAP_SARS2 Nucleoprotein
7o05 A NCAP_SARS2 Nucleoprotein[109 aa] C 98.1
/95.5		 53
/53		 NCAP_SARS2 Nucleoprotein
7o05 B NCAP_SARS2 Nucleoprotein[109 aa] D 98.1
/95.5		 52
/52		 NCAP_SARS2 Nucleoprotein
7o35 B NCAP_SARS2 Nucleoprotein[123 aa] A 98.1
/95.5		 52
/52		 NCAP_SARS2 Nucleoprotein
7o35 A NCAP_SARS2 Nucleoprotein[111 aa] B 98.1
/95.8		 52
/52		 NCAP_SARS2 Nucleoprotein
7o35 D NCAP_SARS2 Nucleoprotein[109 aa] C 98.1
/95.5		 52
/52		 NCAP_SARS2 Nucleoprotein
7o35 C NCAP_SARS2 Nucleoprotein[111 aa] D 98.1
/95.4		 52
/52		 NCAP_SARS2 Nucleoprotein
7o36 B NCAP_SARS2 Nucleoprotein[109 aa] A 98.2
/95.5		 55
/55		 NCAP_SARS2 Nucleoprotein
7o36 A NCAP_SARS2 Nucleoprotein[112 aa] B 98.0
/95.4		 51
/51		 NCAP_SARS2 Nucleoprotein
7o36 D NCAP_SARS2 Nucleoprotein[111 aa] C 98.1
/95.6		 54
/54		 NCAP_SARS2 Nucleoprotein
7o36 C NCAP_SARS2 Nucleoprotein[113 aa] D 98.1
/95.5		 54
/54		 NCAP_SARS2 Nucleoprotein
7uxx C NCAP_SARS2 Nucleoprotein[109 aa] A 98.1
/95.4		 54
/54		 NCAP_SARS2 Nucleoprotein
7uxx D NCAP_SARS2 Nucleoprotein[109 aa] B 98.1
/95.4		 53
/53		 NCAP_SARS2 Nucleoprotein
7uxx A NCAP_SARS2 Nucleoprotein[109 aa] C 98.1
/95.4		 53
/53		 NCAP_SARS2 Nucleoprotein
7uxx B NCAP_SARS2 Nucleoprotein[109 aa] D 98.1
/95.4		 52
/52		 NCAP_SARS2 Nucleoprotein
7uxx F NCAP_SARS2 Nucleoprotein[110 aa] E 98.1
/95.4		 54
/54		 NCAP_SARS2 Nucleoprotein
7uxx E NCAP_SARS2 Nucleoprotein[109 aa] F 98.1
/95.5		 54
/54		 NCAP_SARS2 Nucleoprotein
7uxz B NCAP_SARS2 Nucleoprotein[109 aa] A 98.1
/95.4		 53
/53		 NCAP_SARS2 Nucleoprotein
7uxz A NCAP_SARS2 Nucleoprotein[109 aa] B 98.2
/95.4		 55
/55		 NCAP_SARS2 Nucleoprotein
7uxz D NCAP_SARS2 Nucleoprotein[109 aa] C 98.1
/95.4		 53
/53		 NCAP_SARS2 Nucleoprotein
7uxz C NCAP_SARS2 Nucleoprotein[109 aa] D 98.1
/95.4		 54
/54		 NCAP_SARS2 Nucleoprotein
7uxz F NCAP_SARS2 Nucleoprotein[109 aa] E 98.1
/95.4		 53
/53		 NCAP_SARS2 Nucleoprotein
7uxz E NCAP_SARS2 Nucleoprotein[109 aa] F 98.1
/95.4		 53
/53		 NCAP_SARS2 Nucleoprotein
7vbe B NCAP_SARS2 Nucleoprotein[107 aa] A 98.1
/95.4		 52
/52		 NCAP_SARS2 Nucleoprotein
7vbe A NCAP_SARS2 Nucleoprotein[108 aa] B 98.1
/95.3		 53
/53		 NCAP_SARS2 Nucleoprotein
7vbf B NCAP_SARS2 Nucleoprotein[110 aa] A 98.1
/95.5		 54
/54		 NCAP_SARS2 Nucleoprotein
7vbf A NCAP_SARS2 Nucleoprotein[116 aa] B 98.1
/95.5		 53
/53		 NCAP_SARS2 Nucleoprotein
7xwx E NCAP_SARS2 Nucleoprotein[92 aa] A 97.7
/96.0		 43
/43		 NCAP_SARS2 Nucleoprotein
7xwx F NCAP_SARS2 Nucleoprotein[96 aa] B 97.7
/95.9		 44
/44		 NCAP_SARS2 Nucleoprotein
7xwx D NCAP_SARS2 Nucleoprotein[96 aa] C 97.7
/95.9		 44
/44		 NCAP_SARS2 Nucleoprotein
7xwx C NCAP_SARS2 Nucleoprotein[99 aa] D 97.8
/95.8		 45
/45		 NCAP_SARS2 Nucleoprotein
7xwx A NCAP_SARS2 Nucleoprotein[99 aa] E 97.8
/95.7		 46
/46		 NCAP_SARS2 Nucleoprotein
7xwx B NCAP_SARS2 Nucleoprotein[99 aa] F 97.8
/95.8		 45
/45		 NCAP_SARS2 Nucleoprotein
7xwx H NCAP_SARS2 Nucleoprotein[90 aa] G 97.7
/95.9		 43
/43		 NCAP_SARS2 Nucleoprotein
7xwx G NCAP_SARS2 Nucleoprotein[99 aa] H 97.8
/95.6		 46
/46		 NCAP_SARS2 Nucleoprotein
7xxk B NCAP_SARS2 Nucleoprotein[107 aa] A 98.2
/95.4		 55
/55		 NCAP_SARS2 Nucleoprotein
7xxk A NCAP_SARS2 Nucleoprotein[109 aa] B 98.1
/95.3		 54
/54		 NCAP_SARS2 Nucleoprotein
7xxk D NCAP_SARS2 Nucleoprotein[109 aa] C 98.1
/95.3		 53
/53		 NCAP_SARS2 Nucleoprotein
7xxk C NCAP_SARS2 Nucleoprotein[107 aa] D 98.1
/95.4		 54
/54		 NCAP_SARS2 Nucleoprotein
7xxk F NCAP_SARS2 Nucleoprotein[107 aa] E 98.1
/95.4		 54
/54		 NCAP_SARS2 Nucleoprotein
7xxk E NCAP_SARS2 Nucleoprotein[109 aa] F 98.0
/95.3		 51
/51		 NCAP_SARS2 Nucleoprotein
7ylb B NCAP_SARS2 Nucleoprotein[114 aa] A 98.0
/95.4		 49
/49		 NCAP_SARS2 Nucleoprotein
7ylb A NCAP_SARS2 Nucleoprotein[108 aa] B 98.1
/95.6		 52
/52		 NCAP_SARS2 Nucleoprotein
7ylb E NCAP_SARS2 Nucleoprotein[111 aa] D 98.1
/95.5		 52
/52		 NCAP_SARS2 Nucleoprotein
7ylb D NCAP_SARS2 Nucleoprotein[110 aa] E 98.1
/95.5		 52
/52		 NCAP_SARS2 Nucleoprotein
7ylb H NCAP_SARS2 Nucleoprotein[113 aa] G 98.1
/95.4		 52
/52		 NCAP_SARS2 Nucleoprotein
7ylb G NCAP_SARS2 Nucleoprotein[109 aa] H 98.0
/95.6		 51
/51		 NCAP_SARS2 Nucleoprotein
7ylb K NCAP_SARS2 Nucleoprotein[110 aa] J 98.1
/95.5		 52
/52		 NCAP_SARS2 Nucleoprotein
7ylb J NCAP_SARS2 Nucleoprotein[110 aa] K 98.1
/95.5		 52
/52		 NCAP_SARS2 Nucleoprotein
7f2e F NCAP_SARS2 Nucleoprotein[97 aa] E 97.7
/94.8		 43
/43		 NCAP_SARS2 Nucleoprotein
7f2e L NCAP_SARS2 Nucleoprotein[92 aa] K 97.6
/94.8		 41
/41		 NCAP_SARS2 Nucleoprotein
6wkp A NCAP_SARS2 Nucleoprotein[103 aa] B 87.5
/92.3		 8
/8		 NCAP_SARS2 Nucleoprotein
6wkp A NCAP_SARS2 Nucleoprotein[103 aa] D 100.0
/92.2		 6
/6		 NCAP_SARS2 Nucleoprotein
6vyo B NCAP_SARS2 Nucleoprotein[125 aa] A 91.7
/91.9		 12
/12		 NCAP_SARS2 Nucleoprotein
6vyo D NCAP_SARS2 Nucleoprotein[125 aa] A 88.9
/91.9		 9
/9		 NCAP_SARS2 Nucleoprotein
6vyo A NCAP_SARS2 Nucleoprotein[124 aa] B 83.3
/92.0		 12
/12		 NCAP_SARS2 Nucleoprotein
6vyo C NCAP_SARS2 Nucleoprotein[125 aa] B 85.7
/92.0		 7
/7		 NCAP_SARS2 Nucleoprotein
6vyo B NCAP_SARS2 Nucleoprotein[125 aa] C 87.5
/92.0		 8
/8		 NCAP_SARS2 Nucleoprotein
6vyo D NCAP_SARS2 Nucleoprotein[125 aa] C 93.3
/92.0		 15
/15		 NCAP_SARS2 Nucleoprotein
6vyo A NCAP_SARS2 Nucleoprotein[124 aa] D 87.5
/92.0		 8
/8		 NCAP_SARS2 Nucleoprotein
6vyo C NCAP_SARS2 Nucleoprotein[125 aa] D 83.3
/92.0		 12
/12		 NCAP_SARS2 Nucleoprotein
6wkp B NCAP_SARS2 Nucleoprotein[117 aa] A 100.0
/93.2		 8
/8		 NCAP_SARS2 Nucleoprotein
6wkp D NCAP_SARS2 Nucleoprotein[115 aa] A 83.3
/93.2		 6
/6		 NCAP_SARS2 Nucleoprotein
6wkp C NCAP_SARS2 Nucleoprotein[120 aa] B 100.0
/92.3		 5
/5		 NCAP_SARS2 Nucleoprotein
6wkp B NCAP_SARS2 Nucleoprotein[117 aa] C 83.3
/91.7		 6
/6		 NCAP_SARS2 Nucleoprotein
6wkp D NCAP_SARS2 Nucleoprotein[115 aa] C 92.9
/91.7		 14
/14		 NCAP_SARS2 Nucleoprotein
6wkp C NCAP_SARS2 Nucleoprotein[120 aa] D 83.3
/92.2		 12
/12		 NCAP_SARS2 Nucleoprotein
7xx1 B NCAP_SARS2 Nucleoprotein[125 aa] A 83.3
/92.0		 12
/12		 NCAP_SARS2 Nucleoprotein
7xx1 D NCAP_SARS2 Nucleoprotein[119 aa] A 87.5
/92.0		 8
/8		 NCAP_SARS2 Nucleoprotein
7xx1 A NCAP_SARS2 Nucleoprotein[125 aa] B 93.8
/92.0		 16
/16		 NCAP_SARS2 Nucleoprotein
7xx1 C NCAP_SARS2 Nucleoprotein[125 aa] B 87.5
/92.0		 8
/8		 NCAP_SARS2 Nucleoprotein
7xx1 B NCAP_SARS2 Nucleoprotein[125 aa] C 87.5
/92.0		 8
/8		 NCAP_SARS2 Nucleoprotein
7xx1 D NCAP_SARS2 Nucleoprotein[119 aa] C 83.3
/92.0		 12
/12		 NCAP_SARS2 Nucleoprotein
7xx1 A NCAP_SARS2 Nucleoprotein[125 aa] D 88.9
/92.4		 9
/9		 NCAP_SARS2 Nucleoprotein
7xx1 C NCAP_SARS2 Nucleoprotein[125 aa] D 100.0
/92.4		 15
/15		 NCAP_SARS2 Nucleoprotein
8iv3 B NCAP_SARS2 Nucleoprotein[128 aa] A 83.3
/92.1		 6
/6		 NCAP_SARS2 Nucleoprotein
8iv3 C NCAP_SARS2 Nucleoprotein[128 aa] A 90.0
/92.1		 10
/10		 NCAP_SARS2 Nucleoprotein
8iv3 D NCAP_SARS2 Nucleoprotein[126 aa] A 90.9
/92.1		 11
/11		 NCAP_SARS2 Nucleoprotein
8iv3 A NCAP_SARS2 Nucleoprotein[126 aa] B 100.0
/92.2		 10
/10		 NCAP_SARS2 Nucleoprotein
8iv3 C NCAP_SARS2 Nucleoprotein[128 aa] B 100.0
/92.2		 6
/6		 NCAP_SARS2 Nucleoprotein
8iv3 D NCAP_SARS2 Nucleoprotein[126 aa] B 100.0
/92.2		 4
/4		 NCAP_SARS2 Nucleoprotein
8iv3 A NCAP_SARS2 Nucleoprotein[126 aa] C 87.5
/92.2		 8
/8		 NCAP_SARS2 Nucleoprotein
8iv3 B NCAP_SARS2 Nucleoprotein[128 aa] C 100.0
/92.2		 10
/10		 NCAP_SARS2 Nucleoprotein
8iv3 A NCAP_SARS2 Nucleoprotein[126 aa] D 90.0
/92.1		 10
/10		 NCAP_SARS2 Nucleoprotein
8iv3 B NCAP_SARS2 Nucleoprotein[128 aa] D 100.0
/92.1		 5
/5		 NCAP_SARS2 Nucleoprotein
8j6x B NCAP_SARS2 Nucleoprotein[128 aa] A 83.3
/92.1		 6
/6		 NCAP_SARS2 Nucleoprotein
8j6x C NCAP_SARS2 Nucleoprotein[127 aa] A 90.0
/92.1		 10
/10		 NCAP_SARS2 Nucleoprotein
8j6x D NCAP_SARS2 Nucleoprotein[127 aa] A 90.0
/92.1		 10
/10		 NCAP_SARS2 Nucleoprotein
8j6x A NCAP_SARS2 Nucleoprotein[126 aa] B 100.0
/92.2		 10
/10		 NCAP_SARS2 Nucleoprotein
8j6x C NCAP_SARS2 Nucleoprotein[127 aa] B 100.0
/92.2		 6
/6		 NCAP_SARS2 Nucleoprotein
8j6x D NCAP_SARS2 Nucleoprotein[127 aa] B 100.0
/92.2		 3
/3		 NCAP_SARS2 Nucleoprotein
8j6x A NCAP_SARS2 Nucleoprotein[126 aa] C 85.7
/92.1		 7
/7		 NCAP_SARS2 Nucleoprotein
8j6x B NCAP_SARS2 Nucleoprotein[128 aa] C 100.0
/92.1		 8
/8		 NCAP_SARS2 Nucleoprotein
8j6x A NCAP_SARS2 Nucleoprotein[126 aa] D 90.0
/92.1		 10
/10		 NCAP_SARS2 Nucleoprotein
8j6x B NCAP_SARS2 Nucleoprotein[128 aa] D 100.0
/92.1		 5
/5		 NCAP_SARS2 Nucleoprotein
8x1h A NCAP_SARS2 Nucleoprotein[128 aa] A 92.2
/92.2		 128
/128		 NCAP_SARS2 Nucleoprotein
8x1h A NCAP_SARS2 Nucleoprotein[128 aa] A 92.2
/92.2		 128
/128		 NCAP_SARS2 Nucleoprotein
8x1h A NCAP_SARS2 Nucleoprotein[128 aa] A 92.2
/92.2		 128
/128		 NCAP_SARS2 Nucleoprotein
8x1h A NCAP_SARS2 Nucleoprotein[128 aa] A 92.2
/92.2		 128
/128		 NCAP_SARS2 Nucleoprotein
8x1h A NCAP_SARS2 Nucleoprotein[128 aa] A 92.2
/92.2		 128
/128		 NCAP_SARS2 Nucleoprotein
8x1h A NCAP_SARS2 Nucleoprotein[128 aa] A 92.2
/92.2		 128
/128		 NCAP_SARS2 Nucleoprotein
8x1h A NCAP_SARS2 Nucleoprotein[128 aa] A 92.2
/92.2		 128
/128		 NCAP_SARS2 Nucleoprotein
8x1h A NCAP_SARS2 Nucleoprotein[128 aa] A 92.2
/92.2		 128
/128		 NCAP_SARS2 Nucleoprotein
8x1h A NCAP_SARS2 Nucleoprotein[128 aa] A 92.2
/92.2		 128
/128		 NCAP_SARS2 Nucleoprotein
8x1h A NCAP_SARS2 Nucleoprotein[128 aa] A 92.2
/92.2		 128
/128		 NCAP_SARS2 Nucleoprotein
8x1h A NCAP_SARS2 Nucleoprotein[128 aa] A 92.2
/92.2		 128
/128		 NCAP_SARS2 Nucleoprotein
8x1h A NCAP_SARS2 Nucleoprotein[128 aa] A 92.2
/92.2		 128
/128		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] A 100.0
/92.2		 15
/15		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] A 100.0
/92.2		 15
/15		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] A 100.0
/92.2		 15
/15		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] A 100.0
/92.2		 15
/15		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] A 100.0
/92.2		 15
/15		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] A 100.0
/92.2		 15
/15		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] A 100.0
/92.2		 15
/15		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] A 100.0
/92.2		 15
/15		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] A 100.0
/92.2		 15
/15		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] A 100.0
/92.2		 15
/15		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] A 100.0
/92.2		 15
/15		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] A 100.0
/92.2		 15
/15		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] A 100.0
/92.2		 15
/15		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] A 100.0
/92.2		 15
/15		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] A 100.0
/92.2		 15
/15		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] A 100.0
/92.2		 15
/15		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] A 87.5
/92.2		 8
/8		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] A 87.5
/92.2		 8
/8		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] A 87.5
/92.2		 8
/8		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] A 87.5
/92.2		 8
/8		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] A 87.5
/92.2		 8
/8		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] A 87.5
/92.2		 8
/8		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] A 87.5
/92.2		 8
/8		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] A 87.5
/92.2		 8
/8		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] A 87.5
/92.2		 8
/8		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] A 87.5
/92.2		 8
/8		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] A 87.5
/92.2		 8
/8		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] A 87.5
/92.2		 8
/8		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] A 87.5
/92.2		 8
/8		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] A 87.5
/92.2		 8
/8		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] A 87.5
/92.2		 8
/8		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] A 87.5
/92.2		 8
/8		 NCAP_SARS2 Nucleoprotein
8x1h A NCAP_SARS2 Nucleoprotein[128 aa] B 100.0
/92.3		 13
/13		 NCAP_SARS2 Nucleoprotein
8x1h A NCAP_SARS2 Nucleoprotein[128 aa] B 100.0
/92.3		 13
/13		 NCAP_SARS2 Nucleoprotein
8x1h A NCAP_SARS2 Nucleoprotein[128 aa] B 100.0
/92.3		 13
/13		 NCAP_SARS2 Nucleoprotein
8x1h A NCAP_SARS2 Nucleoprotein[128 aa] B 100.0
/92.3		 13
/13		 NCAP_SARS2 Nucleoprotein
8x1h A NCAP_SARS2 Nucleoprotein[128 aa] B 100.0
/92.3		 13
/13		 NCAP_SARS2 Nucleoprotein
8x1h A NCAP_SARS2 Nucleoprotein[128 aa] B 100.0
/92.3		 13
/13		 NCAP_SARS2 Nucleoprotein
8x1h A NCAP_SARS2 Nucleoprotein[128 aa] B 100.0
/92.3		 13
/13		 NCAP_SARS2 Nucleoprotein
8x1h A NCAP_SARS2 Nucleoprotein[128 aa] B 100.0
/92.3		 13
/13		 NCAP_SARS2 Nucleoprotein
8x1h A NCAP_SARS2 Nucleoprotein[128 aa] B 100.0
/92.3		 13
/13		 NCAP_SARS2 Nucleoprotein
8x1h A NCAP_SARS2 Nucleoprotein[128 aa] B 100.0
/92.3		 13
/13		 NCAP_SARS2 Nucleoprotein
8x1h A NCAP_SARS2 Nucleoprotein[128 aa] B 100.0
/92.3		 13
/13		 NCAP_SARS2 Nucleoprotein
8x1h A NCAP_SARS2 Nucleoprotein[128 aa] B 100.0
/92.3		 13
/13		 NCAP_SARS2 Nucleoprotein
8x1h A NCAP_SARS2 Nucleoprotein[128 aa] B 100.0
/92.3		 13
/13		 NCAP_SARS2 Nucleoprotein
8x1h A NCAP_SARS2 Nucleoprotein[128 aa] B 100.0
/92.3		 13
/13		 NCAP_SARS2 Nucleoprotein
8x1h A NCAP_SARS2 Nucleoprotein[128 aa] B 100.0
/92.3		 13
/13		 NCAP_SARS2 Nucleoprotein
8x1h A NCAP_SARS2 Nucleoprotein[128 aa] B 100.0
/92.3		 13
/13		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] B 92.3
/92.3		 130
/130		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] B 92.3
/92.3		 130
/130		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] B 92.3
/92.3		 130
/130		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] B 92.3
/92.3		 130
/130		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] B 92.3
/92.3		 130
/130		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] B 92.3
/92.3		 130
/130		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] B 92.3
/92.3		 130
/130		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] B 92.3
/92.3		 130
/130		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] B 92.3
/92.3		 130
/130		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] B 92.3
/92.3		 130
/130		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] B 92.3
/92.3		 130
/130		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] B 92.3
/92.3		 130
/130		 NCAP_SARS2 Nucleoprotein
8x1h C NCAP_SARS2 Nucleoprotein[127 aa] B 92.3
/92.3		 13
/13		 NCAP_SARS2 Nucleoprotein
8x1h C NCAP_SARS2 Nucleoprotein[127 aa] B 92.3
/92.3		 13
/13		 NCAP_SARS2 Nucleoprotein
8x1h C NCAP_SARS2 Nucleoprotein[127 aa] B 92.3
/92.3		 13
/13		 NCAP_SARS2 Nucleoprotein
8x1h C NCAP_SARS2 Nucleoprotein[127 aa] B 92.3
/92.3		 13
/13		 NCAP_SARS2 Nucleoprotein
8x1h C NCAP_SARS2 Nucleoprotein[127 aa] B 92.3
/92.3		 13
/13		 NCAP_SARS2 Nucleoprotein
8x1h C NCAP_SARS2 Nucleoprotein[127 aa] B 92.3
/92.3		 13
/13		 NCAP_SARS2 Nucleoprotein
8x1h C NCAP_SARS2 Nucleoprotein[127 aa] B 92.3
/92.3		 13
/13		 NCAP_SARS2 Nucleoprotein
8x1h C NCAP_SARS2 Nucleoprotein[127 aa] B 92.3
/92.3		 13
/13		 NCAP_SARS2 Nucleoprotein
8x1h C NCAP_SARS2 Nucleoprotein[127 aa] B 92.3
/92.3		 13
/13		 NCAP_SARS2 Nucleoprotein
8x1h C NCAP_SARS2 Nucleoprotein[127 aa] B 92.3
/92.3		 13
/13		 NCAP_SARS2 Nucleoprotein
8x1h C NCAP_SARS2 Nucleoprotein[127 aa] B 92.3
/92.3		 13
/13		 NCAP_SARS2 Nucleoprotein
8x1h C NCAP_SARS2 Nucleoprotein[127 aa] B 92.3
/92.3		 13
/13		 NCAP_SARS2 Nucleoprotein
8x1h C NCAP_SARS2 Nucleoprotein[127 aa] B 92.3
/92.3		 13
/13		 NCAP_SARS2 Nucleoprotein
8x1h C NCAP_SARS2 Nucleoprotein[127 aa] B 92.3
/92.3		 13
/13		 NCAP_SARS2 Nucleoprotein
8x1h C NCAP_SARS2 Nucleoprotein[127 aa] B 92.3
/92.3		 13
/13		 NCAP_SARS2 Nucleoprotein
8x1h C NCAP_SARS2 Nucleoprotein[127 aa] B 92.3
/92.3		 13
/13		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] B 100.0
/92.3		 8
/8		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] B 100.0
/92.3		 8
/8		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] B 100.0
/92.3		 8
/8		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] B 100.0
/92.3		 8
/8		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] B 100.0
/92.3		 8
/8		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] B 100.0
/92.3		 8
/8		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] B 100.0
/92.3		 8
/8		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] B 100.0
/92.3		 8
/8		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] B 100.0
/92.3		 8
/8		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] B 100.0
/92.3		 8
/8		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] B 100.0
/92.3		 8
/8		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] B 100.0
/92.3		 8
/8		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] B 100.0
/92.3		 8
/8		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] B 100.0
/92.3		 8
/8		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] B 100.0
/92.3		 8
/8		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] B 100.0
/92.3		 8
/8		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] C 92.3
/92.1		 13
/13		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] C 92.3
/92.1		 13
/13		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] C 92.3
/92.1		 13
/13		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] C 92.3
/92.1		 13
/13		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] C 92.3
/92.1		 13
/13		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] C 92.3
/92.1		 13
/13		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] C 92.3
/92.1		 13
/13		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] C 92.3
/92.1		 13
/13		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] C 92.3
/92.1		 13
/13		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] C 92.3
/92.1		 13
/13		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] C 92.3
/92.1		 13
/13		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] C 92.3
/92.1		 13
/13		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] C 92.3
/92.1		 13
/13		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] C 92.3
/92.1		 13
/13		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] C 92.3
/92.1		 13
/13		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] C 92.3
/92.1		 13
/13		 NCAP_SARS2 Nucleoprotein
8x1h C NCAP_SARS2 Nucleoprotein[127 aa] C 92.1
/92.1		 127
/127		 NCAP_SARS2 Nucleoprotein
8x1h C NCAP_SARS2 Nucleoprotein[127 aa] C 92.1
/92.1		 127
/127		 NCAP_SARS2 Nucleoprotein
8x1h C NCAP_SARS2 Nucleoprotein[127 aa] C 92.1
/92.1		 127
/127		 NCAP_SARS2 Nucleoprotein
8x1h C NCAP_SARS2 Nucleoprotein[127 aa] C 92.1
/92.1		 127
/127		 NCAP_SARS2 Nucleoprotein
8x1h C NCAP_SARS2 Nucleoprotein[127 aa] C 92.1
/92.1		 127
/127		 NCAP_SARS2 Nucleoprotein
8x1h C NCAP_SARS2 Nucleoprotein[127 aa] C 92.1
/92.1		 127
/127		 NCAP_SARS2 Nucleoprotein
8x1h C NCAP_SARS2 Nucleoprotein[127 aa] C 92.1
/92.1		 127
/127		 NCAP_SARS2 Nucleoprotein
8x1h C NCAP_SARS2 Nucleoprotein[127 aa] C 92.1
/92.1		 127
/127		 NCAP_SARS2 Nucleoprotein
8x1h C NCAP_SARS2 Nucleoprotein[127 aa] C 92.1
/92.1		 127
/127		 NCAP_SARS2 Nucleoprotein
8x1h C NCAP_SARS2 Nucleoprotein[127 aa] C 92.1
/92.1		 127
/127		 NCAP_SARS2 Nucleoprotein
8x1h C NCAP_SARS2 Nucleoprotein[127 aa] C 92.1
/92.1		 127
/127		 NCAP_SARS2 Nucleoprotein
8x1h C NCAP_SARS2 Nucleoprotein[127 aa] C 92.1
/92.1		 127
/127		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] C 100.0
/92.1		 1
/1		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] C 100.0
/92.1		 1
/1		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] C 100.0
/92.1		 1
/1		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] C 100.0
/92.1		 1
/1		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] C 100.0
/92.1		 1
/1		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] C 100.0
/92.1		 1
/1		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] C 100.0
/92.1		 1
/1		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] C 100.0
/92.1		 1
/1		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] C 100.0
/92.1		 1
/1		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] C 100.0
/92.1		 1
/1		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] C 100.0
/92.1		 1
/1		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] C 100.0
/92.1		 1
/1		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] C 100.0
/92.1		 1
/1		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] C 100.0
/92.1		 1
/1		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] C 100.0
/92.1		 1
/1		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] C 100.0
/92.1		 1
/1		 NCAP_SARS2 Nucleoprotein
8x1h A NCAP_SARS2 Nucleoprotein[128 aa] D 83.3
/91.8		 6
/6		 NCAP_SARS2 Nucleoprotein
8x1h A NCAP_SARS2 Nucleoprotein[128 aa] D 83.3
/91.8		 6
/6		 NCAP_SARS2 Nucleoprotein
8x1h A NCAP_SARS2 Nucleoprotein[128 aa] D 83.3
/91.8		 6
/6		 NCAP_SARS2 Nucleoprotein
8x1h A NCAP_SARS2 Nucleoprotein[128 aa] D 83.3
/91.8		 6
/6		 NCAP_SARS2 Nucleoprotein
8x1h A NCAP_SARS2 Nucleoprotein[128 aa] D 83.3
/91.8		 6
/6		 NCAP_SARS2 Nucleoprotein
8x1h A NCAP_SARS2 Nucleoprotein[128 aa] D 83.3
/91.8		 6
/6		 NCAP_SARS2 Nucleoprotein
8x1h A NCAP_SARS2 Nucleoprotein[128 aa] D 83.3
/91.8		 6
/6		 NCAP_SARS2 Nucleoprotein
8x1h A NCAP_SARS2 Nucleoprotein[128 aa] D 83.3
/91.8		 6
/6		 NCAP_SARS2 Nucleoprotein
8x1h A NCAP_SARS2 Nucleoprotein[128 aa] D 83.3
/91.8		 6
/6		 NCAP_SARS2 Nucleoprotein
8x1h A NCAP_SARS2 Nucleoprotein[128 aa] D 83.3
/91.8		 6
/6		 NCAP_SARS2 Nucleoprotein
8x1h A NCAP_SARS2 Nucleoprotein[128 aa] D 83.3
/91.8		 6
/6		 NCAP_SARS2 Nucleoprotein
8x1h A NCAP_SARS2 Nucleoprotein[128 aa] D 83.3
/91.8		 6
/6		 NCAP_SARS2 Nucleoprotein
8x1h A NCAP_SARS2 Nucleoprotein[128 aa] D 83.3
/91.8		 6
/6		 NCAP_SARS2 Nucleoprotein
8x1h A NCAP_SARS2 Nucleoprotein[128 aa] D 83.3
/91.8		 6
/6		 NCAP_SARS2 Nucleoprotein
8x1h A NCAP_SARS2 Nucleoprotein[128 aa] D 83.3
/91.8		 6
/6		 NCAP_SARS2 Nucleoprotein
8x1h A NCAP_SARS2 Nucleoprotein[128 aa] D 83.3
/91.8		 6
/6		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] D 80.0
/91.8		 5
/5		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] D 80.0
/91.8		 5
/5		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] D 80.0
/91.8		 5
/5		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] D 80.0
/91.8		 5
/5		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] D 80.0
/91.8		 5
/5		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] D 80.0
/91.8		 5
/5		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] D 80.0
/91.8		 5
/5		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] D 80.0
/91.8		 5
/5		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] D 80.0
/91.8		 5
/5		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] D 80.0
/91.8		 5
/5		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] D 80.0
/91.8		 5
/5		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] D 80.0
/91.8		 5
/5		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] D 80.0
/91.8		 5
/5		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] D 80.0
/91.8		 5
/5		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] D 80.0
/91.8		 5
/5		 NCAP_SARS2 Nucleoprotein
8x1h B NCAP_SARS2 Nucleoprotein[130 aa] D 80.0
/91.8		 5
/5		 NCAP_SARS2 Nucleoprotein
8x1h C NCAP_SARS2 Nucleoprotein[127 aa] D 100.0
/91.8		 1
/1		 NCAP_SARS2 Nucleoprotein
8x1h C NCAP_SARS2 Nucleoprotein[127 aa] D 100.0
/91.8		 1
/1		 NCAP_SARS2 Nucleoprotein
8x1h C NCAP_SARS2 Nucleoprotein[127 aa] D 100.0
/91.8		 1
/1		 NCAP_SARS2 Nucleoprotein
8x1h C NCAP_SARS2 Nucleoprotein[127 aa] D 100.0
/91.8		 1
/1		 NCAP_SARS2 Nucleoprotein
8x1h C NCAP_SARS2 Nucleoprotein[127 aa] D 100.0
/91.8		 1
/1		 NCAP_SARS2 Nucleoprotein
8x1h C NCAP_SARS2 Nucleoprotein[127 aa] D 100.0
/91.8		 1
/1		 NCAP_SARS2 Nucleoprotein
8x1h C NCAP_SARS2 Nucleoprotein[127 aa] D 100.0
/91.8		 1
/1		 NCAP_SARS2 Nucleoprotein
8x1h C NCAP_SARS2 Nucleoprotein[127 aa] D 100.0
/91.8		 1
/1		 NCAP_SARS2 Nucleoprotein
8x1h C NCAP_SARS2 Nucleoprotein[127 aa] D 100.0
/91.8		 1
/1		 NCAP_SARS2 Nucleoprotein
8x1h C NCAP_SARS2 Nucleoprotein[127 aa] D 100.0
/91.8		 1
/1		 NCAP_SARS2 Nucleoprotein
8x1h C NCAP_SARS2 Nucleoprotein[127 aa] D 100.0
/91.8		 1
/1		 NCAP_SARS2 Nucleoprotein
8x1h C NCAP_SARS2 Nucleoprotein[127 aa] D 100.0
/91.8		 1
/1		 NCAP_SARS2 Nucleoprotein
8x1h C NCAP_SARS2 Nucleoprotein[127 aa] D 100.0
/91.8		 1
/1		 NCAP_SARS2 Nucleoprotein
8x1h C NCAP_SARS2 Nucleoprotein[127 aa] D 100.0
/91.8		 1
/1		 NCAP_SARS2 Nucleoprotein
8x1h C NCAP_SARS2 Nucleoprotein[127 aa] D 100.0
/91.8		 1
/1		 NCAP_SARS2 Nucleoprotein
8x1h C NCAP_SARS2 Nucleoprotein[127 aa] D 100.0
/91.8		 1
/1		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] D 91.8
/91.8		 122
/122		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] D 91.8
/91.8		 122
/122		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] D 91.8
/91.8		 122
/122		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] D 91.8
/91.8		 122
/122		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] D 91.8
/91.8		 122
/122		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] D 91.8
/91.8		 122
/122		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] D 91.8
/91.8		 122
/122		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] D 91.8
/91.8		 122
/122		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] D 91.8
/91.8		 122
/122		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] D 91.8
/91.8		 122
/122		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] D 91.8
/91.8		 122
/122		 NCAP_SARS2 Nucleoprotein
8x1h D NCAP_SARS2 Nucleoprotein[122 aa] D 91.8
/91.8		 122
/122		 NCAP_SARS2 Nucleoprotein
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
422 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
7f2b C PO4
PHOSPHATE ION[5 atoms] 		A 100.0
/95.3		 1
/1		 NCAP_SARS2 Nucleoprotein
7f2b D PO4
PHOSPHATE ION[5 atoms] 		A 100.0
/95.3		 2
/2		 NCAP_SARS2 Nucleoprotein
7f2b F PO4
PHOSPHATE ION[5 atoms] 		B 80.0
/95.3		 5
/5		 NCAP_SARS2 Nucleoprotein
7f2b G PO4
PHOSPHATE ION[5 atoms] 		B 100.0
/95.3		 2
/2		 NCAP_SARS2 Nucleoprotein
7f2b H PO4
PHOSPHATE ION[5 atoms] 		B 100.0
/95.3		 3
/3		 NCAP_SARS2 Nucleoprotein
7f2b I PO4
PHOSPHATE ION[5 atoms] 		B 100.0
/95.3		 1
/1		 NCAP_SARS2 Nucleoprotein
7f2e M PO4
PHOSPHATE ION[5 atoms] 		G 100.0
/95.3		 3
/3		 NCAP_SARS2 Nucleoprotein
7f2e N PO4
PHOSPHATE ION[5 atoms] 		G 100.0
/95.3		 3
/3		 NCAP_SARS2 Nucleoprotein
7f2e M PO4
PHOSPHATE ION[5 atoms] 		H 100.0
/95.3		 1
/1		 NCAP_SARS2 Nucleoprotein
7f2e N PO4
PHOSPHATE ION[5 atoms] 		H 100.0
/95.3		 2
/2		 NCAP_SARS2 Nucleoprotein
7f2e O PO4
PHOSPHATE ION[5 atoms] 		I 100.0
/95.3		 2
/2		 NCAP_SARS2 Nucleoprotein
7f2e P PO4
PHOSPHATE ION[5 atoms] 		I 100.0
/95.3		 2
/2		 NCAP_SARS2 Nucleoprotein
7f2e O PO4
PHOSPHATE ION[5 atoms] 		J 100.0
/95.3		 1
/1		 NCAP_SARS2 Nucleoprotein
7f2e P PO4
PHOSPHATE ION[5 atoms] 		J 100.0
/95.3		 1
/1		 NCAP_SARS2 Nucleoprotein
7n3c Y PO4
PHOSPHATE ION[5 atoms] 		C 100.0
/92.1		 4
/4		 NCAP_SARS2 Nucleoprotein
7xwx I PO4
PHOSPHATE ION[5 atoms] 		A 100.0
/96.0		 2
/2		 NCAP_SARS2 Nucleoprotein
7xwx J PO4
PHOSPHATE ION[5 atoms] 		B 100.0
/95.9		 2
/2		 NCAP_SARS2 Nucleoprotein
7xwx K PO4
PHOSPHATE ION[5 atoms] 		C 100.0
/95.9		 2
/2		 NCAP_SARS2 Nucleoprotein
2gib C SO4
SULFATE ION[5 atoms] 		A 100.0
/100.0		 2
/2		 NCAP_CVHSA Nucleocapsid protein
2gib C SO4
SULFATE ION[5 atoms] 		A 100.0
/100.0		 2
/2		 NCAP_CVHSA Nucleocapsid protein
2gib C SO4
SULFATE ION[5 atoms] 		A 100.0
/100.0		 2
/2		 NCAP_CVHSA Nucleocapsid protein
2gib C SO4
SULFATE ION[5 atoms] 		A 100.0
/100.0		 2
/2		 NCAP_CVHSA Nucleocapsid protein
2gib C SO4
SULFATE ION[5 atoms] 		A 100.0
/100.0		 2
/2		 NCAP_CVHSA Nucleocapsid protein
6wzq E SO4
SULFATE ION[5 atoms] 		A 100.0
/95.6		 2
/2		 NCAP_SARS2 Nucleoprotein
6wzq F SO4
SULFATE ION[5 atoms] 		A 100.0
/95.6		 1
/1		 NCAP_SARS2 Nucleoprotein
6wzq G SO4
SULFATE ION[5 atoms] 		B 100.0
/95.6		 1
/1		 NCAP_SARS2 Nucleoprotein
6wzq H SO4
SULFATE ION[5 atoms] 		C 100.0
/95.7		 2
/2		 NCAP_SARS2 Nucleoprotein
6wzq I SO4
SULFATE ION[5 atoms] 		C 100.0
/95.7		 3
/3		 NCAP_SARS2 Nucleoprotein
6wzq J SO4
SULFATE ION[5 atoms] 		D 100.0
/95.7		 1
/1		 NCAP_SARS2 Nucleoprotein
7n0r F SO4
SULFATE ION[5 atoms] 		B 100.0
/92.1		 2
/2		 NCAP_SARS2 Nucleoprotein
7n0r G SO4
SULFATE ION[5 atoms] 		B 100.0
/92.1		 4
/4		 NCAP_SARS2 Nucleoprotein
7ylb M SO4
SULFATE ION[5 atoms] 		B 80.0
/95.6		 5
/5		 NCAP_SARS2 Nucleoprotein
7ylb N SO4
SULFATE ION[5 atoms] 		E 80.0
/95.5		 5
/5		 NCAP_SARS2 Nucleoprotein
7ylb O SO4
SULFATE ION[5 atoms] 		H 80.0
/95.6		 5
/5		 NCAP_SARS2 Nucleoprotein
7ylb P SO4
SULFATE ION[5 atoms] 		K 75.0
/95.5		 4
/4		 NCAP_SARS2 Nucleoprotein
7c22 F PEG
DI(HYDROXYETHYL)ETHER[7 atoms] 		A 100.0
/95.4		 3
/3		 NCAP_SARS2 Nucleoprotein
7de1 C PEG
DI(HYDROXYETHYL)ETHER[7 atoms] 		B 100.0
/95.7		 5
/5		 NCAP_SARS2 Nucleoprotein
7de1 D PEG
DI(HYDROXYETHYL)ETHER[7 atoms] 		B 100.0
/95.7		 2
/2		 NCAP_SARS2 Nucleoprotein
7de1 E PEG
DI(HYDROXYETHYL)ETHER[7 atoms] 		B 100.0
/95.7		 4
/4		 NCAP_SARS2 Nucleoprotein
7uxz H PEG
DI(HYDROXYETHYL)ETHER[7 atoms] 		A 100.0
/95.4		 4
/4		 NCAP_SARS2 Nucleoprotein
7uxz H PEG
DI(HYDROXYETHYL)ETHER[7 atoms] 		B 100.0
/95.4		 1
/1		 NCAP_SARS2 Nucleoprotein
7uxz M PEG
DI(HYDROXYETHYL)ETHER[7 atoms] 		F 100.0
/95.4		 3
/3		 NCAP_SARS2 Nucleoprotein
7xxk G SCN
THIOCYANATE ION[3 atoms] 		A 100.0
/95.4		 5
/5		 NCAP_SARS2 Nucleoprotein
6vyo E MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms] 		A 100.0
/91.9		 5
/5		 NCAP_SARS2 Nucleoprotein
6vyo G MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms] 		A 100.0
/91.9		 3
/3		 NCAP_SARS2 Nucleoprotein
6vyo G MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms] 		B 100.0
/92.0		 4
/4		 NCAP_SARS2 Nucleoprotein
6vyo L MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms] 		B 100.0
/92.0		 2
/2		 NCAP_SARS2 Nucleoprotein
6vyo L MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms] 		C 83.3
/92.0		 6
/6		 NCAP_SARS2 Nucleoprotein
6vyo Q MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms] 		C 100.0
/92.0		 3
/3		 NCAP_SARS2 Nucleoprotein
6vyo E MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms] 		D 100.0
/92.0		 1
/1		 NCAP_SARS2 Nucleoprotein
6vyo Q MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms] 		D 100.0
/92.0		 3
/3		 NCAP_SARS2 Nucleoprotein
6wkp F MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms] 		A 100.0
/93.2		 5
/5		 NCAP_SARS2 Nucleoprotein
6wkp F MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms] 		B 100.0
/92.3		 4
/4		 NCAP_SARS2 Nucleoprotein
6wkp I MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms] 		C 100.0
/91.7		 4
/4		 NCAP_SARS2 Nucleoprotein
6wkp I MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms] 		D 100.0
/92.2		 4
/4		 NCAP_SARS2 Nucleoprotein
7xx1 G MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms] 		A 100.0
/92.0		 4
/4		 NCAP_SARS2 Nucleoprotein
7xx1 L MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms] 		A 100.0
/92.0		 1
/1		 NCAP_SARS2 Nucleoprotein
7xx1 G MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms] 		B 100.0
/92.0		 4
/4		 NCAP_SARS2 Nucleoprotein
7xx1 H MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms] 		B 100.0
/92.0		 5
/5		 NCAP_SARS2 Nucleoprotein
7xx1 H MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms] 		C 100.0
/92.0		 2
/2		 NCAP_SARS2 Nucleoprotein
7xx1 K MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms] 		C 100.0
/92.0		 4
/4		 NCAP_SARS2 Nucleoprotein
7xx1 K MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms] 		D 100.0
/92.4		 4
/4		 NCAP_SARS2 Nucleoprotein
7xx1 L MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms] 		D 100.0
/92.4		 5
/5		 NCAP_SARS2 Nucleoprotein
6vyo K GOL
GLYCEROL[6 atoms] 		B 100.0
/92.0		 3
/3		 NCAP_SARS2 Nucleoprotein
6vyo P GOL
GLYCEROL[6 atoms] 		C 83.3
/92.0		 6
/6		 NCAP_SARS2 Nucleoprotein
6vyo S GOL
GLYCEROL[6 atoms] 		D 100.0
/92.0		 3
/3		 NCAP_SARS2 Nucleoprotein
6vyo T GOL
GLYCEROL[6 atoms] 		D 85.7
/92.0		 7
/7		 NCAP_SARS2 Nucleoprotein
7o36 F GOL
GLYCEROL[6 atoms] 		A 100.0
/95.5		 3
/3		 NCAP_SARS2 Nucleoprotein
7o36 F GOL
GLYCEROL[6 atoms] 		B 100.0
/95.4		 9
/9		 NCAP_SARS2 Nucleoprotein
7uxx G GOL
GLYCEROL[6 atoms] 		A 100.0
/95.4		 4
/4		 NCAP_SARS2 Nucleoprotein
7uxx H GOL
GLYCEROL[6 atoms] 		B 100.0
/95.4		 1
/1		 NCAP_SARS2 Nucleoprotein
7uxx G GOL
GLYCEROL[6 atoms] 		C 100.0
/95.4		 2
/2		 NCAP_SARS2 Nucleoprotein
7uxx H GOL
GLYCEROL[6 atoms] 		D 100.0
/95.4		 3
/3		 NCAP_SARS2 Nucleoprotein
7uxx J GOL
GLYCEROL[6 atoms] 		F 75.0
/95.5		 4
/4		 NCAP_SARS2 Nucleoprotein
7uxz I GOL
GLYCEROL[6 atoms] 		A 100.0
/95.4		 2
/2		 NCAP_SARS2 Nucleoprotein
7uxz I GOL
GLYCEROL[6 atoms] 		B 100.0
/95.4		 3
/3		 NCAP_SARS2 Nucleoprotein
7uxz K GOL
GLYCEROL[6 atoms] 		D 50.0
/95.4		 4
/4		 NCAP_SARS2 Nucleoprotein
7uxz N GOL
GLYCEROL[6 atoms] 		F 80.0
/95.4		 5
/5		 NCAP_SARS2 Nucleoprotein
7xwz I GOL
GLYCEROL[6 atoms] 		B 66.7
/91.7		 6
/6		 NCAP_SARS2 Nucleoprotein
8x1h E GOL
GLYCEROL[6 atoms] 		A 100.0
/92.2		 6
/6		 NCAP_SARS2 Nucleoprotein
8x1h E GOL
GLYCEROL[6 atoms] 		A 100.0
/92.2		 6
/6		 NCAP_SARS2 Nucleoprotein
8x1h E GOL
GLYCEROL[6 atoms] 		A 100.0
/92.2		 6
/6		 NCAP_SARS2 Nucleoprotein
8x1h E GOL
GLYCEROL[6 atoms] 		A 100.0
/92.2		 6
/6		 NCAP_SARS2 Nucleoprotein
8x1h E GOL
GLYCEROL[6 atoms] 		A 100.0
/92.2		 6
/6		 NCAP_SARS2 Nucleoprotein
8x1h E GOL
GLYCEROL[6 atoms] 		A 100.0
/92.2		 6
/6		 NCAP_SARS2 Nucleoprotein
8x1h E GOL
GLYCEROL[6 atoms] 		A 100.0
/92.2		 6
/6		 NCAP_SARS2 Nucleoprotein
8x1h E GOL
GLYCEROL[6 atoms] 		A 100.0
/92.2		 6
/6		 NCAP_SARS2 Nucleoprotein
8x1h E GOL
GLYCEROL[6 atoms] 		A 100.0
/92.2		 6
/6		 NCAP_SARS2 Nucleoprotein
8x1h E GOL
GLYCEROL[6 atoms] 		A 100.0
/92.2		 6
/6		 NCAP_SARS2 Nucleoprotein
8x1h E GOL
GLYCEROL[6 atoms] 		A 100.0
/92.2		 6
/6		 NCAP_SARS2 Nucleoprotein
8x1h E GOL
GLYCEROL[6 atoms] 		A 100.0
/92.2		 6
/6		 NCAP_SARS2 Nucleoprotein
8x1h E GOL
GLYCEROL[6 atoms] 		A 100.0
/92.2		 6
/6		 NCAP_SARS2 Nucleoprotein
8x1h E GOL
GLYCEROL[6 atoms] 		A 100.0
/92.2		 6
/6		 NCAP_SARS2 Nucleoprotein
8x1h E GOL
GLYCEROL[6 atoms] 		A 100.0
/92.2		 6
/6		 NCAP_SARS2 Nucleoprotein
8x1h E GOL
GLYCEROL[6 atoms] 		A 100.0
/92.2		 6
/6		 NCAP_SARS2 Nucleoprotein
7c22 E ACT
ACETATE ION[4 atoms] 		A 100.0
/95.4		 2
/2		 NCAP_SARS2 Nucleoprotein
7c22 E ACT
ACETATE ION[4 atoms] 		B 100.0
/95.6		 1
/1		 NCAP_SARS2 Nucleoprotein
7c22 G ACT
ACETATE ION[4 atoms] 		C 100.0
/95.5		 3
/3		 NCAP_SARS2 Nucleoprotein
7c22 G ACT
ACETATE ION[4 atoms] 		D 100.0
/95.4		 1
/1		 NCAP_SARS2 Nucleoprotein
7n0i M ACT
ACETATE ION[4 atoms] 		C 100.0
/95.8		 3
/3		 NCAP_SARS2 Nucleoprotein
7n0i M ACT
ACETATE ION[4 atoms] 		D 100.0
/95.8		 2
/2		 NCAP_SARS2 Nucleoprotein
7n0i O ACT
ACETATE ION[4 atoms] 		L 100.0
/95.8		 2
/2		 NCAP_SARS2 Nucleoprotein
7uxx I ACT
ACETATE ION[4 atoms] 		B 100.0
/95.4		 3
/3		 NCAP_SARS2 Nucleoprotein
7uxx I ACT
ACETATE ION[4 atoms] 		D 100.0
/95.4		 2
/2		 NCAP_SARS2 Nucleoprotein
7vnu E ACT
ACETATE ION[4 atoms] 		C 100.0
/92.1		 3
/3		 NCAP_SARS2 Nucleoprotein
2ofz B EDO
1,2-ETHANEDIOL[4 atoms] 		A 100.0
/100.0		 2
/2		 NCAP_CVHSA Nucleocapsid protein
7n3c M EDO
1,2-ETHANEDIOL[4 atoms] 		C 100.0
/92.1		 1
/1		 NCAP_SARS2 Nucleoprotein
7n3c R EDO
1,2-ETHANEDIOL[4 atoms] 		C 100.0
/92.1		 3
/3		 NCAP_SARS2 Nucleoprotein
7n3c S EDO
1,2-ETHANEDIOL[4 atoms] 		C 100.0
/92.1		 5
/5		 NCAP_SARS2 Nucleoprotein
7n3d K EDO
1,2-ETHANEDIOL[4 atoms] 		C 100.0
/92.7		 2
/2		 NCAP_SARS2 Nucleoprotein
7n3d L EDO
1,2-ETHANEDIOL[4 atoms] 		C 80.0
/92.7		 5
/5		 NCAP_SARS2 Nucleoprotein
7n3d M EDO
1,2-ETHANEDIOL[4 atoms] 		C 100.0
/92.7		 5
/5		 NCAP_SARS2 Nucleoprotein
7n3d N EDO
1,2-ETHANEDIOL[4 atoms] 		C 66.7
/92.7		 3
/3		 NCAP_SARS2 Nucleoprotein
7str D EDO
1,2-ETHANEDIOL[4 atoms] 		C 100.0
/92.1		 1
/1		 NCAP_SARS2 Nucleoprotein
7str F EDO
1,2-ETHANEDIOL[4 atoms] 		C 80.0
/92.1		 5
/5		 NCAP_SARS2 Nucleoprotein
7str G EDO
1,2-ETHANEDIOL[4 atoms] 		C 80.0
/92.1		 5
/5		 NCAP_SARS2 Nucleoprotein
7xwz G EDO
1,2-ETHANEDIOL[4 atoms] 		A 66.7
/92.0		 3
/3		 NCAP_SARS2 Nucleoprotein
7xwz H EDO
1,2-ETHANEDIOL[4 atoms] 		B 66.7
/91.7		 3
/3		 NCAP_SARS2 Nucleoprotein
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.