Contact Molecules for Homologous Proteins

[Summary Bars]
[SiteTable]


Full Bars[30 %]


[Back to Search Page]
[Back to HOMCOS]

[SupCon3D]
[help] 		seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
15368 468 37 P08887(IL6RA_HUMAN) RecName: Full=Interleukin-6 receptor subunit alpha ; Short=IL-6 receptor subunit alpha; Short=IL-6R subunit alpha; Short=IL-6R-alpha; Short=IL-6RA;AltName: Full=IL-6R 1;AltName: Full=Membrane glycoprotein 80; Short=gp80;AltName: CD_antigen=CD126;Contains: RecName: Full=Soluble interleukin-6 receptor subunit alpha ; Short=sIL6R ;Flags: Precursor;
QUERYSEQ 
MLAVGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLV
RKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQ
GEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPRPTPVLVPLISPPVSPSSLGSDNTSSHNRPDA
RDPRSPYDISNTDYFFPR
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [P08887(IL6RA_HUMAN)]

468
region name description
1-19 SIGNAL
20-468 CHAIN /note="Interleukin-6 receptor subunit alpha" /id="PRO_0000010895"
20-355 CHAIN /note="Soluble interleukin-6 receptor subunit alpha" /id="PRO_0000450730"
20-365 TOPO_DOM /note="Extracellular"
366-386 TRANSMEM /note="Helical"
387-468 TOPO_DOM /note="Cytoplasmic"
26-112 DOMAIN /note="Ig-like C2-type"
113-217 DOMAIN /note="Fibronectin type-III 1"
218-316 DOMAIN /note="Fibronectin type-III 2"
303-328 REGION /note="Disordered"
421-468 REGION /note="Disordered"
311-328 COMPBIAS /note="Polar residues"
1-468 DISORDER predicted by DISOPRED

MONOMER
468
pdb_id a1 identity[%]2 description
1n26 A 100.0 IL6A_HUMAN IL-6 Receptor alpha chain
8d82 A 100.0 IL6RA_HUMAN Soluble interleukin-6 receptor subunit alpha
8d82 D 100.0 IL6RA_HUMAN Soluble interleukin-6 receptor subunit alpha
1p9m C 100.0 IL6RA_HUMAN Interleukin-6 receptor alpha chain
8qy6 C 100.0 IL6RA_HUMAN Interleukin-6 receptor subunit alpha
8qy5 E 100.0 IL6RA_HUMAN Interleukin-6 receptor subunit alpha
8qy5 C 100.0 IL6RA_HUMAN Interleukin-6 receptor subunit alpha
8qy6 E 100.0 IL6RA_HUMAN Interleukin-6 receptor subunit alpha
5fuc C 99.0 D6R9R8_HUMAN IL6RA_HUMAN INTERLEUKIN-6 RECEPTOR SUBUNIT ALPHA, INTERLEUKIN-6 RECEPTOR
5fuc D 99.0 D6R9R8_HUMAN IL6RA_HUMAN INTERLEUKIN-6 RECEPTOR SUBUNIT ALPHA, INTERLEUKIN-6 RECEPTOR
7dc8 C 99.5 IL6RA_HUMAN Interleukin-6 receptor subunit alpha
7dc8 F 99.5 IL6RA_HUMAN Interleukin-6 receptor subunit alpha
2arw A 100.0 IL6RA_HUMAN Interleukin-6 receptor alpha chain
8iow A 100.0 IL6RA_HUMAN Interleukin-6 receptor subunit alpha
8j6f C 100.0 IL6RA_HUMAN Interleukin-6 receptor subunit alpha
8dpt F 34.2 I11RA_HUMAN Interleukin-11 receptor subunit alpha
8dpt C 34.2 I11RA_HUMAN Interleukin-11 receptor subunit alpha
6o4p A 35.0 I11RA_HUMAN Interleukin-11 receptor subunit alpha
6o4p B 35.4 I11RA_HUMAN Interleukin-11 receptor subunit alpha
8dpu R 35.3 I11RA_HUMAN Interleukin-11 receptor subunit alpha
8dpu O 35.3 I11RA_HUMAN Interleukin-11 receptor subunit alpha
8dpu F 35.3 I11RA_HUMAN Interleukin-11 receptor subunit alpha
8dpu L 35.3 I11RA_HUMAN Interleukin-11 receptor subunit alpha
8dpu I 35.3 I11RA_HUMAN Interleukin-11 receptor subunit alpha
8dpu C 35.3 I11RA_HUMAN Interleukin-11 receptor subunit alpha
8d7h A 33.9 CNTFR_HUMAN Ciliary neurotrophic factor receptor subunit alpha
8d7e A 33.9 CNTFR_HUMAN Ciliary neurotrophic factor receptor subunit alpha
8d7h D 33.9 CNTFR_HUMAN Ciliary neurotrophic factor receptor subunit alpha
8d74 C 34.7 CNTFR_HUMAN Ciliary neurotrophic factor receptor subunit alpha
8d7r B 34.7 CNTFR_HUMAN Ciliary neurotrophic factor receptor subunit alpha
1uc6 A 40.8 CNTFR_HUMAN Ciliary Neurotrophic Factor Receptor alpha
8dps C 33.9 I11RA_HUMAN Interleukin-11 receptor subunit alpha
8dps F 33.9 I11RA_HUMAN Interleukin-11 receptor subunit alpha
8qy4 F 31.7 I11RA_HUMAN Interleukin-11 receptor subunit alpha
8qy4 E 31.7 I11RA_HUMAN Interleukin-11 receptor subunit alpha
1bqu A 30.2 IL6RB_HUMAN PROTEIN (GP130)
1f45 A 30.4 I12B_HUMAN INTERLEUKIN-12 BETA CHAIN 
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HETERO
468 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
1p9m A IL6RB_HUMAN Interleukin-6 receptor beta chain[298 aa] C 100.0
/100.0		 12
/12		 IL6RA_HUMAN Interleukin-6 receptor alpha chain
1p9m A IL6RB_HUMAN Interleukin-6 receptor beta chain[298 aa] C 100.0
/100.0		 8
/8		 IL6RA_HUMAN Interleukin-6 receptor alpha chain
1p9m A IL6RB_HUMAN Interleukin-6 receptor beta chain[298 aa] C 100.0
/100.0		 8
/8		 IL6RA_HUMAN Interleukin-6 receptor alpha chain
1p9m A IL6RB_HUMAN Interleukin-6 receptor beta chain[298 aa] C 100.0
/100.0		 12
/12		 IL6RA_HUMAN Interleukin-6 receptor alpha chain
1p9m B IL6_HUMAN Interleukin-6[163 aa] C 100.0
/100.0		 15
/15		 IL6RA_HUMAN Interleukin-6 receptor alpha chain
1p9m B IL6_HUMAN Interleukin-6[163 aa] C 100.0
/100.0		 15
/15		 IL6RA_HUMAN Interleukin-6 receptor alpha chain
5fuc B IL6_HUMAN INTERLEUKIN-6[160 aa] C 100.0
/99.0		 18
/18		 D6R9R8_HUMAN IL6RA_HUMAN INTERLEUKIN-6 RECEPTOR SUBUNIT ALPHA, INTERLEUKIN-..
8d82 B IL6_HUMAN Interleukin-6[169 aa] A 100.0
/100.0		 12
/12		 IL6RA_HUMAN Soluble interleukin-6 receptor subunit alpha
8d82 E IL6_HUMAN Interleukin-6[169 aa] D 100.0
/100.0		 12
/12		 IL6RA_HUMAN Soluble interleukin-6 receptor subunit alpha
8qy5 B IL6_HUMAN Interleukin-6[157 aa] C 100.0
/100.0		 11
/11		 IL6RA_HUMAN Interleukin-6 receptor subunit alpha
8qy5 D IL6_HUMAN Interleukin-6[157 aa] E 100.0
/100.0		 10
/10		 IL6RA_HUMAN Interleukin-6 receptor subunit alpha
8qy6 B IL6_HUMAN Interleukin-6[157 aa] C 100.0
/100.0		 10
/10		 IL6RA_HUMAN Interleukin-6 receptor subunit alpha
8qy6 D IL6_HUMAN Interleukin-6[157 aa] E 100.0
/100.0		 11
/11		 IL6RA_HUMAN Interleukin-6 receptor subunit alpha
8d82 C IL6RB_HUMAN Interleukin-6 receptor subunit beta[589 aa] A 100.0
/100.0		 11
/11		 IL6RA_HUMAN Soluble interleukin-6 receptor subunit alpha
8d82 F IL6RB_HUMAN Interleukin-6 receptor subunit beta[589 aa] A 100.0
/100.0		 6
/6		 IL6RA_HUMAN Soluble interleukin-6 receptor subunit alpha
8d82 C IL6RB_HUMAN Interleukin-6 receptor subunit beta[589 aa] D 100.0
/100.0		 6
/6		 IL6RA_HUMAN Soluble interleukin-6 receptor subunit alpha
8d82 F IL6RB_HUMAN Interleukin-6 receptor subunit beta[589 aa] D 100.0
/100.0		 11
/11		 IL6RA_HUMAN Soluble interleukin-6 receptor subunit alpha
8iow C Light chain of Sarilumab Fab[212 aa] A 100.0
/100.0		 6
/6		 IL6RA_HUMAN Interleukin-6 receptor subunit alpha
8j6f B Light chain of Tocilizumab Fab[209 aa] C 100.0
/100.0		 12
/12		 IL6RA_HUMAN Interleukin-6 receptor subunit alpha
8iow D Heavy chain of Sarilumab Fab[207 aa] A 100.0
/100.0		 12
/12		 IL6RA_HUMAN Interleukin-6 receptor subunit alpha
8j6f A Heavy chain of Tocilizumab Fab[211 aa] C 100.0
/100.0		 14
/14		 IL6RA_HUMAN Interleukin-6 receptor subunit alpha
8j6f D IL6RA_HUMAN IL6R-D2 peptide[10 aa] C 100.0
/100.0		 6
/6		 IL6RA_HUMAN Interleukin-6 receptor subunit alpha
8qy4 B IL6RB_MOUSE Interleukin-6 receptor subunit beta[583 aa] E 41.7
/31.7		 12
/12		 I11RA_HUMAN Interleukin-11 receptor subunit alpha
8qy4 D IL6RB_MOUSE Interleukin-6 receptor subunit beta[583 aa] E 0.0
/31.7		 6
/6		 I11RA_HUMAN Interleukin-11 receptor subunit alpha
8qy4 B IL6RB_MOUSE Interleukin-6 receptor subunit beta[583 aa] F 0.0
/31.7		 6
/6		 I11RA_HUMAN Interleukin-11 receptor subunit alpha
8qy4 D IL6RB_MOUSE Interleukin-6 receptor subunit beta[583 aa] F 41.7
/31.7		 12
/12		 I11RA_HUMAN Interleukin-11 receptor subunit alpha
8qy5 A IL6RB_MOUSE Interleukin-6 receptor subunit beta[584 aa] C 100.0
/100.0		 14
/14		 IL6RA_HUMAN Interleukin-6 receptor subunit alpha
8qy5 F IL6RB_MOUSE Interleukin-6 receptor subunit beta[584 aa] C 100.0
/100.0		 8
/8		 IL6RA_HUMAN Interleukin-6 receptor subunit alpha
8qy5 A IL6RB_MOUSE Interleukin-6 receptor subunit beta[584 aa] E 100.0
/100.0		 4
/4		 IL6RA_HUMAN Interleukin-6 receptor subunit alpha
8qy5 F IL6RB_MOUSE Interleukin-6 receptor subunit beta[584 aa] E 100.0
/100.0		 13
/13		 IL6RA_HUMAN Interleukin-6 receptor subunit alpha
8qy6 A IL6RB_MOUSE Interleukin-6 receptor subunit beta[584 aa] C 100.0
/100.0		 13
/13		 IL6RA_HUMAN Interleukin-6 receptor subunit alpha
8qy6 F IL6RB_MOUSE Interleukin-6 receptor subunit beta[584 aa] C 100.0
/100.0		 10
/10		 IL6RA_HUMAN Interleukin-6 receptor subunit alpha
8qy6 A IL6RB_MOUSE Interleukin-6 receptor subunit beta[584 aa] E 100.0
/100.0		 5
/5		 IL6RA_HUMAN Interleukin-6 receptor subunit alpha
8qy6 F IL6RB_MOUSE Interleukin-6 receptor subunit beta[584 aa] E 100.0
/100.0		 11
/11		 IL6RA_HUMAN Interleukin-6 receptor subunit alpha
7dc8 A Switch Ab Fab light chain[212 aa] C 100.0
/99.5		 5
/5		 IL6RA_HUMAN Interleukin-6 receptor subunit alpha
7dc8 D Switch Ab Fab light chain[212 aa] F 100.0
/99.5		 5
/5		 IL6RA_HUMAN Interleukin-6 receptor subunit alpha
7dc8 B Switch Ab Fab heavy chain[209 aa] C 100.0
/99.5		 9
/9		 IL6RA_HUMAN Interleukin-6 receptor subunit alpha
7dc8 E Switch Ab Fab heavy chain[209 aa] F 100.0
/99.5		 8
/8		 IL6RA_HUMAN Interleukin-6 receptor subunit alpha
5fuc E VHH6[110 aa] C 100.0
/99.0		 10
/10		 D6R9R8_HUMAN IL6RA_HUMAN INTERLEUKIN-6 RECEPTOR SUBUNIT ALPHA, INTERLEUKIN-..
5fuc A IL6_HUMAN INTERLEUKIN-6[152 aa] D 100.0
/99.0		 12
/12		 D6R9R8_HUMAN IL6RA_HUMAN INTERLEUKIN-6 RECEPTOR SUBUNIT ALPHA, INTERLEUKIN-..
5fuc F VHH6[124 aa] D 100.0
/99.0		 10
/10		 D6R9R8_HUMAN IL6RA_HUMAN INTERLEUKIN-6 RECEPTOR SUBUNIT ALPHA, INTERLEUKIN-..
8d74 A IL6RB_HUMAN Interleukin-6 receptor subunit beta[392 aa] C 36.4
/34.7		 11
/11		 CNTFR_HUMAN Ciliary neurotrophic factor receptor subunit alpha..
8d7r D IL6RB_HUMAN Interleukin-6 receptor subunit beta[392 aa] B 27.3
/34.7		 11
/11		 CNTFR_HUMAN Ciliary neurotrophic factor receptor subunit alpha..
8d74 B CNTF_HUMAN Ciliary neurotrophic factor[174 aa] C 14.3
/34.7		 14
/14		 CNTFR_HUMAN Ciliary neurotrophic factor receptor subunit alpha..
8d7h B CLCF1_HUMAN Cardiotrophin-like cytokine factor 1[178 aa] A 12.5
/33.9		 16
/17		 CNTFR_HUMAN Ciliary neurotrophic factor receptor subunit alpha..
8d7h E CLCF1_HUMAN Cardiotrophin-like cytokine factor 1[178 aa] D 12.5
/33.9		 16
/17		 CNTFR_HUMAN Ciliary neurotrophic factor receptor subunit alpha..
8d7r A CLCF1_HUMAN Cardiotrophin-like cytokine factor 1[178 aa] B 6.2
/34.7		 16
/17		 CNTFR_HUMAN Ciliary neurotrophic factor receptor subunit alpha..
8d7e B H4H25311P2 antibody Fab fragment light chain[215 a.. A 33.3
/33.9		 9
/9		 CNTFR_HUMAN Ciliary neurotrophic factor receptor subunit alpha..
8d7e C H4H25311P2 antibody Fab fragment heavy chain[217 a.. A 27.3
/33.9		 11
/11		 CNTFR_HUMAN Ciliary neurotrophic factor receptor subunit alpha..
8d7e E REGN8938 antibody Fab fragment heavy chain[214 aa].. A 0.0
/33.9		 3
/11		 CNTFR_HUMAN Ciliary neurotrophic factor receptor subunit alpha..
8qy4 A IL11_HUMAN Interleukin-11[165 aa] E 0.0
/31.7		 10
/15		 I11RA_HUMAN Interleukin-11 receptor subunit alpha
8qy4 C IL11_HUMAN Interleukin-11[165 aa] F 0.0
/31.7		 9
/14		 I11RA_HUMAN Interleukin-11 receptor subunit alpha
1f45 B I12A_HUMAN INTERLEUKIN-12 ALPHA CHAIN[133 aa] A 25.0
/30.4		 20
/21		 I12B_HUMAN INTERLEUKIN-12 BETA CHAIN
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
COMPOUND
468 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
1n26 D NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. 		A 100.0
/100.0		 5
/5		 IL6A_HUMAN IL-6 Receptor alpha chain
1n26 D NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. 		A 100.0
/100.0		 5
/5		 IL6A_HUMAN IL-6 Receptor alpha chain
1n26 E NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. 		A 100.0
/100.0		 3
/3		 IL6A_HUMAN IL-6 Receptor alpha chain
1n26 E NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. 		A 100.0
/100.0		 3
/3		 IL6A_HUMAN IL-6 Receptor alpha chain
1n26 E NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. 		A 100.0
/100.0		 3
/3		 IL6A_HUMAN IL-6 Receptor alpha chain
5fuc G NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. 		C 100.0
/99.0		 3
/3		 D6R9R8_HUMAN IL6RA_HUMAN INTERLEUKIN-6 RECEPTOR SUBUNIT ALPHA, INTERLEUKIN-..
5fuc H NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. 		C 100.0
/99.0		 1
/1		 D6R9R8_HUMAN IL6RA_HUMAN INTERLEUKIN-6 RECEPTOR SUBUNIT ALPHA, INTERLEUKIN-..
5fuc I NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. 		D 100.0
/99.0		 2
/2		 D6R9R8_HUMAN IL6RA_HUMAN INTERLEUKIN-6 RECEPTOR SUBUNIT ALPHA, INTERLEUKIN-..
5fuc J NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. 		D 100.0
/99.0		 2
/2		 D6R9R8_HUMAN IL6RA_HUMAN INTERLEUKIN-6 RECEPTOR SUBUNIT ALPHA, INTERLEUKIN-..
6o4p E NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. 		A 50.0
/35.0		 4
/4		 I11RA_HUMAN Interleukin-11 receptor subunit alpha
8d74 P NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. 		C 0.0
/34.7		 1
/1		 CNTFR_HUMAN Ciliary neurotrophic factor receptor subunit alpha..
8d7r J NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. 		B 0.0
/34.7		 3
/3		 CNTFR_HUMAN Ciliary neurotrophic factor receptor subunit alpha..
8d82 Q NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. 		A 100.0
/100.0		 6
/6		 IL6RA_HUMAN Soluble interleukin-6 receptor subunit alpha
8d82 R NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. 		A 100.0
/100.0		 2
/2		 IL6RA_HUMAN Soluble interleukin-6 receptor subunit alpha
8d82 S NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. 		A 100.0
/100.0		 3
/3		 IL6RA_HUMAN Soluble interleukin-6 receptor subunit alpha
8d82 AA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. 		D 100.0
/100.0		 2
/2		 IL6RA_HUMAN Soluble interleukin-6 receptor subunit alpha
8d82 BA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. 		D 100.0
/100.0		 3
/3		 IL6RA_HUMAN Soluble interleukin-6 receptor subunit alpha
8d82 Z NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. 		D 100.0
/100.0		 6
/6		 IL6RA_HUMAN Soluble interleukin-6 receptor subunit alpha
8iow E NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. 		A 100.0
/100.0		 3
/3		 IL6RA_HUMAN Interleukin-6 receptor subunit alpha
8iow F NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. 		A 100.0
/100.0		 3
/3		 IL6RA_HUMAN Interleukin-6 receptor subunit alpha
8j6f E NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. 		C 100.0
/100.0		 1
/1		 IL6RA_HUMAN Interleukin-6 receptor subunit alpha
1n26 H CYS
CYSTEINE[7 atoms] 		A 100.0
/100.0		 5
/5		 IL6A_HUMAN IL-6 Receptor alpha chain
1n26 H CYS
CYSTEINE[7 atoms] 		A 100.0
/100.0		 5
/5		 IL6A_HUMAN IL-6 Receptor alpha chain
7dc8 H ATP
ADENOSINE-5'-TRIPHOSPHATE[31 atoms] 		C 100.0
/99.5		 1
/1		 IL6RA_HUMAN Interleukin-6 receptor subunit alpha
7dc8 O ATP
ADENOSINE-5'-TRIPHOSPHATE[31 atoms] 		F 100.0
/99.5		 1
/1		 IL6RA_HUMAN Interleukin-6 receptor subunit alpha
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
OTHERPOLY
468 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
1n26 B 2-acetamido-2-deoxy-alpha-D-glucopyranose-(1-4)-al.. A 100.0
/100.0		 9
/9		 IL6A_HUMAN IL-6 Receptor alpha chain
1n26 B 2-acetamido-2-deoxy-alpha-D-glucopyranose-(1-4)-al.. A 100.0
/100.0		 9
/9		 IL6A_HUMAN IL-6 Receptor alpha chain
6o4p C alpha-D-mannopyranose-(1-3)-beta-D-mannopyranose-(.. A 0.0
/35.0		 5
/5		 I11RA_HUMAN Interleukin-11 receptor subunit alpha
1n26 C 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/100.0		 5
/5		 IL6A_HUMAN IL-6 Receptor alpha chain
1n26 C 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/100.0		 5
/5		 IL6A_HUMAN IL-6 Receptor alpha chain
6o4p D 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 0.0
/35.4		 4
/4		 I11RA_HUMAN Interleukin-11 receptor subunit alpha
8d74 F 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. C 40.0
/34.7		 5
/5		 CNTFR_HUMAN Ciliary neurotrophic factor receptor subunit alpha..
8d7e F 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 25.0
/33.9		 4
/4		 CNTFR_HUMAN Ciliary neurotrophic factor receptor subunit alpha..
8d7e H 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 50.0
/33.9		 2
/4		 CNTFR_HUMAN Ciliary neurotrophic factor receptor subunit alpha..
8d7e I 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 0.0
/33.9		 2
/2		 CNTFR_HUMAN Ciliary neurotrophic factor receptor subunit alpha..
8d7h G 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 25.0
/33.9		 4
/4		 CNTFR_HUMAN Ciliary neurotrophic factor receptor subunit alpha..
8d7h I 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 50.0
/33.9		 2
/3		 CNTFR_HUMAN Ciliary neurotrophic factor receptor subunit alpha..
8d7h J 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 0.0
/33.9		 1
/1		 CNTFR_HUMAN Ciliary neurotrophic factor receptor subunit alpha..
8d7h N 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. D 25.0
/33.9		 4
/4		 CNTFR_HUMAN Ciliary neurotrophic factor receptor subunit alpha..
8d7h P 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. D 50.0
/33.9		 2
/3		 CNTFR_HUMAN Ciliary neurotrophic factor receptor subunit alpha..
8d7h Q 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. D 0.0
/33.9		 1
/1		 CNTFR_HUMAN Ciliary neurotrophic factor receptor subunit alpha..
8d7r E 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 33.3
/34.7		 3
/3		 CNTFR_HUMAN Ciliary neurotrophic factor receptor subunit alpha..
8d82 G 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/100.0		 1
/1		 IL6RA_HUMAN Soluble interleukin-6 receptor subunit alpha
8d82 L 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. D 100.0
/100.0		 1
/1		 IL6RA_HUMAN Soluble interleukin-6 receptor subunit alpha
8qy4 I 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. E 40.0
/31.7		 5
/5		 I11RA_HUMAN Interleukin-11 receptor subunit alpha
8qy4 J 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. E 0.0
/31.7		 5
/5		 I11RA_HUMAN Interleukin-11 receptor subunit alpha
8qy4 K 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. F 40.0
/31.7		 5
/5		 I11RA_HUMAN Interleukin-11 receptor subunit alpha
8qy4 L 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. F 0.0
/31.7		 5
/5		 I11RA_HUMAN Interleukin-11 receptor subunit alpha
1f45 C alpha-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-be.. A 0.0
/30.4		 3
/7		 I12B_HUMAN INTERLEUKIN-12 BETA CHAIN
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
HOMO
468 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
1n26 A IL6A_HUMAN IL-6 Receptor alpha chain[299 aa] A 100.0
/100.0		 11
/11		 IL6A_HUMAN IL-6 Receptor alpha chain
1n26 A IL6A_HUMAN IL-6 Receptor alpha chain[299 aa] A 100.0
/100.0		 15
/15		 IL6A_HUMAN IL-6 Receptor alpha chain
8iow B IL6RA_HUMAN Interleukin-6 receptor subunit alpha[14 aa] A 100.0
/100.0		 8
/8		 IL6RA_HUMAN Interleukin-6 receptor subunit alpha
1bqu B IL6RB_HUMAN PROTEIN (GP130)[215 aa] A 33.3
/30.2		 9
/9		 IL6RB_HUMAN PROTEIN (GP130)
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
468 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
1bqu C SO4
SULFATE ION[5 atoms] 		A 0.0
/30.2		 4
/4		 IL6RB_HUMAN PROTEIN (GP130)
1bqu D SO4
SULFATE ION[5 atoms] 		A 0.0
/30.2		 1
/1		 IL6RB_HUMAN PROTEIN (GP130)
1bqu E SO4
SULFATE ION[5 atoms] 		A 100.0
/30.2		 2
/2		 IL6RB_HUMAN PROTEIN (GP130)
1n26 F SO4
SULFATE ION[5 atoms] 		A 100.0
/100.0		 3
/3		 IL6A_HUMAN IL-6 Receptor alpha chain
1n26 F SO4
SULFATE ION[5 atoms] 		A 100.0
/100.0		 3
/3		 IL6A_HUMAN IL-6 Receptor alpha chain
1n26 G SO4
SULFATE ION[5 atoms] 		A 100.0
/100.0		 3
/3		 IL6A_HUMAN IL-6 Receptor alpha chain
1n26 G SO4
SULFATE ION[5 atoms] 		A 100.0
/100.0		 3
/3		 IL6A_HUMAN IL-6 Receptor alpha chain
6o4p F SO4
SULFATE ION[5 atoms] 		A 0.0
/35.0		 4
/4		 I11RA_HUMAN Interleukin-11 receptor subunit alpha
6o4p G SO4
SULFATE ION[5 atoms] 		A 0.0
/35.0		 2
/2		 I11RA_HUMAN Interleukin-11 receptor subunit alpha
6o4p H SO4
SULFATE ION[5 atoms] 		A 0.0
/35.0		 4
/4		 I11RA_HUMAN Interleukin-11 receptor subunit alpha
6o4p I SO4
SULFATE ION[5 atoms] 		A 0.0
/35.0		 1
/3		 I11RA_HUMAN Interleukin-11 receptor subunit alpha
6o4p J SO4
SULFATE ION[5 atoms] 		A 33.3
/35.0		 3
/3		 I11RA_HUMAN Interleukin-11 receptor subunit alpha
6o4p K SO4
SULFATE ION[5 atoms] 		A 0.0
/35.0		 2
/2		 I11RA_HUMAN Interleukin-11 receptor subunit alpha
6o4p L SO4
SULFATE ION[5 atoms] 		B 0.0
/35.4		 2
/2		 I11RA_HUMAN Interleukin-11 receptor subunit alpha
6o4p M SO4
SULFATE ION[5 atoms] 		B 0.0
/35.4		 3
/3		 I11RA_HUMAN Interleukin-11 receptor subunit alpha
6o4p N SO4
SULFATE ION[5 atoms] 		B 0.0
/35.4		 1
/1		 I11RA_HUMAN Interleukin-11 receptor subunit alpha
6o4p O SO4
SULFATE ION[5 atoms] 		B 0.0
/35.4		 1
/1		 I11RA_HUMAN Interleukin-11 receptor subunit alpha
6o4p P SO4
SULFATE ION[5 atoms] 		B 0.0
/35.4		 1
/1		 I11RA_HUMAN Interleukin-11 receptor subunit alpha
7dc8 K SO4
SULFATE ION[5 atoms] 		C 100.0
/99.5		 3
/3		 IL6RA_HUMAN Interleukin-6 receptor subunit alpha
7dc8 L SO4
SULFATE ION[5 atoms] 		C 100.0
/99.5		 3
/3		 IL6RA_HUMAN Interleukin-6 receptor subunit alpha
7dc8 Q SO4
SULFATE ION[5 atoms] 		F 100.0
/99.5		 4
/4		 IL6RA_HUMAN Interleukin-6 receptor subunit alpha
7dc8 R SO4
SULFATE ION[5 atoms] 		F 100.0
/99.5		 2
/2		 IL6RA_HUMAN Interleukin-6 receptor subunit alpha
1bqu F GOL
GLYCEROL[6 atoms] 		A 50.0
/30.2		 6
/6		 IL6RB_HUMAN PROTEIN (GP130)
1bqu G GOL
GLYCEROL[6 atoms] 		A 25.0
/30.2		 8
/8		 IL6RB_HUMAN PROTEIN (GP130)
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.