#WARNING:no index is registered index 'YP_009725309.1' in 'http://www.uniprot.org/uniprot/'

[Full Bars]
[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]
[Back to HOMCOS]


[help] 		seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
19863 527 10 YP_009725309.1()
QUERYSEQ 
AENVTGLFKDCSKVITGLHPTQAPTHLSVDTKFKTEGLCVDIPGIPKDMTYRRLISMMGFKMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVAVPTGYVDTPNNTDFSRVSAKPPPGDQFKHLI
PLMYKGLPWNVVRIKIVQMLSDTLKNLSDRVVFVLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNPFMIDVQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEYPIIG
DELKINAACRKVQHMVVKAALLADKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDKAYKIEELFYSYATHSDKFTDGVCLFWNCNVDRYPANSIVCRFDTRVLSNLNLPGCDGGSLYVNKHAFHTPAFDKSAFVNLKQLPFFYYSDS
PCESHGKQVVSDIDYVPLKSATCITRCNLGGAVCRHHANEYRLYLDAYNMMISAGFSLWVYKQFDTYNLWNTFTRLQ
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [YP_009725309.1()]

527
region name description
1-10 DISORDER predicted by DISOPRED (1-5,8-8,10-10)

MONOMER
527
pdb_id a1 identity[%]2 description
5c8u D 94.9 R1AB_CVHSA Guanine-N7 methyltransferase 
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HETERO
527 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
5c8u[6] C R1AB_CVHSA Non-structural protein 10[133 aa] D 97.8
/94.9		 45
/45		 R1AB_CVHSA Guanine-N7 methyltransferase
5nfy[4] E Q1T6X8_CVHSA Polyprotein 1ab[132 aa] A 98.0
/94.7		 50
/50		 Q1T6X8_CVHSA Polyprotein 1ab
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
COMPOUND
527 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
5c8s[2] L G3A
GUANOSINE-P3-ADENOSINE-5',5'-TRIPHOSPHATE[50 atoms.. 		B 100.0
/94.9		 16
/16		 R1AB_CVHSA Guanine-N7 methyltransferase
5c8s[2] K SAH
S-ADENOSYL-L-HOMOCYSTEINE[26 atoms] 		B 100.0
/94.9		 14
/14		 R1AB_CVHSA Guanine-N7 methyltransferase
5c8t[2] R SAM
S-ADENOSYLMETHIONINE[27 atoms] 		D 100.0
/94.9		 15
/15		 R1AB_CVHSA Guanine-N7 methyltransferase
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
METAL
527 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
5nfy[4] P ZN
ZINC ION[1 atoms] 		B 100.0
/94.7		 5
/5		 Q1T6X8_CVHSA Polyprotein 1ab
5c8t[4] P ZN
ZINC ION[1 atoms] 		D 100.0
/94.9		 5
/5		 R1AB_CVHSA Guanine-N7 methyltransferase
5c8t[4] N ZN
ZINC ION[1 atoms] 		D 100.0
/94.9		 4
/4		 R1AB_CVHSA Guanine-N7 methyltransferase
5c8t[4] O ZN
ZINC ION[1 atoms] 		D 100.0
/94.9		 4
/4		 R1AB_CVHSA Guanine-N7 methyltransferase
5c8s[2] O ZN
ZINC ION[1 atoms] 		D 100.0
/94.9		 4
/4		 R1AB_CVHSA Guanine-N7 methyltransferase
5nfy[4] V ZN
ZINC ION[1 atoms] 		D 100.0
/94.7		 4
/4		 Q1T6X8_CVHSA Polyprotein 1ab
5nfy[4] U ZN
ZINC ION[1 atoms] 		D 100.0
/94.7		 6
/6		 Q1T6X8_CVHSA Polyprotein 1ab
5c8s[2] P ZN
ZINC ION[1 atoms] 		D 100.0
/94.9		 4
/4		 R1AB_CVHSA Guanine-N7 methyltransferase
5c8s[2] I ZN
ZINC ION[1 atoms] 		B 100.0
/94.9		 4
/4		 R1AB_CVHSA Guanine-N7 methyltransferase
5c8t[4] Q MG
MAGNESIUM ION[1 atoms] 		D 100.0
/94.9		 3
/3		 R1AB_CVHSA Guanine-N7 methyltransferase
5c8s[2] J MG
MAGNESIUM ION[1 atoms] 		B 100.0
/94.9		 3
/3		 R1AB_CVHSA Guanine-N7 methyltransferase
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
527 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
5nfy[2] L PEG
DI(HYDROXYETHYL)ETHER[7 atoms] 		A 100.0
/94.7		 2
/2		 Q1T6X8_CVHSA Polyprotein 1ab
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.