[Multiple Alignment(many alignments)] [Alignment Bar(many alignments)] [show plain BLAST file]
BLASTP 2.11.0+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: unitmol_20210609.fasta
           599,558 sequences; 163,607,441 total letters



Query= YP_009725309.1 3'-to-5' exonuclease [Severe acute respiratory
syndrome coronavirus 2]

Length=527
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

5c8s_B B Guanine-N7 methyltransferase                                 1041    0.0  
5c8t_B B Guanine-N7 methyltransferase                                 1041    0.0  
5c8u_D D Guanine-N7 methyltransferase                                 1041    0.0  
5c8u_B B Guanine-N7 methyltransferase                                 1041    0.0  
5c8s_D D Guanine-N7 methyltransferase                                 1041    0.0  
5c8t_D D Guanine-N7 methyltransferase                                 1041    0.0  
5nfy_B B Polyprotein 1ab                                              1039    0.0  
5nfy_C C Polyprotein 1ab                                              1039    0.0  
5nfy_D D Polyprotein 1ab                                              1039    0.0  
5nfy_A A Polyprotein 1ab                                              1035    0.0  
7mc5_A A Proofreading exoribonuclease                                 605     0.0  
7diy_B B nsp14-ExoN protein                                           604     0.0  
7mc6_A A Proofreading exoribonuclease                                 601     0.0  
2j69_A A BACTERIAL DYNAMIN-LIKE PROTEIN                               33.5    4.1  
2j69_C C BACTERIAL DYNAMIN-LIKE PROTEIN                               33.5    4.1  
2j69_B B BACTERIAL DYNAMIN-LIKE PROTEIN                               33.5    4.1  
2j69_D D BACTERIAL DYNAMIN-LIKE PROTEIN                               33.5    4.1  
2j68_A A BACTERIAL DYNAMIN-LIKE PROTEIN                               33.5    4.4  
2w6d_B B DYNAMIN FAMILY PROTEIN                                       33.5    4.4  
2w6d_A A DYNAMIN FAMILY PROTEIN                                       33.5    4.4  


>5c8s_B B Guanine-N7 methyltransferase
Length=527 Score = 1041 bits (2693), Expect = 0.0, Method: Compositional matrix adjust. Identities = 488/525 (93%), Positives = 507/525 (97%), Gaps = 0/525 (0%) Query 1 AENVTGLFKDCSKVITGLHPTQAPTHLSVDTKFKTEGLCVDIPGIPKDMTYRRLISMMGF 60 AENVTGLFKDCSK+ITGLHPTQAPTHLSVD KFKTEGLCVDIPGIPKDMTYRRLISMMGF Sbjct 1 AENVTGLFKDCSKIITGLHPTQAPTHLSVDIKFKTEGLCVDIPGIPKDMTYRRLISMMGF 60 Query 61 KMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVAV 120 KMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATR+AVGTNLPLQLGFSTGVNLVAV Sbjct 61 KMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATRDAVGTNLPLQLGFSTGVNLVAV 120 Query 121 PTGYVDTPNNTDFSRVSAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSDR 180 PTGYVDT NNT+F+RV+AKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLK LSDR Sbjct 121 PTGYVDTENNTEFTRVNAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKGLSDR 180 Query 181 VVFVLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNPF 240 VVFVLWAHGFELTSMKYFVKIGPERTCCLCD+RATCFST+SDTYACW+HS+GFDYVYNPF Sbjct 181 VVFVLWAHGFELTSMKYFVKIGPERTCCLCDKRATCFSTSSDTYACWNHSVGFDYVYNPF 240 Query 241 MIDVQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEYPIIG 300 MIDVQQWGFTGNLQSNHD +CQVHGNAHVASCDAIMTRCLAVHECFVKRVDW++EYPIIG Sbjct 241 MIDVQQWGFTGNLQSNHDQHCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWSVEYPIIG 300 Query 301 DELKINAACRKVQHMVVKAALLADKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDKA 360 DEL++N+ACRKVQHMVVK+ALLADKFPVLHDIGNPKAIKCVPQA+VEWKFYDAQPCSDKA Sbjct 301 DELRVNSACRKVQHMVVKSALLADKFPVLHDIGNPKAIKCVPQAEVEWKFYDAQPCSDKA 360 Query 361 YKIEELFYSYATHSDKFTDGVCLFWNCNVDRYPANSIVCRFDTRVLSNLNLPGCDGGSLY 420 YKIEELFYSYATH DKFTDGVCLFWNCNVDRYPAN+IVCRFDTRVLSNLNLPGCDGGSLY Sbjct 361 YKIEELFYSYATHHDKFTDGVCLFWNCNVDRYPANAIVCRFDTRVLSNLNLPGCDGGSLY 420 Query 421 VNKHAFHTPAFDKSAFVNLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLG 480 VNKHAFHTPAFDKSAF NLKQLPFFYYSDSPCE YVPLKSATCITRCNLG Sbjct 421 VNKHAFHTPAFDKSAFTNLKQLPFFYYSDSPCEXXXXXXXXXXXYVPLKSATCITRCNLG 480 Query 481 GAVCRHHANEYRLYLDAYNMMISAGFSLWVYKQFDTYNLWNTFTR 525 GAVCRHHANEYR YLDAYNMMISAGFSLW+YKQFDTYNLWNTFTR Sbjct 481 GAVCRHHANEYRQYLDAYNMMISAGFSLWIYKQFDTYNLWNTFTR 525
>5c8t_B B Guanine-N7 methyltransferase
Length=528 Score = 1041 bits (2693), Expect = 0.0, Method: Compositional matrix adjust. Identities = 488/525 (93%), Positives = 507/525 (97%), Gaps = 0/525 (0%) Query 1 AENVTGLFKDCSKVITGLHPTQAPTHLSVDTKFKTEGLCVDIPGIPKDMTYRRLISMMGF 60 AENVTGLFKDCSK+ITGLHPTQAPTHLSVD KFKTEGLCVDIPGIPKDMTYRRLISMMGF Sbjct 2 AENVTGLFKDCSKIITGLHPTQAPTHLSVDIKFKTEGLCVDIPGIPKDMTYRRLISMMGF 61 Query 61 KMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVAV 120 KMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATR+AVGTNLPLQLGFSTGVNLVAV Sbjct 62 KMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATRDAVGTNLPLQLGFSTGVNLVAV 121 Query 121 PTGYVDTPNNTDFSRVSAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSDR 180 PTGYVDT NNT+F+RV+AKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLK LSDR Sbjct 122 PTGYVDTENNTEFTRVNAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKGLSDR 181 Query 181 VVFVLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNPF 240 VVFVLWAHGFELTSMKYFVKIGPERTCCLCD+RATCFST+SDTYACW+HS+GFDYVYNPF Sbjct 182 VVFVLWAHGFELTSMKYFVKIGPERTCCLCDKRATCFSTSSDTYACWNHSVGFDYVYNPF 241 Query 241 MIDVQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEYPIIG 300 MIDVQQWGFTGNLQSNHD +CQVHGNAHVASCDAIMTRCLAVHECFVKRVDW++EYPIIG Sbjct 242 MIDVQQWGFTGNLQSNHDQHCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWSVEYPIIG 301 Query 301 DELKINAACRKVQHMVVKAALLADKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDKA 360 DEL++N+ACRKVQHMVVK+ALLADKFPVLHDIGNPKAIKCVPQA+VEWKFYDAQPCSDKA Sbjct 302 DELRVNSACRKVQHMVVKSALLADKFPVLHDIGNPKAIKCVPQAEVEWKFYDAQPCSDKA 361 Query 361 YKIEELFYSYATHSDKFTDGVCLFWNCNVDRYPANSIVCRFDTRVLSNLNLPGCDGGSLY 420 YKIEELFYSYATH DKFTDGVCLFWNCNVDRYPAN+IVCRFDTRVLSNLNLPGCDGGSLY Sbjct 362 YKIEELFYSYATHHDKFTDGVCLFWNCNVDRYPANAIVCRFDTRVLSNLNLPGCDGGSLY 421 Query 421 VNKHAFHTPAFDKSAFVNLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLG 480 VNKHAFHTPAFDKSAF NLKQLPFFYYSDSPCE YVPLKSATCITRCNLG Sbjct 422 VNKHAFHTPAFDKSAFTNLKQLPFFYYSDSPCEXXXXXXXXXXXYVPLKSATCITRCNLG 481 Query 481 GAVCRHHANEYRLYLDAYNMMISAGFSLWVYKQFDTYNLWNTFTR 525 GAVCRHHANEYR YLDAYNMMISAGFSLW+YKQFDTYNLWNTFTR Sbjct 482 GAVCRHHANEYRQYLDAYNMMISAGFSLWIYKQFDTYNLWNTFTR 526
>5c8u_D D Guanine-N7 methyltransferase
Length=528 Score = 1041 bits (2693), Expect = 0.0, Method: Compositional matrix adjust. Identities = 488/525 (93%), Positives = 507/525 (97%), Gaps = 0/525 (0%) Query 1 AENVTGLFKDCSKVITGLHPTQAPTHLSVDTKFKTEGLCVDIPGIPKDMTYRRLISMMGF 60 AENVTGLFKDCSK+ITGLHPTQAPTHLSVD KFKTEGLCVDIPGIPKDMTYRRLISMMGF Sbjct 2 AENVTGLFKDCSKIITGLHPTQAPTHLSVDIKFKTEGLCVDIPGIPKDMTYRRLISMMGF 61 Query 61 KMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVAV 120 KMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATR+AVGTNLPLQLGFSTGVNLVAV Sbjct 62 KMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATRDAVGTNLPLQLGFSTGVNLVAV 121 Query 121 PTGYVDTPNNTDFSRVSAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSDR 180 PTGYVDT NNT+F+RV+AKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLK LSDR Sbjct 122 PTGYVDTENNTEFTRVNAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKGLSDR 181 Query 181 VVFVLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNPF 240 VVFVLWAHGFELTSMKYFVKIGPERTCCLCD+RATCFST+SDTYACW+HS+GFDYVYNPF Sbjct 182 VVFVLWAHGFELTSMKYFVKIGPERTCCLCDKRATCFSTSSDTYACWNHSVGFDYVYNPF 241 Query 241 MIDVQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEYPIIG 300 MIDVQQWGFTGNLQSNHD +CQVHGNAHVASCDAIMTRCLAVHECFVKRVDW++EYPIIG Sbjct 242 MIDVQQWGFTGNLQSNHDQHCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWSVEYPIIG 301 Query 301 DELKINAACRKVQHMVVKAALLADKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDKA 360 DEL++N+ACRKVQHMVVK+ALLADKFPVLHDIGNPKAIKCVPQA+VEWKFYDAQPCSDKA Sbjct 302 DELRVNSACRKVQHMVVKSALLADKFPVLHDIGNPKAIKCVPQAEVEWKFYDAQPCSDKA 361 Query 361 YKIEELFYSYATHSDKFTDGVCLFWNCNVDRYPANSIVCRFDTRVLSNLNLPGCDGGSLY 420 YKIEELFYSYATH DKFTDGVCLFWNCNVDRYPAN+IVCRFDTRVLSNLNLPGCDGGSLY Sbjct 362 YKIEELFYSYATHHDKFTDGVCLFWNCNVDRYPANAIVCRFDTRVLSNLNLPGCDGGSLY 421 Query 421 VNKHAFHTPAFDKSAFVNLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLG 480 VNKHAFHTPAFDKSAF NLKQLPFFYYSDSPCE YVPLKSATCITRCNLG Sbjct 422 VNKHAFHTPAFDKSAFTNLKQLPFFYYSDSPCEXXXXXXXXXXXYVPLKSATCITRCNLG 481 Query 481 GAVCRHHANEYRLYLDAYNMMISAGFSLWVYKQFDTYNLWNTFTR 525 GAVCRHHANEYR YLDAYNMMISAGFSLW+YKQFDTYNLWNTFTR Sbjct 482 GAVCRHHANEYRQYLDAYNMMISAGFSLWIYKQFDTYNLWNTFTR 526
>5c8u_B B Guanine-N7 methyltransferase
Length=528 Score = 1041 bits (2693), Expect = 0.0, Method: Compositional matrix adjust. Identities = 488/525 (93%), Positives = 507/525 (97%), Gaps = 0/525 (0%) Query 1 AENVTGLFKDCSKVITGLHPTQAPTHLSVDTKFKTEGLCVDIPGIPKDMTYRRLISMMGF 60 AENVTGLFKDCSK+ITGLHPTQAPTHLSVD KFKTEGLCVDIPGIPKDMTYRRLISMMGF Sbjct 2 AENVTGLFKDCSKIITGLHPTQAPTHLSVDIKFKTEGLCVDIPGIPKDMTYRRLISMMGF 61 Query 61 KMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVAV 120 KMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATR+AVGTNLPLQLGFSTGVNLVAV Sbjct 62 KMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATRDAVGTNLPLQLGFSTGVNLVAV 121 Query 121 PTGYVDTPNNTDFSRVSAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSDR 180 PTGYVDT NNT+F+RV+AKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLK LSDR Sbjct 122 PTGYVDTENNTEFTRVNAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKGLSDR 181 Query 181 VVFVLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNPF 240 VVFVLWAHGFELTSMKYFVKIGPERTCCLCD+RATCFST+SDTYACW+HS+GFDYVYNPF Sbjct 182 VVFVLWAHGFELTSMKYFVKIGPERTCCLCDKRATCFSTSSDTYACWNHSVGFDYVYNPF 241 Query 241 MIDVQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEYPIIG 300 MIDVQQWGFTGNLQSNHD +CQVHGNAHVASCDAIMTRCLAVHECFVKRVDW++EYPIIG Sbjct 242 MIDVQQWGFTGNLQSNHDQHCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWSVEYPIIG 301 Query 301 DELKINAACRKVQHMVVKAALLADKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDKA 360 DEL++N+ACRKVQHMVVK+ALLADKFPVLHDIGNPKAIKCVPQA+VEWKFYDAQPCSDKA Sbjct 302 DELRVNSACRKVQHMVVKSALLADKFPVLHDIGNPKAIKCVPQAEVEWKFYDAQPCSDKA 361 Query 361 YKIEELFYSYATHSDKFTDGVCLFWNCNVDRYPANSIVCRFDTRVLSNLNLPGCDGGSLY 420 YKIEELFYSYATH DKFTDGVCLFWNCNVDRYPAN+IVCRFDTRVLSNLNLPGCDGGSLY Sbjct 362 YKIEELFYSYATHHDKFTDGVCLFWNCNVDRYPANAIVCRFDTRVLSNLNLPGCDGGSLY 421 Query 421 VNKHAFHTPAFDKSAFVNLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLG 480 VNKHAFHTPAFDKSAF NLKQLPFFYYSDSPCE YVPLKSATCITRCNLG Sbjct 422 VNKHAFHTPAFDKSAFTNLKQLPFFYYSDSPCEXXXXXXXXXXXYVPLKSATCITRCNLG 481 Query 481 GAVCRHHANEYRLYLDAYNMMISAGFSLWVYKQFDTYNLWNTFTR 525 GAVCRHHANEYR YLDAYNMMISAGFSLW+YKQFDTYNLWNTFTR Sbjct 482 GAVCRHHANEYRQYLDAYNMMISAGFSLWIYKQFDTYNLWNTFTR 526
>5c8s_D D Guanine-N7 methyltransferase
Length=527 Score = 1041 bits (2693), Expect = 0.0, Method: Compositional matrix adjust. Identities = 488/525 (93%), Positives = 507/525 (97%), Gaps = 0/525 (0%) Query 1 AENVTGLFKDCSKVITGLHPTQAPTHLSVDTKFKTEGLCVDIPGIPKDMTYRRLISMMGF 60 AENVTGLFKDCSK+ITGLHPTQAPTHLSVD KFKTEGLCVDIPGIPKDMTYRRLISMMGF Sbjct 1 AENVTGLFKDCSKIITGLHPTQAPTHLSVDIKFKTEGLCVDIPGIPKDMTYRRLISMMGF 60 Query 61 KMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVAV 120 KMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATR+AVGTNLPLQLGFSTGVNLVAV Sbjct 61 KMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATRDAVGTNLPLQLGFSTGVNLVAV 120 Query 121 PTGYVDTPNNTDFSRVSAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSDR 180 PTGYVDT NNT+F+RV+AKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLK LSDR Sbjct 121 PTGYVDTENNTEFTRVNAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKGLSDR 180 Query 181 VVFVLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNPF 240 VVFVLWAHGFELTSMKYFVKIGPERTCCLCD+RATCFST+SDTYACW+HS+GFDYVYNPF Sbjct 181 VVFVLWAHGFELTSMKYFVKIGPERTCCLCDKRATCFSTSSDTYACWNHSVGFDYVYNPF 240 Query 241 MIDVQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEYPIIG 300 MIDVQQWGFTGNLQSNHD +CQVHGNAHVASCDAIMTRCLAVHECFVKRVDW++EYPIIG Sbjct 241 MIDVQQWGFTGNLQSNHDQHCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWSVEYPIIG 300 Query 301 DELKINAACRKVQHMVVKAALLADKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDKA 360 DEL++N+ACRKVQHMVVK+ALLADKFPVLHDIGNPKAIKCVPQA+VEWKFYDAQPCSDKA Sbjct 301 DELRVNSACRKVQHMVVKSALLADKFPVLHDIGNPKAIKCVPQAEVEWKFYDAQPCSDKA 360 Query 361 YKIEELFYSYATHSDKFTDGVCLFWNCNVDRYPANSIVCRFDTRVLSNLNLPGCDGGSLY 420 YKIEELFYSYATH DKFTDGVCLFWNCNVDRYPAN+IVCRFDTRVLSNLNLPGCDGGSLY Sbjct 361 YKIEELFYSYATHHDKFTDGVCLFWNCNVDRYPANAIVCRFDTRVLSNLNLPGCDGGSLY 420 Query 421 VNKHAFHTPAFDKSAFVNLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLG 480 VNKHAFHTPAFDKSAF NLKQLPFFYYSDSPCE YVPLKSATCITRCNLG Sbjct 421 VNKHAFHTPAFDKSAFTNLKQLPFFYYSDSPCEXXXXXXXXXXXYVPLKSATCITRCNLG 480 Query 481 GAVCRHHANEYRLYLDAYNMMISAGFSLWVYKQFDTYNLWNTFTR 525 GAVCRHHANEYR YLDAYNMMISAGFSLW+YKQFDTYNLWNTFTR Sbjct 481 GAVCRHHANEYRQYLDAYNMMISAGFSLWIYKQFDTYNLWNTFTR 525
>5c8t_D D Guanine-N7 methyltransferase
Length=528 Score = 1041 bits (2693), Expect = 0.0, Method: Compositional matrix adjust. Identities = 488/525 (93%), Positives = 507/525 (97%), Gaps = 0/525 (0%) Query 1 AENVTGLFKDCSKVITGLHPTQAPTHLSVDTKFKTEGLCVDIPGIPKDMTYRRLISMMGF 60 AENVTGLFKDCSK+ITGLHPTQAPTHLSVD KFKTEGLCVDIPGIPKDMTYRRLISMMGF Sbjct 2 AENVTGLFKDCSKIITGLHPTQAPTHLSVDIKFKTEGLCVDIPGIPKDMTYRRLISMMGF 61 Query 61 KMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVAV 120 KMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATR+AVGTNLPLQLGFSTGVNLVAV Sbjct 62 KMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATRDAVGTNLPLQLGFSTGVNLVAV 121 Query 121 PTGYVDTPNNTDFSRVSAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSDR 180 PTGYVDT NNT+F+RV+AKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLK LSDR Sbjct 122 PTGYVDTENNTEFTRVNAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKGLSDR 181 Query 181 VVFVLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNPF 240 VVFVLWAHGFELTSMKYFVKIGPERTCCLCD+RATCFST+SDTYACW+HS+GFDYVYNPF Sbjct 182 VVFVLWAHGFELTSMKYFVKIGPERTCCLCDKRATCFSTSSDTYACWNHSVGFDYVYNPF 241 Query 241 MIDVQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEYPIIG 300 MIDVQQWGFTGNLQSNHD +CQVHGNAHVASCDAIMTRCLAVHECFVKRVDW++EYPIIG Sbjct 242 MIDVQQWGFTGNLQSNHDQHCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWSVEYPIIG 301 Query 301 DELKINAACRKVQHMVVKAALLADKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDKA 360 DEL++N+ACRKVQHMVVK+ALLADKFPVLHDIGNPKAIKCVPQA+VEWKFYDAQPCSDKA Sbjct 302 DELRVNSACRKVQHMVVKSALLADKFPVLHDIGNPKAIKCVPQAEVEWKFYDAQPCSDKA 361 Query 361 YKIEELFYSYATHSDKFTDGVCLFWNCNVDRYPANSIVCRFDTRVLSNLNLPGCDGGSLY 420 YKIEELFYSYATH DKFTDGVCLFWNCNVDRYPAN+IVCRFDTRVLSNLNLPGCDGGSLY Sbjct 362 YKIEELFYSYATHHDKFTDGVCLFWNCNVDRYPANAIVCRFDTRVLSNLNLPGCDGGSLY 421 Query 421 VNKHAFHTPAFDKSAFVNLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLG 480 VNKHAFHTPAFDKSAF NLKQLPFFYYSDSPCE YVPLKSATCITRCNLG Sbjct 422 VNKHAFHTPAFDKSAFTNLKQLPFFYYSDSPCEXXXXXXXXXXXYVPLKSATCITRCNLG 481 Query 481 GAVCRHHANEYRLYLDAYNMMISAGFSLWVYKQFDTYNLWNTFTR 525 GAVCRHHANEYR YLDAYNMMISAGFSLW+YKQFDTYNLWNTFTR Sbjct 482 GAVCRHHANEYRQYLDAYNMMISAGFSLWIYKQFDTYNLWNTFTR 526
>5nfy_B B Polyprotein 1ab
Length=534 Score = 1039 bits (2687), Expect = 0.0, Method: Compositional matrix adjust. Identities = 487/525 (93%), Positives = 506/525 (96%), Gaps = 0/525 (0%) Query 1 AENVTGLFKDCSKVITGLHPTQAPTHLSVDTKFKTEGLCVDIPGIPKDMTYRRLISMMGF 60 AENVTGLFKDCSK+ITGLHPTQAPTHLSVD KFKTEGLCVDIPGIPKDMTYRRLISMMGF Sbjct 8 AENVTGLFKDCSKIITGLHPTQAPTHLSVDIKFKTEGLCVDIPGIPKDMTYRRLISMMGF 67 Query 61 KMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVAV 120 KMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATR+AVGTNLPLQLGFSTGVNLVAV Sbjct 68 KMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATRDAVGTNLPLQLGFSTGVNLVAV 127 Query 121 PTGYVDTPNNTDFSRVSAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSDR 180 PTGYVDT NNT+F+RV+AKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLK LSDR Sbjct 128 PTGYVDTENNTEFTRVNAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKGLSDR 187 Query 181 VVFVLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNPF 240 VVFVLWAHGFELTSMKYFVKIGPERTCCLCD+RATCFST+SDTYACW+HS+GFDYVYNPF Sbjct 188 VVFVLWAHGFELTSMKYFVKIGPERTCCLCDKRATCFSTSSDTYACWNHSVGFDYVYNPF 247 Query 241 MIDVQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEYPIIG 300 MIDVQQWGFTGNLQSNHD +CQVHGNAHVASCDAIMTRCLAVHECFVKRVDW++EYPIIG Sbjct 248 MIDVQQWGFTGNLQSNHDQHCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWSVEYPIIG 307 Query 301 DELKINAACRKVQHMVVKAALLADKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDKA 360 DEL++N+ACRKVQHMVVK+ALLADKFPVLHDIGNPKAIKCVPQA+VEWKFYDAQPCSDKA Sbjct 308 DELRVNSACRKVQHMVVKSALLADKFPVLHDIGNPKAIKCVPQAEVEWKFYDAQPCSDKA 367 Query 361 YKIEELFYSYATHSDKFTDGVCLFWNCNVDRYPANSIVCRFDTRVLSNLNLPGCDGGSLY 420 YKIEELFYSYA H DKFTDGVCLFWNCNVDRYPAN+IVCRFDTRVLSNLNLPGCDGGSLY Sbjct 368 YKIEELFYSYAIHHDKFTDGVCLFWNCNVDRYPANAIVCRFDTRVLSNLNLPGCDGGSLY 427 Query 421 VNKHAFHTPAFDKSAFVNLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLG 480 VNKHAFHTPAFDKSAF NLKQLPFFYYSDSPCE YVPLKSATCITRCNLG Sbjct 428 VNKHAFHTPAFDKSAFTNLKQLPFFYYSDSPCEXXXXXXXXXXXYVPLKSATCITRCNLG 487 Query 481 GAVCRHHANEYRLYLDAYNMMISAGFSLWVYKQFDTYNLWNTFTR 525 GAVCRHHANEYR YLDAYNMMISAGFSLW+YKQFDTYNLWNTFTR Sbjct 488 GAVCRHHANEYRQYLDAYNMMISAGFSLWIYKQFDTYNLWNTFTR 532
>5nfy_C C Polyprotein 1ab
Length=534 Score = 1039 bits (2687), Expect = 0.0, Method: Compositional matrix adjust. Identities = 487/525 (93%), Positives = 506/525 (96%), Gaps = 0/525 (0%) Query 1 AENVTGLFKDCSKVITGLHPTQAPTHLSVDTKFKTEGLCVDIPGIPKDMTYRRLISMMGF 60 AENVTGLFKDCSK+ITGLHPTQAPTHLSVD KFKTEGLCVDIPGIPKDMTYRRLISMMGF Sbjct 8 AENVTGLFKDCSKIITGLHPTQAPTHLSVDIKFKTEGLCVDIPGIPKDMTYRRLISMMGF 67 Query 61 KMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVAV 120 KMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATR+AVGTNLPLQLGFSTGVNLVAV Sbjct 68 KMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATRDAVGTNLPLQLGFSTGVNLVAV 127 Query 121 PTGYVDTPNNTDFSRVSAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSDR 180 PTGYVDT NNT+F+RV+AKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLK LSDR Sbjct 128 PTGYVDTENNTEFTRVNAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKGLSDR 187 Query 181 VVFVLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNPF 240 VVFVLWAHGFELTSMKYFVKIGPERTCCLCD+RATCFST+SDTYACW+HS+GFDYVYNPF Sbjct 188 VVFVLWAHGFELTSMKYFVKIGPERTCCLCDKRATCFSTSSDTYACWNHSVGFDYVYNPF 247 Query 241 MIDVQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEYPIIG 300 MIDVQQWGFTGNLQSNHD +CQVHGNAHVASCDAIMTRCLAVHECFVKRVDW++EYPIIG Sbjct 248 MIDVQQWGFTGNLQSNHDQHCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWSVEYPIIG 307 Query 301 DELKINAACRKVQHMVVKAALLADKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDKA 360 DEL++N+ACRKVQHMVVK+ALLADKFPVLHDIGNPKAIKCVPQA+VEWKFYDAQPCSDKA Sbjct 308 DELRVNSACRKVQHMVVKSALLADKFPVLHDIGNPKAIKCVPQAEVEWKFYDAQPCSDKA 367 Query 361 YKIEELFYSYATHSDKFTDGVCLFWNCNVDRYPANSIVCRFDTRVLSNLNLPGCDGGSLY 420 YKIEELFYSYA H DKFTDGVCLFWNCNVDRYPAN+IVCRFDTRVLSNLNLPGCDGGSLY Sbjct 368 YKIEELFYSYAIHHDKFTDGVCLFWNCNVDRYPANAIVCRFDTRVLSNLNLPGCDGGSLY 427 Query 421 VNKHAFHTPAFDKSAFVNLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLG 480 VNKHAFHTPAFDKSAF NLKQLPFFYYSDSPCE YVPLKSATCITRCNLG Sbjct 428 VNKHAFHTPAFDKSAFTNLKQLPFFYYSDSPCEXXXXXXXXXXXYVPLKSATCITRCNLG 487 Query 481 GAVCRHHANEYRLYLDAYNMMISAGFSLWVYKQFDTYNLWNTFTR 525 GAVCRHHANEYR YLDAYNMMISAGFSLW+YKQFDTYNLWNTFTR Sbjct 488 GAVCRHHANEYRQYLDAYNMMISAGFSLWIYKQFDTYNLWNTFTR 532
>5nfy_D D Polyprotein 1ab
Length=534 Score = 1039 bits (2687), Expect = 0.0, Method: Compositional matrix adjust. Identities = 487/525 (93%), Positives = 506/525 (96%), Gaps = 0/525 (0%) Query 1 AENVTGLFKDCSKVITGLHPTQAPTHLSVDTKFKTEGLCVDIPGIPKDMTYRRLISMMGF 60 AENVTGLFKDCSK+ITGLHPTQAPTHLSVD KFKTEGLCVDIPGIPKDMTYRRLISMMGF Sbjct 8 AENVTGLFKDCSKIITGLHPTQAPTHLSVDIKFKTEGLCVDIPGIPKDMTYRRLISMMGF 67 Query 61 KMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVAV 120 KMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATR+AVGTNLPLQLGFSTGVNLVAV Sbjct 68 KMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATRDAVGTNLPLQLGFSTGVNLVAV 127 Query 121 PTGYVDTPNNTDFSRVSAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSDR 180 PTGYVDT NNT+F+RV+AKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLK LSDR Sbjct 128 PTGYVDTENNTEFTRVNAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKGLSDR 187 Query 181 VVFVLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNPF 240 VVFVLWAHGFELTSMKYFVKIGPERTCCLCD+RATCFST+SDTYACW+HS+GFDYVYNPF Sbjct 188 VVFVLWAHGFELTSMKYFVKIGPERTCCLCDKRATCFSTSSDTYACWNHSVGFDYVYNPF 247 Query 241 MIDVQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEYPIIG 300 MIDVQQWGFTGNLQSNHD +CQVHGNAHVASCDAIMTRCLAVHECFVKRVDW++EYPIIG Sbjct 248 MIDVQQWGFTGNLQSNHDQHCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWSVEYPIIG 307 Query 301 DELKINAACRKVQHMVVKAALLADKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDKA 360 DEL++N+ACRKVQHMVVK+ALLADKFPVLHDIGNPKAIKCVPQA+VEWKFYDAQPCSDKA Sbjct 308 DELRVNSACRKVQHMVVKSALLADKFPVLHDIGNPKAIKCVPQAEVEWKFYDAQPCSDKA 367 Query 361 YKIEELFYSYATHSDKFTDGVCLFWNCNVDRYPANSIVCRFDTRVLSNLNLPGCDGGSLY 420 YKIEELFYSYA H DKFTDGVCLFWNCNVDRYPAN+IVCRFDTRVLSNLNLPGCDGGSLY Sbjct 368 YKIEELFYSYAIHHDKFTDGVCLFWNCNVDRYPANAIVCRFDTRVLSNLNLPGCDGGSLY 427 Query 421 VNKHAFHTPAFDKSAFVNLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLG 480 VNKHAFHTPAFDKSAF NLKQLPFFYYSDSPCE YVPLKSATCITRCNLG Sbjct 428 VNKHAFHTPAFDKSAFTNLKQLPFFYYSDSPCEXXXXXXXXXXXYVPLKSATCITRCNLG 487 Query 481 GAVCRHHANEYRLYLDAYNMMISAGFSLWVYKQFDTYNLWNTFTR 525 GAVCRHHANEYR YLDAYNMMISAGFSLW+YKQFDTYNLWNTFTR Sbjct 488 GAVCRHHANEYRQYLDAYNMMISAGFSLWIYKQFDTYNLWNTFTR 532
>5nfy_A A Polyprotein 1ab
Length=534 Score = 1035 bits (2676), Expect = 0.0, Method: Compositional matrix adjust. Identities = 485/523 (93%), Positives = 504/523 (96%), Gaps = 0/523 (0%) Query 3 NVTGLFKDCSKVITGLHPTQAPTHLSVDTKFKTEGLCVDIPGIPKDMTYRRLISMMGFKM 62 NVTGLFKDCSK+ITGLHPTQAPTHLSVD KFKTEGLCVDIPGIPKDMTYRRLISMMGFKM Sbjct 10 NVTGLFKDCSKIITGLHPTQAPTHLSVDIKFKTEGLCVDIPGIPKDMTYRRLISMMGFKM 69 Query 63 NYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVAVPT 122 NYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATR+AVGTNLPLQLGFSTGVNLVAVPT Sbjct 70 NYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATRDAVGTNLPLQLGFSTGVNLVAVPT 129 Query 123 GYVDTPNNTDFSRVSAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSDRVV 182 GYVDT NNT+F+RV+AKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLK LSDRVV Sbjct 130 GYVDTENNTEFTRVNAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKGLSDRVV 189 Query 183 FVLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNPFMI 242 FVLWAHGFELTSMKYFVKIGPERTCCLCD+RATCFST+SDTYACW+HS+GFDYVYNPFMI Sbjct 190 FVLWAHGFELTSMKYFVKIGPERTCCLCDKRATCFSTSSDTYACWNHSVGFDYVYNPFMI 249 Query 243 DVQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEYPIIGDE 302 DVQQWGFTGNLQSNHD +CQVHGNAHVASCDAIMTRCLAVHECFVKRVDW++EYPIIGDE Sbjct 250 DVQQWGFTGNLQSNHDQHCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWSVEYPIIGDE 309 Query 303 LKINAACRKVQHMVVKAALLADKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDKAYK 362 L++N+ACRKVQHMVVK+ALLADKFPVLHDIGNPKAIKCVPQA+VEWKFYDAQPCSDKAYK Sbjct 310 LRVNSACRKVQHMVVKSALLADKFPVLHDIGNPKAIKCVPQAEVEWKFYDAQPCSDKAYK 369 Query 363 IEELFYSYATHSDKFTDGVCLFWNCNVDRYPANSIVCRFDTRVLSNLNLPGCDGGSLYVN 422 IEELFYSYA H DKFTDGVCLFWNCNVDRYPAN+IVCRFDTRVLSNLNLPGCDGGSLYVN Sbjct 370 IEELFYSYAIHHDKFTDGVCLFWNCNVDRYPANAIVCRFDTRVLSNLNLPGCDGGSLYVN 429 Query 423 KHAFHTPAFDKSAFVNLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLGGA 482 KHAFHTPAFDKSAF NLKQLPFFYYSDSPCE YVPLKSATCITRCNLGGA Sbjct 430 KHAFHTPAFDKSAFTNLKQLPFFYYSDSPCEXXXXXXXXXXXYVPLKSATCITRCNLGGA 489 Query 483 VCRHHANEYRLYLDAYNMMISAGFSLWVYKQFDTYNLWNTFTR 525 VCRHHANEYR YLDAYNMMISAGFSLW+YKQFDTYNLWNTFTR Sbjct 490 VCRHHANEYRQYLDAYNMMISAGFSLWIYKQFDTYNLWNTFTR 532
>7mc5_A A Proofreading exoribonuclease
Length=287 Score = 605 bits (1560), Expect = 0.0, Method: Compositional matrix adjust. Identities = 286/287 (99%), Positives = 287/287 (100%), Gaps = 0/287 (0%) Query 3 NVTGLFKDCSKVITGLHPTQAPTHLSVDTKFKTEGLCVDIPGIPKDMTYRRLISMMGFKM 62 NVTGLFKDCSKVITGLHPTQAPTHLSVDTKFKTEGLCVDIPGIPKDMTYRRLISMMGFKM Sbjct 1 NVTGLFKDCSKVITGLHPTQAPTHLSVDTKFKTEGLCVDIPGIPKDMTYRRLISMMGFKM 60 Query 63 NYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVAVPT 122 NYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVAVPT Sbjct 61 NYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVAVPT 120 Query 123 GYVDTPNNTDFSRVSAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSDRVV 182 GYVDTPNNTDFSRVSAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSDRVV Sbjct 121 GYVDTPNNTDFSRVSAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSDRVV 180 Query 183 FVLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNPFMI 242 FVLWAHGF+LTSMKYFVKIGPERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNPFMI Sbjct 181 FVLWAHGFQLTSMKYFVKIGPERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNPFMI 240 Query 243 DVQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKR 289 DVQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKR Sbjct 241 DVQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKR 287
>7diy_B B nsp14-ExoN protein
Length=294 Score = 604 bits (1558), Expect = 0.0, Method: Compositional matrix adjust. Identities = 286/286 (100%), Positives = 286/286 (100%), Gaps = 0/286 (0%) Query 3 NVTGLFKDCSKVITGLHPTQAPTHLSVDTKFKTEGLCVDIPGIPKDMTYRRLISMMGFKM 62 NVTGLFKDCSKVITGLHPTQAPTHLSVDTKFKTEGLCVDIPGIPKDMTYRRLISMMGFKM Sbjct 8 NVTGLFKDCSKVITGLHPTQAPTHLSVDTKFKTEGLCVDIPGIPKDMTYRRLISMMGFKM 67 Query 63 NYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVAVPT 122 NYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVAVPT Sbjct 68 NYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVAVPT 127 Query 123 GYVDTPNNTDFSRVSAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSDRVV 182 GYVDTPNNTDFSRVSAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSDRVV Sbjct 128 GYVDTPNNTDFSRVSAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSDRVV 187 Query 183 FVLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNPFMI 242 FVLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNPFMI Sbjct 188 FVLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNPFMI 247 Query 243 DVQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVK 288 DVQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVK Sbjct 248 DVQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVK 293
>7mc6_A A Proofreading exoribonuclease
Length=291 Score = 601 bits (1549), Expect = 0.0, Method: Compositional matrix adjust. Identities = 284/285 (99%), Positives = 285/285 (100%), Gaps = 0/285 (0%) Query 3 NVTGLFKDCSKVITGLHPTQAPTHLSVDTKFKTEGLCVDIPGIPKDMTYRRLISMMGFKM 62 NVTGLFKDCSKVITGLHPTQAPTHLSVDTKFKTEGLCVDIPGIPKDMTYRRLISMMGFKM Sbjct 5 NVTGLFKDCSKVITGLHPTQAPTHLSVDTKFKTEGLCVDIPGIPKDMTYRRLISMMGFKM 64 Query 63 NYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVAVPT 122 NYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVAVPT Sbjct 65 NYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVAVPT 124 Query 123 GYVDTPNNTDFSRVSAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSDRVV 182 GYVDTPNNTDFSRVSAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSDRVV Sbjct 125 GYVDTPNNTDFSRVSAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSDRVV 184 Query 183 FVLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNPFMI 242 FVLWAHGF+LTSMKYFVKIGPERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNPFMI Sbjct 185 FVLWAHGFQLTSMKYFVKIGPERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNPFMI 244 Query 243 DVQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFV 287 DVQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFV Sbjct 245 DVQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFV 289
>2j69_A A BACTERIAL DYNAMIN-LIKE PROTEIN
Length=695 Score = 33.5 bits (75), Expect = 4.1, Method: Compositional matrix adjust. Identities = 18/46 (39%), Positives = 23/46 (50%), Gaps = 6/46 (13%) Query 68 GYP------NMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPL 107 G+P N F+TRE AI +R C+ TREAV +PL Sbjct 311 GFPKFMDSLNTFLTRERAIAELRQVRTLARLACNHTREAVARRIPL 356
>2j69_C C BACTERIAL DYNAMIN-LIKE PROTEIN
Length=695 Score = 33.5 bits (75), Expect = 4.1, Method: Compositional matrix adjust. Identities = 18/46 (39%), Positives = 23/46 (50%), Gaps = 6/46 (13%) Query 68 GYP------NMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPL 107 G+P N F+TRE AI +R C+ TREAV +PL Sbjct 311 GFPKFMDSLNTFLTRERAIAELRQVRTLARLACNHTREAVARRIPL 356
>2j69_B B BACTERIAL DYNAMIN-LIKE PROTEIN
Length=695 Score = 33.5 bits (75), Expect = 4.1, Method: Compositional matrix adjust. Identities = 18/46 (39%), Positives = 23/46 (50%), Gaps = 6/46 (13%) Query 68 GYP------NMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPL 107 G+P N F+TRE AI +R C+ TREAV +PL Sbjct 311 GFPKFMDSLNTFLTRERAIAELRQVRTLARLACNHTREAVARRIPL 356
>2j69_D D BACTERIAL DYNAMIN-LIKE PROTEIN
Length=695 Score = 33.5 bits (75), Expect = 4.1, Method: Compositional matrix adjust. Identities = 18/46 (39%), Positives = 23/46 (50%), Gaps = 6/46 (13%) Query 68 GYP------NMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPL 107 G+P N F+TRE AI +R C+ TREAV +PL Sbjct 311 GFPKFMDSLNTFLTRERAIAELRQVRTLARLACNHTREAVARRIPL 356
>2j68_A A BACTERIAL DYNAMIN-LIKE PROTEIN
Length=695 Score = 33.5 bits (75), Expect = 4.4, Method: Compositional matrix adjust. Identities = 18/46 (39%), Positives = 23/46 (50%), Gaps = 6/46 (13%) Query 68 GYP------NMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPL 107 G+P N F+TRE AI +R C+ TREAV +PL Sbjct 311 GFPKFMDSLNTFLTRERAIAELRQVRTLARLACNHTREAVARRIPL 356
>2w6d_B B DYNAMIN FAMILY PROTEIN
Length=695 Score = 33.5 bits (75), Expect = 4.4, Method: Compositional matrix adjust. Identities = 18/46 (39%), Positives = 23/46 (50%), Gaps = 6/46 (13%) Query 68 GYP------NMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPL 107 G+P N F+TRE AI +R C+ TREAV +PL Sbjct 311 GFPKFMDSLNTFLTRERAIAELRQVRTLARLACNHTREAVARRIPL 356
>2w6d_A A DYNAMIN FAMILY PROTEIN
Length=695 Score = 33.5 bits (75), Expect = 4.4, Method: Compositional matrix adjust. Identities = 18/46 (39%), Positives = 23/46 (50%), Gaps = 6/46 (13%) Query 68 GYP------NMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPL 107 G+P N F+TRE AI +R C+ TREAV +PL Sbjct 311 GFPKFMDSLNTFLTRERAIAELRQVRTLARLACNHTREAVARRIPL 356 Lambda K H a alpha 0.325 0.138 0.455 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 37305815767 Database: unitmol_20210609.fasta Posted date: Jun 9, 2021 5:21 PM Number of letters in database: 163,607,441 Number of sequences in database: 599,558 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40