PSIBLAST 2.11.0+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Stephen F.
Altschul, John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005)
"Protein database searches using compositionally adjusted
substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: uniprot_sprot.fasta
           564,638 sequences; 203,519,613 total letters

Results from round 1


Query= YP_009725309.1 3'-to-5' exonuclease [Severe acute respiratory
syndrome coronavirus 2]

Length=527
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

sp|P0DTD1|R1AB_SARS2 Replicase polyprotein 1ab OS=Severe acute re...  1134    0.0   
sp|P0C6W6|R1AB_BCRP3 Replicase polyprotein 1ab OS=Bat coronavirus...  1097    0.0   
sp|P0C6X7|R1AB_SARS Replicase polyprotein 1ab OS=Severe acute res...  1094    0.0   
sp|P0C6V9|R1AB_BC279 Replicase polyprotein 1ab OS=Bat coronavirus...  1090    0.0   
sp|P0C6W2|R1AB_BCHK3 Replicase polyprotein 1ab OS=Bat coronavirus...  1087    0.0   
sp|K9N7C7|R1AB_MERS1 Replicase polyprotein 1ab OS=Middle East res...  714     0.0   
sp|P0C6W4|R1AB_BCHK5 Replicase polyprotein 1ab OS=Bat coronavirus...  711     0.0   
sp|P0C6W1|R1AB_BC133 Replicase polyprotein 1ab OS=Bat coronavirus...  707     0.0   
sp|P0C6W3|R1AB_BCHK4 Replicase polyprotein 1ab OS=Bat coronavirus...  707     0.0   
sp|P0C6W5|R1AB_BCHK9 Replicase polyprotein 1ab OS=Bat coronavirus...  676     0.0   
sp|P0C6X8|R1AB_CVM2 Replicase polyprotein 1ab OS=Murine coronavir...  671     0.0   
sp|P0C6W7|R1AB_CVBEN Replicase polyprotein 1ab OS=Bovine coronavi...  668     0.0   
sp|P0C6W8|R1AB_CVBLU Replicase polyprotein 1ab OS=Bovine coronavi...  668     0.0   
sp|P0C6X9|R1AB_CVMA5 Replicase polyprotein 1ab OS=Murine coronavi...  667     0.0   
sp|P0C6X4|R1AB_CVHN5 Replicase polyprotein 1ab OS=Human coronavir...  665     0.0   
sp|P0C6X2|R1AB_CVHN1 Replicase polyprotein 1ab OS=Human coronavir...  665     0.0   
sp|P0C6X6|R1AB_CVHOC Replicase polyprotein 1ab OS=Human coronavir...  663     0.0   
sp|P0C6X3|R1AB_CVHN2 Replicase polyprotein 1ab OS=Human coronavir...  662     0.0   
sp|P0C6X0|R1AB_CVBQ Replicase polyprotein 1ab OS=Bovine coronavir...  662     0.0   
sp|P0C6W9|R1AB_CVBM Replicase polyprotein 1ab OS=Bovine coronavir...  660     0.0   
sp|P0C6Y0|R1AB_CVMJH Replicase polyprotein 1ab OS=Murine coronavi...  656     0.0   
sp|P0C6Y3|R1AB_IBVM Replicase polyprotein 1ab OS=Avian infectious...  596     0.0   
sp|P0C6Y2|R1AB_IBVBC Replicase polyprotein 1ab OS=Avian infectiou...  593     0.0   
sp|P0C6Y1|R1AB_IBVB Replicase polyprotein 1ab OS=Avian infectious...  592     0.0   
sp|P0C6X5|R1AB_CVHNL Replicase polyprotein 1ab OS=Human coronavir...  570     0.0   
sp|P0C6X1|R1AB_CVH22 Replicase polyprotein 1ab OS=Human coronavir...  565     5e-180
sp|Q98VG9|R1AB_FIPV Replicase polyprotein 1ab OS=Feline coronavir...  561     9e-179
sp|P0C6Y5|R1AB_CVPPU Replicase polyprotein 1ab OS=Porcine transmi...  561     1e-178
sp|P0C6W0|R1AB_BC512 Replicase polyprotein 1ab OS=Bat coronavirus...  560     3e-178
sp|P0C6Y4|R1AB_PEDV7 Replicase polyprotein 1ab OS=Porcine epidemi...  560     5e-178
sp|P0C6V8|R1AB_BRV1 Replicase polyprotein 1ab OS=Breda virus 1 OX...  50.8    3e-05 
sp|Q008X6|R1AB_WBV24 Replicase polyprotein 1ab OS=White bream vir...  50.1    6e-05 
sp|P0C6V7|R1AB_BEV Replicase polyprotein 1ab OS=Berne virus OX=11...  47.8    3e-04 
sp|Q9RL17|BVMO1_STRCO Baeyer-Villiger monooxygenase OS=Streptomyc...  33.5    5.2   
sp|Q7Z7M0|MEGF8_HUMAN Multiple epidermal growth factor-like domai...  33.5    6.1   
sp|Q8G500|LEU3_BIFLO 3-isopropylmalate dehydrogenase OS=Bifidobac...  33.1    6.2   
sp|B3DTF8|LEU3_BIFLD 3-isopropylmalate dehydrogenase OS=Bifidobac...  33.1    6.2   
sp|B7GUI8|LEU3_BIFLS 3-isopropylmalate dehydrogenase OS=Bifidobac...  33.1    6.4   
sp|Q0D8D4|NADE_ORYSJ Glutamine-dependent NAD(+) synthetase OS=Ory...  33.1    8.8   
sp|A2YII8|NADE_ORYSI Glutamine-dependent NAD(+) synthetase OS=Ory...  33.1    8.8   


>sp|P0DTD1|R1AB_SARS2 Replicase polyprotein 1ab OS=Severe acute 
respiratory syndrome coronavirus 2 OX=2697049 GN=rep PE=1 
SV=1
Length=7096

 Score = 1134 bits (2932),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 527/527 (100%), Positives = 527/527 (100%), Gaps = 0/527 (0%)

Query  1     AENVTGLFKDCSKVITGLHPTQAPTHLSVDTKFKTEGLCVDIPGIPKDMTYRRLISMMGF  60
             AENVTGLFKDCSKVITGLHPTQAPTHLSVDTKFKTEGLCVDIPGIPKDMTYRRLISMMGF
Sbjct  5926  AENVTGLFKDCSKVITGLHPTQAPTHLSVDTKFKTEGLCVDIPGIPKDMTYRRLISMMGF  5985

Query  61    KMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVAV  120
             KMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVAV
Sbjct  5986  KMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVAV  6045

Query  121   PTGYVDTPNNTDFSRVSAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSDR  180
             PTGYVDTPNNTDFSRVSAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSDR
Sbjct  6046  PTGYVDTPNNTDFSRVSAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSDR  6105

Query  181   VVFVLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNPF  240
             VVFVLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNPF
Sbjct  6106  VVFVLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNPF  6165

Query  241   MIDVQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEYPIIG  300
             MIDVQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEYPIIG
Sbjct  6166  MIDVQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEYPIIG  6225

Query  301   DELKINAACRKVQHMVVKAALLADKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDKA  360
             DELKINAACRKVQHMVVKAALLADKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDKA
Sbjct  6226  DELKINAACRKVQHMVVKAALLADKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDKA  6285

Query  361   YKIEELFYSYATHSDKFTDGVCLFWNCNVDRYPANSIVCRFDTRVLSNLNLPGCDGGSLY  420
             YKIEELFYSYATHSDKFTDGVCLFWNCNVDRYPANSIVCRFDTRVLSNLNLPGCDGGSLY
Sbjct  6286  YKIEELFYSYATHSDKFTDGVCLFWNCNVDRYPANSIVCRFDTRVLSNLNLPGCDGGSLY  6345

Query  421   VNKHAFHTPAFDKSAFVNLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLG  480
             VNKHAFHTPAFDKSAFVNLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLG
Sbjct  6346  VNKHAFHTPAFDKSAFVNLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLG  6405

Query  481   GAVCRHHANEYRLYLDAYNMMISAGFSLWVYKQFDTYNLWNTFTRLQ  527
             GAVCRHHANEYRLYLDAYNMMISAGFSLWVYKQFDTYNLWNTFTRLQ
Sbjct  6406  GAVCRHHANEYRLYLDAYNMMISAGFSLWVYKQFDTYNLWNTFTRLQ  6452


>sp|P0C6W6|R1AB_BCRP3 Replicase polyprotein 1ab OS=Bat coronavirus 
Rp3/2004 OX=349344 GN=rep PE=3 SV=1
Length=7071

 Score = 1097 bits (2837),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 503/527 (95%), Positives = 521/527 (99%), Gaps = 0/527 (0%)

Query  1     AENVTGLFKDCSKVITGLHPTQAPTHLSVDTKFKTEGLCVDIPGIPKDMTYRRLISMMGF  60
             AENVTGLFKDCSK+ITGLHPTQAPTHLSVDTKFKTEGLCVDIPGIPKDMTYRRLISMMGF
Sbjct  5901  AENVTGLFKDCSKIITGLHPTQAPTHLSVDTKFKTEGLCVDIPGIPKDMTYRRLISMMGF  5960

Query  61    KMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVAV  120
             KMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATR+AVGTNLPLQLGFSTGVNLVA+
Sbjct  5961  KMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATRDAVGTNLPLQLGFSTGVNLVAI  6020

Query  121   PTGYVDTPNNTDFSRVSAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSDR  180
             PTGYVDT NNT+F+RV+AKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLK LSDR
Sbjct  6021  PTGYVDTENNTEFTRVNAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKGLSDR  6080

Query  181   VVFVLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNPF  240
             VVFVLWAHGFELTSMKYFVKIGPERTCCLCD+RATCFST+SDTYACW+HS+GFDYVYNPF
Sbjct  6081  VVFVLWAHGFELTSMKYFVKIGPERTCCLCDKRATCFSTSSDTYACWNHSVGFDYVYNPF  6140

Query  241   MIDVQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEYPIIG  300
             MIDVQQWGFTGNLQSNHD +CQVHGNAHVASCDAIMTRCLAVHECFVKRVDW++EYPIIG
Sbjct  6141  MIDVQQWGFTGNLQSNHDQHCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWSVEYPIIG  6200

Query  301   DELKINAACRKVQHMVVKAALLADKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDKA  360
             DELKIN+ACRKVQHMVVK+ALLADKFPVLHDIGNPKAIKCVPQA+VEWKFYDAQPCSDKA
Sbjct  6201  DELKINSACRKVQHMVVKSALLADKFPVLHDIGNPKAIKCVPQAEVEWKFYDAQPCSDKA  6260

Query  361   YKIEELFYSYATHSDKFTDGVCLFWNCNVDRYPANSIVCRFDTRVLSNLNLPGCDGGSLY  420
             YKIEELFYSYATH DKFTDGVCLFWNCNVDRYPAN+IVCRFDTRVLSNLNLPGCDGGSLY
Sbjct  6261  YKIEELFYSYATHHDKFTDGVCLFWNCNVDRYPANAIVCRFDTRVLSNLNLPGCDGGSLY  6320

Query  421   VNKHAFHTPAFDKSAFVNLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLG  480
             VNKHAFHTPAFDKSAF NLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLG
Sbjct  6321  VNKHAFHTPAFDKSAFTNLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLG  6380

Query  481   GAVCRHHANEYRLYLDAYNMMISAGFSLWVYKQFDTYNLWNTFTRLQ  527
             GAVCRHHANEYR YLDAYNMMISAGFSLW+YKQFDTYNLWNTFTRLQ
Sbjct  6381  GAVCRHHANEYRQYLDAYNMMISAGFSLWIYKQFDTYNLWNTFTRLQ  6427


>sp|P0C6X7|R1AB_SARS Replicase polyprotein 1ab OS=Severe acute 
respiratory syndrome coronavirus OX=694009 GN=rep PE=1 SV=1
Length=7073

 Score = 1094 bits (2829),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 501/527 (95%), Positives = 520/527 (99%), Gaps = 0/527 (0%)

Query  1     AENVTGLFKDCSKVITGLHPTQAPTHLSVDTKFKTEGLCVDIPGIPKDMTYRRLISMMGF  60
             AENVTGLFKDCSK+ITGLHPTQAPTHLSVD KFKTEGLCVDIPGIPKDMTYRRLISMMGF
Sbjct  5903  AENVTGLFKDCSKIITGLHPTQAPTHLSVDIKFKTEGLCVDIPGIPKDMTYRRLISMMGF  5962

Query  61    KMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVAV  120
             KMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATR+AVGTNLPLQLGFSTGVNLVAV
Sbjct  5963  KMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATRDAVGTNLPLQLGFSTGVNLVAV  6022

Query  121   PTGYVDTPNNTDFSRVSAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSDR  180
             PTGYVDT NNT+F+RV+AKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLK LSDR
Sbjct  6023  PTGYVDTENNTEFTRVNAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKGLSDR  6082

Query  181   VVFVLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNPF  240
             VVFVLWAHGFELTSMKYFVKIGPERTCCLCD+RATCFST+SDTYACW+HS+GFDYVYNPF
Sbjct  6083  VVFVLWAHGFELTSMKYFVKIGPERTCCLCDKRATCFSTSSDTYACWNHSVGFDYVYNPF  6142

Query  241   MIDVQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEYPIIG  300
             MIDVQQWGFTGNLQSNHD +CQVHGNAHVASCDAIMTRCLAVHECFVKRVDW++EYPIIG
Sbjct  6143  MIDVQQWGFTGNLQSNHDQHCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWSVEYPIIG  6202

Query  301   DELKINAACRKVQHMVVKAALLADKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDKA  360
             DEL++N+ACRKVQHMVVK+ALLADKFPVLHDIGNPKAIKCVPQA+VEWKFYDAQPCSDKA
Sbjct  6203  DELRVNSACRKVQHMVVKSALLADKFPVLHDIGNPKAIKCVPQAEVEWKFYDAQPCSDKA  6262

Query  361   YKIEELFYSYATHSDKFTDGVCLFWNCNVDRYPANSIVCRFDTRVLSNLNLPGCDGGSLY  420
             YKIEELFYSYATH DKFTDGVCLFWNCNVDRYPAN+IVCRFDTRVLSNLNLPGCDGGSLY
Sbjct  6263  YKIEELFYSYATHHDKFTDGVCLFWNCNVDRYPANAIVCRFDTRVLSNLNLPGCDGGSLY  6322

Query  421   VNKHAFHTPAFDKSAFVNLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLG  480
             VNKHAFHTPAFDKSAF NLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLG
Sbjct  6323  VNKHAFHTPAFDKSAFTNLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLG  6382

Query  481   GAVCRHHANEYRLYLDAYNMMISAGFSLWVYKQFDTYNLWNTFTRLQ  527
             GAVCRHHANEYR YLDAYNMMISAGFSLW+YKQFDTYNLWNTFTRLQ
Sbjct  6383  GAVCRHHANEYRQYLDAYNMMISAGFSLWIYKQFDTYNLWNTFTRLQ  6429


>sp|P0C6V9|R1AB_BC279 Replicase polyprotein 1ab OS=Bat coronavirus 
279/2005 OX=389167 GN=rep PE=3 SV=1
Length=7079

 Score = 1090 bits (2818),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 502/527 (95%), Positives = 518/527 (98%), Gaps = 0/527 (0%)

Query  1     AENVTGLFKDCSKVITGLHPTQAPTHLSVDTKFKTEGLCVDIPGIPKDMTYRRLISMMGF  60
             AENVTGLFKDCSK+ITGLHPTQAPTHLSVDTKFKTEGLCVDIPGIPKDMTYRRLISMMGF
Sbjct  5909  AENVTGLFKDCSKIITGLHPTQAPTHLSVDTKFKTEGLCVDIPGIPKDMTYRRLISMMGF  5968

Query  61    KMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVAV  120
             KMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATR+AVGTNLPLQLGFSTGVNLVAV
Sbjct  5969  KMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATRDAVGTNLPLQLGFSTGVNLVAV  6028

Query  121   PTGYVDTPNNTDFSRVSAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSDR  180
             PTGYVDT NNT+F+RV+AKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLK LSDR
Sbjct  6029  PTGYVDTENNTEFTRVNAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKGLSDR  6088

Query  181   VVFVLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNPF  240
             VVFVLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFST+SDTYACW+HS+GFDYVYNPF
Sbjct  6089  VVFVLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTSSDTYACWNHSVGFDYVYNPF  6148

Query  241   MIDVQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEYPIIG  300
             MIDVQQWGFTGNLQSNHD +CQVHGNAHVASCDAIMTRCLAVHECFVKRVDW++EYPIIG
Sbjct  6149  MIDVQQWGFTGNLQSNHDQHCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWSVEYPIIG  6208

Query  301   DELKINAACRKVQHMVVKAALLADKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDKA  360
             DELKINAACRKVQHMVVK+ALLADKF VLHDIGNPKAIKCVPQA+V+WKFYDAQPCSDKA
Sbjct  6209  DELKINAACRKVQHMVVKSALLADKFSVLHDIGNPKAIKCVPQAEVDWKFYDAQPCSDKA  6268

Query  361   YKIEELFYSYATHSDKFTDGVCLFWNCNVDRYPANSIVCRFDTRVLSNLNLPGCDGGSLY  420
             YKIEELFYSYATH DKFTDGVCLFWNCNVDRYPAN+IVCRFDTRVLSNLNLPGCDGGSLY
Sbjct  6269  YKIEELFYSYATHHDKFTDGVCLFWNCNVDRYPANAIVCRFDTRVLSNLNLPGCDGGSLY  6328

Query  421   VNKHAFHTPAFDKSAFVNLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLG  480
             VNKHAFHTPAFDKSAF  LKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLG
Sbjct  6329  VNKHAFHTPAFDKSAFTYLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLG  6388

Query  481   GAVCRHHANEYRLYLDAYNMMISAGFSLWVYKQFDTYNLWNTFTRLQ  527
             GAVCR HANEYR YLDAYNMMISAGFSLW+YKQFDTYNLWNTFTRLQ
Sbjct  6389  GAVCRRHANEYRQYLDAYNMMISAGFSLWIYKQFDTYNLWNTFTRLQ  6435


>sp|P0C6W2|R1AB_BCHK3 Replicase polyprotein 1ab OS=Bat coronavirus 
HKU3 OX=442736 GN=rep PE=3 SV=1
Length=7067

 Score = 1087 bits (2812),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 499/527 (95%), Positives = 520/527 (99%), Gaps = 0/527 (0%)

Query  1     AENVTGLFKDCSKVITGLHPTQAPTHLSVDTKFKTEGLCVDIPGIPKDMTYRRLISMMGF  60
             AENVTGLFKDCSK+ITGLHPTQAPTHLSVDTKFKTEGLCVDIPGIPKDMTYRRLISMMGF
Sbjct  5897  AENVTGLFKDCSKIITGLHPTQAPTHLSVDTKFKTEGLCVDIPGIPKDMTYRRLISMMGF  5956

Query  61    KMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVAV  120
             KMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATR+AVGTNLPLQLGFSTGVNLVAV
Sbjct  5957  KMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATRDAVGTNLPLQLGFSTGVNLVAV  6016

Query  121   PTGYVDTPNNTDFSRVSAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSDR  180
             PTGYVDT N+T+F+RV+AKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLK LSDR
Sbjct  6017  PTGYVDTENSTEFTRVNAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKGLSDR  6076

Query  181   VVFVLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNPF  240
             VVFVLWAHGFELTSMKYFVKIGPERTCCLCD+RATCFST+SDTYACW+HS+GFDYVYNPF
Sbjct  6077  VVFVLWAHGFELTSMKYFVKIGPERTCCLCDKRATCFSTSSDTYACWNHSVGFDYVYNPF  6136

Query  241   MIDVQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEYPIIG  300
             MIDVQQWGFTGNLQSNHD +CQVHGNAHVASCDAIMTRCLAVHECFVKRVDW++EYPIIG
Sbjct  6137  MIDVQQWGFTGNLQSNHDQHCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWSVEYPIIG  6196

Query  301   DELKINAACRKVQHMVVKAALLADKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDKA  360
             DELKINAACRKVQHMVVK+ALLADKF VLHDIGNPKAI+CVPQA+V+WKFYDAQPCSDKA
Sbjct  6197  DELKINAACRKVQHMVVKSALLADKFTVLHDIGNPKAIRCVPQAEVDWKFYDAQPCSDKA  6256

Query  361   YKIEELFYSYATHSDKFTDGVCLFWNCNVDRYPANSIVCRFDTRVLSNLNLPGCDGGSLY  420
             YKIEELFYSYATH DKFTDGVCLFWNCNVDRYPAN+IVCRFDTRVLSNLNLPGCDGGSLY
Sbjct  6257  YKIEELFYSYATHHDKFTDGVCLFWNCNVDRYPANAIVCRFDTRVLSNLNLPGCDGGSLY  6316

Query  421   VNKHAFHTPAFDKSAFVNLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLG  480
             VNKHAFHTPAFDKSAF +LKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLG
Sbjct  6317  VNKHAFHTPAFDKSAFTHLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLG  6376

Query  481   GAVCRHHANEYRLYLDAYNMMISAGFSLWVYKQFDTYNLWNTFTRLQ  527
             GAVCRHHANEYR YLDAYNMMISAGFSLW+YKQFDTYNLWNTFT+LQ
Sbjct  6377  GAVCRHHANEYRQYLDAYNMMISAGFSLWIYKQFDTYNLWNTFTKLQ  6423


>sp|K9N7C7|R1AB_MERS1 Replicase polyprotein 1ab OS=Middle East 
respiratory syndrome-related coronavirus (isolate United Kingdom/H123990006/2012) 
OX=1263720 GN=rep PE=1 SV=1
Length=7078

 Score = 714 bits (1844),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/529 (63%), Positives = 407/529 (77%), Gaps = 7/529 (1%)

Query  1     AENVTGLFKDCSKVITGLHPTQAPTHLSVDTKFKT-EGLCVDIPGIPKDMTYRRLISMMG  59
             ++ VTGLFKDCS+  +GL P  APT++SVD K+KT + LCV++  +P ++ Y R+IS MG
Sbjct  5909  SQIVTGLFKDCSRETSGLSPAYAPTYVSVDDKYKTSDELCVNL-NLPANVPYSRVISRMG  5967

Query  60    FKMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVA  119
             FK++  V GYP +FITREEA+R VR+WIGFDVEG HA+R A GTN+PLQLGFSTGVN V 
Sbjct  5968  FKLDATVPGYPKLFITREEAVRQVRSWIGFDVEGAHASRNACGTNVPLQLGFSTGVNFVV  6027

Query  120   VPTGYVDTPNNTDFSRVSAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSD  179
              P G VDT      + ++A+PPPG+QFKHL+PLM+KG  W +VR +IVQMLSDTL  LSD
Sbjct  6028  QPVGVVDTEWGNMLTGIAARPPPGEQFKHLVPLMHKGAAWPIVRRRIVQMLSDTLDKLSD  6087

Query  180   RVVFVLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNP  239
                FV WAHGFELTS  YF KIG E+ CC+C+RRA  +S+   +YACW HS G+DYVYNP
Sbjct  6088  YCTFVCWAHGFELTSASYFCKIGKEQKCCMCNRRAAAYSSPLQSYACWTHSCGYDYVYNP  6147

Query  240   FMIDVQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEYPII  299
             F +DVQQWG+ GNL +NHD YC VH  AHVAS DAIMTRCLA+H CF++RVDW IEYP I
Sbjct  6148  FFVDVQQWGYVGNLATNHDRYCSVHQGAHVASNDAIMTRCLAIHSCFIERVDWDIEYPYI  6207

Query  300   GDELKINAACRKVQHMVVKAALLADKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDK  359
               E K+N+ CR V+  VV+AALLA  F  ++DIGNPK I  V    V+W ++DAQP +  
Sbjct  6208  SHEKKLNSCCRIVERNVVRAALLAGSFDKVYDIGNPKGIPIVDDPVVDWHYFDAQPLTR-  6266

Query  360   AYKIEELFYSYATHSDKFTDGVCLFWNCNVDRYPANSIVCRFDTRVLSNLNLPGCDGGSL  419
               K+++LFY+    S +F DG+CLFWNCNV +YP N+IVCRFDTRV S  NLPGCDGGSL
Sbjct  6267  --KVQQLFYTEDMAS-RFADGLCLFWNCNVPKYPNNAIVCRFDTRVHSEFNLPGCDGGSL  6323

Query  420   YVNKHAFHTPAFDKSAFVNLKQLPFFYYSDSPCESHGK-QVVSDIDYVPLKSATCITRCN  478
             YVNKHAFHTPA+D SAF +LK LPFFYYS +PCE HG   ++ DIDYVPLKSA CIT CN
Sbjct  6324  YVNKHAFHTPAYDVSAFRDLKPLPFFYYSTTPCEVHGNGSMIEDIDYVPLKSAVCITACN  6383

Query  479   LGGAVCRHHANEYRLYLDAYNMMISAGFSLWVYKQFDTYNLWNTFTRLQ  527
             LGGAVCR HA EYR Y++AYN++ ++GF LW YK FD YNLW+TFT++Q
Sbjct  6384  LGGAVCRKHATEYREYMEAYNLVSASGFRLWCYKTFDIYNLWSTFTKVQ  6432


>sp|P0C6W4|R1AB_BCHK5 Replicase polyprotein 1ab OS=Bat coronavirus 
HKU5 OX=694008 GN=rep PE=3 SV=1
Length=7182

 Score = 711 bits (1835),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/529 (62%), Positives = 409/529 (77%), Gaps = 7/529 (1%)

Query  1     AENVTGLFKDCSKVITGLHPTQAPTHLSVDTKFKT-EGLCVDIPGIPKDMTYRRLISMMG  59
             ++ VTGL+KDCS+  +GLHP  APT++SVD K+KT + LCV++  +P ++ Y R+IS MG
Sbjct  6000  SQIVTGLYKDCSRESSGLHPAYAPTYVSVDDKYKTSDELCVNL-NVPANVPYSRVISRMG  6058

Query  60    FKMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVA  119
             FK++  +  YP +FITR+EAIR VR+WIGFDVEG HA+R A GTN+PLQLGFSTGVN V 
Sbjct  6059  FKLDASIPNYPKLFITRDEAIRQVRSWIGFDVEGAHASRNACGTNVPLQLGFSTGVNFVV  6118

Query  120   VPTGYVDTPNNTDFSRVSAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSD  179
              P G VDT   +  + ++A+PPPG+QFKHL+PLM KG  W +VR +IVQMLSDTL  LSD
Sbjct  6119  QPVGVVDTEWGSMLTSIAARPPPGEQFKHLVPLMNKGAAWPIVRRRIVQMLSDTLDKLSD  6178

Query  180   RVVFVLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNP  239
                FV WAHGFELTS  YF KIG E+ CC+C+RRA+ +S+   +YACW HS G+DYVYNP
Sbjct  6179  YCTFVCWAHGFELTSASYFCKIGKEQRCCMCNRRASTYSSPLHSYACWSHSSGYDYVYNP  6238

Query  240   FMIDVQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEYPII  299
             F +DVQQWG+ GNL +NHD YC VH  AHVAS DA+MTRCLA+H+CF++RV+W I YP I
Sbjct  6239  FFVDVQQWGYIGNLATNHDRYCSVHQGAHVASNDAVMTRCLAIHDCFIERVEWDITYPYI  6298

Query  300   GDELKINAACRKVQHMVVKAALLADKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDK  359
               E ++N+ CR V+  VV+AALLA +F  ++DIGNPK I  V    V+W +YDAQP S  
Sbjct  6299  SHEKRLNSCCRAVERNVVRAALLAGRFERVYDIGNPKGIPIVDDPVVDWHYYDAQPLSK-  6357

Query  360   AYKIEELFYSYATHSDKFTDGVCLFWNCNVDRYPANSIVCRFDTRVLSNLNLPGCDGGSL  419
               K+++LFY+    +  F+DG+CLFWNCNV RYP N+IVCRFDTRV S  NLPGCDGGSL
Sbjct  6358  --KVQQLFYT-EDCAKNFSDGLCLFWNCNVPRYPNNAIVCRFDTRVHSEFNLPGCDGGSL  6414

Query  420   YVNKHAFHTPAFDKSAFVNLKQLPFFYYSDSPCESHGK-QVVSDIDYVPLKSATCITRCN  478
             YVNKHAFHTPA+D SAF +LK LPFFYYS +PCE HG   ++ DIDYVPLKSA CIT CN
Sbjct  6415  YVNKHAFHTPAYDASAFRDLKPLPFFYYSTTPCEVHGNGNMLEDIDYVPLKSAVCITACN  6474

Query  479   LGGAVCRHHANEYRLYLDAYNMMISAGFSLWVYKQFDTYNLWNTFTRLQ  527
             LGGAVCR HA EYR Y++AYN++ ++GF LW YK FD YNLW+TFT++Q
Sbjct  6475  LGGAVCRKHAAEYRDYMEAYNLVSASGFRLWCYKTFDVYNLWSTFTKIQ  6523


>sp|P0C6W1|R1AB_BC133 Replicase polyprotein 1ab OS=Bat coronavirus 
133/2005 OX=389230 GN=rep PE=3 SV=1
Length=7126

 Score = 707 bits (1826),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/529 (62%), Positives = 410/529 (78%), Gaps = 8/529 (2%)

Query  1     AENVTGLFKDCSKVITGLHPTQAPTHLSVDTKFKT-EGLCVDIPGIPKDMTYRRLISMMG  59
             ++ VTGLFKDCS+   GL P  APT+LSVD K+KT + LCV++  I  ++TY R+IS MG
Sbjct  5960  SQIVTGLFKDCSREDVGLPPAYAPTYLSVDAKYKTTDELCVNL-NITPNVTYSRVISRMG  6018

Query  60    FKMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVA  119
             FK++  + GYP +FITR+EAIR VR+WIGFDVEG HA+R A GTN+PLQLGFSTGVN V 
Sbjct  6019  FKLDATIPGYPKLFITRDEAIRQVRSWIGFDVEGAHASRNACGTNVPLQLGFSTGVNFVV  6078

Query  120   VPTGYVDTPNNTDFSRVSAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSD  179
              P G VDT   +  + +SA+PPPG+QFKHL+PLM KG  W +VR +IVQMLSDTL  LSD
Sbjct  6079  QPVGVVDTEWGSMLTTISARPPPGEQFKHLVPLMNKGATWPIVRRRIVQMLSDTLDKLSD  6138

Query  180   RVVFVLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNP  239
                FV WAHGFELTS  YF KIG E+ CC+C RRA+ FS+   +YACW HS G+DYVYNP
Sbjct  6139  YCTFVCWAHGFELTSASYFCKIGKEQRCCMCSRRASTFSSPLQSYACWSHSSGYDYVYNP  6198

Query  240   FMIDVQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEYPII  299
             F +DVQQWG+ GNL +NHD YC +H  AHVAS DAIMTRCLA+++CF++RVDW + YP I
Sbjct  6199  FFVDVQQWGYVGNLATNHDRYCGIHAGAHVASSDAIMTRCLAIYDCFIERVDWDVTYPYI  6258

Query  300   GDELKINAACRKVQHMVVKAALLADKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDK  359
               E K+N+ CR V+  VV++A+L+ KF  ++DIGNPK I  + +  VEW FYDAQP S+ 
Sbjct  6259  SHEQKLNSCCRTVERNVVRSAVLSGKFDKIYDIGNPKGIPIISEP-VEWHFYDAQPLSN-  6316

Query  360   AYKIEELFYSYATHSDKFTDGVCLFWNCNVDRYPANSIVCRFDTRVLSNLNLPGCDGGSL  419
               K+++LFY+    + +F DG+CLFWNCNV +YP+N++VCRFDTRV S  NLPGC+GGSL
Sbjct  6317  --KVKKLFYTDDV-AKQFEDGLCLFWNCNVSKYPSNAVVCRFDTRVHSEFNLPGCNGGSL  6373

Query  420   YVNKHAFHTPAFDKSAFVNLKQLPFFYYSDSPCESHGK-QVVSDIDYVPLKSATCITRCN  478
             YVNKHAFHTPA+D +AF +LK LPFFYYS +PCE HG   ++ DIDYVPLKSA CIT CN
Sbjct  6374  YVNKHAFHTPAYDINAFRDLKPLPFFYYSTTPCEVHGSGNMLEDIDYVPLKSAVCITACN  6433

Query  479   LGGAVCRHHANEYRLYLDAYNMMISAGFSLWVYKQFDTYNLWNTFTRLQ  527
             LGGAVCR HA EYR Y++AYN++ +AGF LWVYK FD YNLW+TF ++Q
Sbjct  6434  LGGAVCRKHAAEYRDYMEAYNIVSAAGFRLWVYKTFDIYNLWSTFVKVQ  6482


>sp|P0C6W3|R1AB_BCHK4 Replicase polyprotein 1ab OS=Bat coronavirus 
HKU4 OX=694007 GN=rep PE=1 SV=1
Length=7119

 Score = 707 bits (1824),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/529 (62%), Positives = 410/529 (78%), Gaps = 8/529 (2%)

Query  1     AENVTGLFKDCSKVITGLHPTQAPTHLSVDTKFKT-EGLCVDIPGIPKDMTYRRLISMMG  59
             ++ VTGLFKDCS+  TGL P  APT+LSVD K+KT + LCV++  I  ++TY R+IS MG
Sbjct  5953  SQIVTGLFKDCSREDTGLPPAYAPTYLSVDAKYKTTDELCVNL-NITPNVTYSRVISRMG  6011

Query  60    FKMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVA  119
             FK++  + GYP +FITR+EAIR VR+W+GFDVEG HA+R A GTN+PLQLGFSTGVN V 
Sbjct  6012  FKLDATIPGYPKLFITRDEAIRQVRSWVGFDVEGAHASRNACGTNVPLQLGFSTGVNFVV  6071

Query  120   VPTGYVDTPNNTDFSRVSAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSD  179
              P G VDT   +  + +SA+PPPG+QFKHL+PLM KG  W +VR +IVQMLSDTL  LSD
Sbjct  6072  QPVGVVDTEWGSMLTTISARPPPGEQFKHLVPLMNKGATWPIVRRRIVQMLSDTLDKLSD  6131

Query  180   RVVFVLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNP  239
                FV WAHGFELTS  YF KIG E+ C +C RRA+ FS+   +YACW HS G+DYVYNP
Sbjct  6132  YCTFVCWAHGFELTSASYFCKIGKEQRCSMCSRRASTFSSPLQSYACWSHSSGYDYVYNP  6191

Query  240   FMIDVQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEYPII  299
             F +DVQQWG+ GNL +NHD YC +H  AHVAS DAIMTRCLA+++CF++RVDW + YP I
Sbjct  6192  FFVDVQQWGYVGNLATNHDRYCGIHAGAHVASSDAIMTRCLAIYDCFIERVDWDVTYPYI  6251

Query  300   GDELKINAACRKVQHMVVKAALLADKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDK  359
               E K+N+ CR V+  VV++A+L+ KF  ++DIGNPK I  + +  VEW FYDAQP S+ 
Sbjct  6252  SHEQKLNSCCRTVERNVVRSAVLSGKFEKIYDIGNPKGIAIISEP-VEWHFYDAQPLSN-  6309

Query  360   AYKIEELFYSYATHSDKFTDGVCLFWNCNVDRYPANSIVCRFDTRVLSNLNLPGCDGGSL  419
               K+++LFY+    S +F DG+CLFWNCNV +YP+N++VCRFDTRV S  NLPGC+GGSL
Sbjct  6310  --KVKKLFYTDDV-SKQFEDGLCLFWNCNVSKYPSNAVVCRFDTRVHSEFNLPGCNGGSL  6366

Query  420   YVNKHAFHTPAFDKSAFVNLKQLPFFYYSDSPCESHGK-QVVSDIDYVPLKSATCITRCN  478
             YVNKHAFHTPA+D +AF +LK LPFFYYS +PCE HG   ++ DIDYVPLKSA CIT CN
Sbjct  6367  YVNKHAFHTPAYDINAFRDLKPLPFFYYSTTPCEVHGSGNMLEDIDYVPLKSAVCITACN  6426

Query  479   LGGAVCRHHANEYRLYLDAYNMMISAGFSLWVYKQFDTYNLWNTFTRLQ  527
             LGGAVCR HA EYR Y++AYN++ +AGF LWVYK FD YNLW+TF ++Q
Sbjct  6427  LGGAVCRKHAAEYRDYMEAYNIVSAAGFRLWVYKTFDIYNLWSTFVKVQ  6475


>sp|P0C6W5|R1AB_BCHK9 Replicase polyprotein 1ab OS=Bat coronavirus 
HKU9 OX=694006 GN=rep PE=1 SV=1
Length=6930

 Score = 676 bits (1743),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/534 (60%), Positives = 389/534 (73%), Gaps = 11/534 (2%)

Query  1     AENVTGLFKDCSKVITGLHPTQAPTHLSVDTKFK-TEGLCVDIPGIPKDMTYRRLISMMG  59
             +E   GLFKDC+K    L P  APT +SV+ KFK  E LCV        M Y RLIS MG
Sbjct  5767  SEVTVGLFKDCAKA-EPLGPAYAPTFVSVNDKFKLNESLCVHFDTTELQMPYNRLISKMG  5825

Query  60    FKMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVA  119
             FK +  + GY  +FITRE+AIR VR W+GFDVEG HA    +GTNLPLQ+GFSTGVN V 
Sbjct  5826  FKFDLNIPGYSKLFITREQAIREVRGWVGFDVEGAHACGPNIGTNLPLQIGFSTGVNFVV  5885

Query  120   VPTGYVDTPNNTDFSRVSAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSD  179
              P+GY+DT + +  + V +K PPGDQFKHLIPLM KG PW+VVR +IV+ML DTL  +SD
Sbjct  5886  TPSGYIDTESGSRLANVVSKAPPGDQFKHLIPLMRKGEPWSVVRKRIVEMLCDTLDGVSD  5945

Query  180   RVVFVLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDTYACWHHSI---GFDYV  236
              V FV WAHGFELT++ YF K+GPER C +C RRAT FS+    Y+CW H     G D+V
Sbjct  5946  TVTFVTWAHGFELTTLHYFAKVGPERKCFMCPRRATLFSSVYGAYSCWSHHRHIGGADFV  6005

Query  237   YNPFMIDVQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEY  296
             YNPF++DVQQWG+ GNLQ NHD  C VH  AHVASCDAIMTRCLA+H+CF   V+W +EY
Sbjct  6006  YNPFLVDVQQWGYVGNLQVNHDNVCDVHKGAHVASCDAIMTRCLAIHDCFCGEVNWDVEY  6065

Query  297   PIIGDELKINAACRKVQHMVVKAALLADKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPC  356
             PII +EL IN ACR VQ +V+KAA+ A     ++DIGNPKAIK        W FYD  P 
Sbjct  6066  PIIANELAINRACRSVQRVVLKAAVKALHIETIYDIGNPKAIKVYGVNVNNWNFYDTNPV  6125

Query  357   SDKAYKIEELFYSYATHSDKFTDGVCLFWNCNVDRYPANSIVCRFDTRVLSNLNLPGCDG  416
              +    +++L Y Y  H D+F DG+ +FWNCNVD YP N++VCRFDTRVLS LNL GC+G
Sbjct  6126  VE---GVKQLHYVYDVHRDQFKDGLAMFWNCNVDCYPHNALVCRFDTRVLSKLNLAGCNG  6182

Query  417   GSLYVNKHAFHTPAFDKSAFVNLKQLPFFYYSDSPCESH---GKQVVSDIDYVPLKSATC  473
             GSLYVN+HAFHT AF+K+AFVNLK LPFFYYSD+ CE+        VS++DYVPLKS  C
Sbjct  6183  GSLYVNQHAFHTDAFNKNAFVNLKPLPFFYYSDTACENATGVSTNYVSEVDYVPLKSNVC  6242

Query  474   ITRCNLGGAVCRHHANEYRLYLDAYNMMISAGFSLWVYKQFDTYNLWNTFTRLQ  527
             ITRCNLGGAVC+ HA+EYR +L++YN M+SAGF+LWV K FD +NLW+TF +LQ
Sbjct  6243  ITRCNLGGAVCKKHADEYRNFLESYNTMVSAGFTLWVDKTFDVFNLWSTFVKLQ  6296


>sp|P0C6X8|R1AB_CVM2 Replicase polyprotein 1ab OS=Murine coronavirus 
(strain 2) OX=76344 GN=rep PE=3 SV=1
Length=7124

 Score = 671 bits (1732),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/524 (58%), Positives = 389/524 (74%), Gaps = 6/524 (1%)

Query  5     TGLFKDCSKVITGLHPTQAPTHLSVDTKFKTEG-LCVDIPGIPKDMTYRRLISMMGFKMN  63
             T LFKDCS+   G HP  AP+ L+VD K+K  G L V +      +TY RLIS+MGFK++
Sbjct  5933  TNLFKDCSRSYAGYHPAHAPSFLAVDDKYKVGGDLAVCLNVADSAVTYSRLISLMGFKLD  5992

Query  64    YQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVAVPTG  123
               ++GY  +FITR+EAIR VRAW+GFD EG HATR+++GTN PLQLGFSTG++ V   TG
Sbjct  5993  LTLDGYCKLFITRDEAIRRVRAWVGFDAEGAHATRDSIGTNFPLQLGFSTGIDFVVEATG  6052

Query  124   YVDTPNNTDFSRVSAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSDRVVF  183
                  +   F +  A+ PPG+QFKHL+PLM +G  W+VVRI+IVQMLSD L +L+D VV 
Sbjct  6053  MFAERDGYVFKKAVARAPPGEQFKHLVPLMSRGQKWDVVRIRIVQMLSDHLVDLADSVVL  6112

Query  184   VLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNPFMID  243
             V WA  FELT ++YF K+G E  C +C++RATCF++ +  Y CW HS   DY+YNP ++D
Sbjct  6113  VTWAASFELTCLRYFAKVGKEVVCSVCNKRATCFNSRTGYYGCWRHSYSCDYLYNPLIVD  6172

Query  244   VQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEYPIIGDEL  303
             +QQWG+TG+L SNHDL C VH  AHVAS DAIMTRCLAVH+CF K V+W++EYPII +E+
Sbjct  6173  IQQWGYTGSLTSNHDLICSVHKGAHVASSDAIMTRCLAVHDCFCKSVNWSLEYPIISNEV  6232

Query  304   KINAACRKVQHMVVKAALLADKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDKAYKI  363
              +N +CR +Q ++ +AA+L +++ V +DIGNPK + CV   D  +KFYDA P       +
Sbjct  6233  SVNTSCRLLQRVMFRAAMLCNRYDVCYDIGNPKGLACVKGYD--FKFYDASPV---VKSV  6287

Query  364   EELFYSYATHSDKFTDGVCLFWNCNVDRYPANSIVCRFDTRVLSNLNLPGCDGGSLYVNK  423
             ++  Y Y  H D+F DG+C+FWNCNVD+YPAN++VCRFDTRVL+ LNLPGC+GGSLYVNK
Sbjct  6288  KQFVYKYEAHKDQFLDGLCMFWNCNVDKYPANAVVCRFDTRVLNKLNLPGCNGGSLYVNK  6347

Query  424   HAFHTPAFDKSAFVNLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLGGAV  483
             HAFHT  F ++AF NLK +PFFYYSD+PC          +DYVPL+SATCITRCNLGGAV
Sbjct  6348  HAFHTSPFTRAAFENLKPMPFFYYSDTPCVYMEGMESKQVDYVPLRSATCITRCNLGGAV  6407

Query  484   CRHHANEYRLYLDAYNMMISAGFSLWVYKQFDTYNLWNTFTRLQ  527
             C  HA +YR YL++YN   +AGF+ WVYK FD YNLWNTFTRLQ
Sbjct  6408  CLKHAEDYREYLESYNTATTAGFTFWVYKTFDFYNLWNTFTRLQ  6451


>sp|P0C6W7|R1AB_CVBEN Replicase polyprotein 1ab OS=Bovine coronavirus 
(strain 98TXSF-110-ENT) OX=233262 GN=rep PE=3 SV=1
Length=7094

 Score = 668 bits (1724),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/524 (58%), Positives = 389/524 (74%), Gaps = 6/524 (1%)

Query  5     TGLFKDCSKVITGLHPTQAPTHLSVDTKFKTEGLCVDIPGIPKD-MTYRRLISMMGFKMN  63
             T LFKDCSK  +G HP  AP+ L+VD K+K  G      GI    +TY RLIS+MGFK++
Sbjct  5903  TNLFKDCSKSYSGYHPAHAPSFLAVDDKYKATGDLAVCLGIGDSAVTYSRLISLMGFKLD  5962

Query  64    YQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVAVPTG  123
               ++GY  +FIT+EEA++ VRAW+GFD EG HATR+++GTN PLQLGFSTG++ V   TG
Sbjct  5963  VTLDGYCKLFITKEEAVKRVRAWVGFDAEGAHATRDSIGTNFPLQLGFSTGIDFVVEATG  6022

Query  124   YVDTPNNTDFSRVSAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSDRVVF  183
                  +   F +  AK PPG+QFKHLIPLM +G  W+VVR +IVQM +D L +LSD VV 
Sbjct  6023  LFADRDGYSFKKAVAKAPPGEQFKHLIPLMTRGQRWDVVRPRIVQMFADHLIDLSDCVVL  6082

Query  184   VLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNPFMID  243
             V WA  FELT ++YF K+G E +C +C +RAT +++ +  Y CW HS+  DY+YNP ++D
Sbjct  6083  VTWAANFELTCLRYFAKVGREISCNVCTKRATAYNSRTGYYGCWRHSVTCDYLYNPLIVD  6142

Query  244   VQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEYPIIGDEL  303
             +QQWG+ G+L SNHDLYC VH  AHVAS DAIMTRCLAV++CF   ++W +EYPII +EL
Sbjct  6143  IQQWGYIGSLSSNHDLYCSVHKGAHVASSDAIMTRCLAVYDCFCNNINWNVEYPIISNEL  6202

Query  304   KINAACRKVQHMVVKAALLADKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDKAYKI  363
              IN +CR +Q +++KAA+L +++ + +DIGNPKAI CV   D ++KFYDAQP       +
Sbjct  6203  SINTSCRVLQRVMLKAAMLCNRYTLCYDIGNPKAIACVK--DFDFKFYDAQPI---VKSV  6257

Query  364   EELFYSYATHSDKFTDGVCLFWNCNVDRYPANSIVCRFDTRVLSNLNLPGCDGGSLYVNK  423
             + L YS+  H D F DG+C+FWNCNVD+YP N++VCRFDTRVL+NLNLPGC+GGSLYVNK
Sbjct  6258  KTLLYSFEAHKDSFKDGLCMFWNCNVDKYPPNAVVCRFDTRVLNNLNLPGCNGGSLYVNK  6317

Query  424   HAFHTPAFDKSAFVNLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLGGAV  483
             HAFHT  F ++AF +LK +PFFYYSD+PC          +DYVPLKSATCITRCNLGGAV
Sbjct  6318  HAFHTKPFSRAAFEHLKPMPFFYYSDTPCVYMDGMDAKQVDYVPLKSATCITRCNLGGAV  6377

Query  484   CRHHANEYRLYLDAYNMMISAGFSLWVYKQFDTYNLWNTFTRLQ  527
             C  HA EYR YL++YN   +AGF+ WVYK FD YNLWNTFT+LQ
Sbjct  6378  CLKHAEEYREYLESYNTATTAGFTFWVYKTFDFYNLWNTFTKLQ  6421


>sp|P0C6W8|R1AB_CVBLU Replicase polyprotein 1ab OS=Bovine coronavirus 
(strain 98TXSF-110-LUN) OX=233264 GN=rep PE=3 SV=1
Length=7094

 Score = 668 bits (1723),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/524 (58%), Positives = 389/524 (74%), Gaps = 6/524 (1%)

Query  5     TGLFKDCSKVITGLHPTQAPTHLSVDTKFKTEGLCVDIPGIPKD-MTYRRLISMMGFKMN  63
             T LFKDCSK  +G HP  AP+ L+VD K+K  G      GI    +TY RLIS+MGFK++
Sbjct  5903  TNLFKDCSKSYSGYHPAHAPSFLAVDDKYKATGDLAVCLGIGDSAVTYSRLISLMGFKLD  5962

Query  64    YQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVAVPTG  123
               ++GY  +FIT+EEA++ VRAW+GFD EG HATR+++GTN PLQLGFSTG++ V   TG
Sbjct  5963  VTLDGYCKLFITKEEAVKRVRAWVGFDAEGAHATRDSIGTNFPLQLGFSTGIDFVVEATG  6022

Query  124   YVDTPNNTDFSRVSAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSDRVVF  183
                  +   F +  AK PPG+QFKHLIPLM +G  W+VVR +IVQM +D L +LSD VV 
Sbjct  6023  LFADRDGYSFKKAVAKAPPGEQFKHLIPLMTRGQRWDVVRPRIVQMFADHLIDLSDCVVL  6082

Query  184   VLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNPFMID  243
             V WA  FELT ++YF K+G E +C +C +RAT +++ +  Y CW HS+  DY+YNP ++D
Sbjct  6083  VTWAANFELTCLRYFAKVGREISCNVCTKRATAYNSRTGYYGCWRHSVTCDYLYNPLIVD  6142

Query  244   VQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEYPIIGDEL  303
             +QQWG+ G+L SNHDLYC VH  AHVAS DAIMTRCLAV++CF   ++W +EYPII +EL
Sbjct  6143  IQQWGYIGSLSSNHDLYCSVHKGAHVASSDAIMTRCLAVYDCFCNNINWNVEYPIISNEL  6202

Query  304   KINAACRKVQHMVVKAALLADKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDKAYKI  363
              IN +CR +Q +++KAA+L +++ + +DIGNPKAI CV   D ++KFYDAQP       +
Sbjct  6203  SINTSCRVLQRVMLKAAMLCNRYTLCYDIGNPKAIACVK--DFDFKFYDAQPI---VKSV  6257

Query  364   EELFYSYATHSDKFTDGVCLFWNCNVDRYPANSIVCRFDTRVLSNLNLPGCDGGSLYVNK  423
             + L YS+  H D F DG+C+FWNCNVD+YP N++VCRFDTRVL+NLNLPGC+GGSLYVNK
Sbjct  6258  KTLLYSFEAHKDSFKDGLCMFWNCNVDKYPPNAVVCRFDTRVLNNLNLPGCNGGSLYVNK  6317

Query  424   HAFHTPAFDKSAFVNLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLGGAV  483
             HAFHT  F ++AF +LK +PFFYYSD+PC          +DYVPLKSATCITRCNLGGAV
Sbjct  6318  HAFHTKPFSRAAFEHLKPMPFFYYSDTPCVYMDGMDAKQVDYVPLKSATCITRCNLGGAV  6377

Query  484   CRHHANEYRLYLDAYNMMISAGFSLWVYKQFDTYNLWNTFTRLQ  527
             C  HA EYR YL++YN   +AGF+ WVYK FD YNLWNTFT+LQ
Sbjct  6378  CLKHAEEYREYLESYNTATTAGFTFWVYKTFDFYNLWNTFTKLQ  6421


>sp|P0C6X9|R1AB_CVMA5 Replicase polyprotein 1ab OS=Murine coronavirus 
(strain A59) OX=11142 GN=rep PE=1 SV=1
Length=7176

 Score = 667 bits (1720),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/524 (58%), Positives = 386/524 (74%), Gaps = 6/524 (1%)

Query  5     TGLFKDCSKVITGLHPTQAPTHLSVDTKFKTEG-LCVDIPGIPKDMTYRRLISMMGFKMN  63
             T LFKDCS+   G HP  AP+ L+VD K+K  G L V +      +TY RLIS+MGFK++
Sbjct  5985  TNLFKDCSRSYVGYHPAHAPSFLAVDDKYKVGGDLAVCLNVADSAVTYSRLISLMGFKLD  6044

Query  64    YQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVAVPTG  123
               ++GY  +FITR+EAI+ VRAW+GFD EG HA R+++GTN PLQLGFSTG++ V   TG
Sbjct  6045  LTLDGYCKLFITRDEAIKRVRAWVGFDAEGAHAIRDSIGTNFPLQLGFSTGIDFVVEATG  6104

Query  124   YVDTPNNTDFSRVSAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSDRVVF  183
                  +   F + +A+ PPG+QFKHLIPLM +G  W+VVRI+IVQMLSD L +L+D VV 
Sbjct  6105  MFAERDGYVFKKAAARAPPGEQFKHLIPLMSRGQKWDVVRIRIVQMLSDHLVDLADSVVL  6164

Query  184   VLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNPFMID  243
             V WA  FELT ++YF K+G E  C +C +RATCF++ +  Y CW HS   DY+YNP ++D
Sbjct  6165  VTWAASFELTCLRYFAKVGREVVCSVCTKRATCFNSRTGYYGCWRHSYSCDYLYNPLIVD  6224

Query  244   VQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEYPIIGDEL  303
             +QQWG+TG+L SNHD  C VH  AHVAS DAIMTRCLAVH+CF K V+W +EYPII +E+
Sbjct  6225  IQQWGYTGSLTSNHDPICSVHKGAHVASSDAIMTRCLAVHDCFCKSVNWNLEYPIISNEV  6284

Query  304   KINAACRKVQHMVVKAALLADKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDKAYKI  363
              +N +CR +Q ++ +AA+L +++ V +DIGNPK + CV   D  +KFYDA P       +
Sbjct  6285  SVNTSCRLLQRVMFRAAMLCNRYDVCYDIGNPKGLACVKGYD--FKFYDASPV---VKSV  6339

Query  364   EELFYSYATHSDKFTDGVCLFWNCNVDRYPANSIVCRFDTRVLSNLNLPGCDGGSLYVNK  423
             ++  Y Y  H D+F DG+C+FWNCNVD+YPAN++VCRFDTRVL+ LNLPGC+GGSLYVNK
Sbjct  6340  KQFVYKYEAHKDQFLDGLCMFWNCNVDKYPANAVVCRFDTRVLNKLNLPGCNGGSLYVNK  6399

Query  424   HAFHTPAFDKSAFVNLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLGGAV  483
             HAFHT  F ++AF NLK +PFFYYSD+PC          +DYVPL+SATCITRCNLGGAV
Sbjct  6400  HAFHTSPFTRAAFENLKPMPFFYYSDTPCVYMEGMESKQVDYVPLRSATCITRCNLGGAV  6459

Query  484   CRHHANEYRLYLDAYNMMISAGFSLWVYKQFDTYNLWNTFTRLQ  527
             C  HA EYR YL++YN   +AGF+ WVYK FD YNLWNTFTRLQ
Sbjct  6460  CLKHAEEYREYLESYNTATTAGFTFWVYKTFDFYNLWNTFTRLQ  6503


>sp|P0C6X4|R1AB_CVHN5 Replicase polyprotein 1ab OS=Human coronavirus 
HKU1 (isolate N5) OX=443241 GN=rep PE=3 SV=1
Length=7132

 Score = 665 bits (1717),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/524 (58%), Positives = 390/524 (74%), Gaps = 6/524 (1%)

Query  5     TGLFKDCSKVITGLHPTQAPTHLSVDTKFKT-EGLCVDIPGIPKDMTYRRLISMMGFKMN  63
             T LFKDCSK   G HP  AP+ L+VD K+K  E L V++      +TY RLIS+MGFK++
Sbjct  5941  TNLFKDCSKSCLGYHPAHAPSFLAVDDKYKVNENLAVNLNICEPVLTYSRLISLMGFKLD  6000

Query  64    YQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVAVPTG  123
               ++GY  +FIT++EAI+ VR W+GFDVEG HATRE +GTN PLQ+GFSTGV+ V   TG
Sbjct  6001  LTLDGYSKLFITKDEAIKRVRGWVGFDVEGAHATRENIGTNFPLQIGFSTGVDFVVEATG  6060

Query  124   YVDTPNNTDFSRVSAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSDRVVF  183
                  +   F +  AK PPG++FKHLIPLM KG  W++VRI+IVQMLSD L +LSD VVF
Sbjct  6061  LFAERDCYTFKKTVAKAPPGEKFKHLIPLMSKGQKWDIVRIRIVQMLSDYLLDLSDSVVF  6120

Query  184   VLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNPFMID  243
             + W+  FELT ++YF K+G E  C +C  RATC+++ +  Y CW HS   DYVYNP ++D
Sbjct  6121  ITWSASFELTCLRYFAKLGRELNCNVCSNRATCYNSRTGYYGCWRHSYTCDYVYNPLIVD  6180

Query  244   VQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEYPIIGDEL  303
             +QQWG+TG+L SNHD+ C VH  AHVAS DAIMTRCLA+++CF K V+W +EYPII +E+
Sbjct  6181  IQQWGYTGSLTSNHDIICNVHKGAHVASADAIMTRCLAIYDCFCKSVNWNLEYPIISNEV  6240

Query  304   KINAACRKVQHMVVKAALLADKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDKAYKI  363
              IN +CR +Q +++KAA+L +++ + +DIGNPK + CV   D E+KFYDA P    A  +
Sbjct  6241  SINTSCRLLQRVMLKAAMLCNRYNLCYDIGNPKGLACVK--DYEFKFYDAFPV---AKSV  6295

Query  364   EELFYSYATHSDKFTDGVCLFWNCNVDRYPANSIVCRFDTRVLSNLNLPGCDGGSLYVNK  423
             ++LFY Y  H D F DG+C+FWNCNVD+YP+NSIVCRFDTRVL+ LNLPGC+GGSLYVNK
Sbjct  6296  KQLFYVYDVHKDNFKDGLCMFWNCNVDKYPSNSIVCRFDTRVLNKLNLPGCNGGSLYVNK  6355

Query  424   HAFHTPAFDKSAFVNLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLGGAV  483
             HAFHT  F ++ F NLK +PFFYYSD+PC          +DYVPL+SATCITRCNLGGAV
Sbjct  6356  HAFHTNPFTRTVFENLKPMPFFYYSDTPCVYVDGLESKQVDYVPLRSATCITRCNLGGAV  6415

Query  484   CRHHANEYRLYLDAYNMMISAGFSLWVYKQFDTYNLWNTFTRLQ  527
             C  HA EY  YL++YN++ +AGF+ WVYK FD YNLWNTFT LQ
Sbjct  6416  CSKHAEEYCNYLESYNIVTTAGFTFWVYKTFDFYNLWNTFTTLQ  6459


>sp|P0C6X2|R1AB_CVHN1 Replicase polyprotein 1ab OS=Human coronavirus 
HKU1 (isolate N1) OX=443239 GN=rep PE=3 SV=1
Length=7182

 Score = 665 bits (1717),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/524 (58%), Positives = 390/524 (74%), Gaps = 6/524 (1%)

Query  5     TGLFKDCSKVITGLHPTQAPTHLSVDTKFKT-EGLCVDIPGIPKDMTYRRLISMMGFKMN  63
             T LFKDCSK   G HP  AP+ L+VD K+K  E L V++      +TY RLIS+MGFK++
Sbjct  5991  TNLFKDCSKSCLGYHPAHAPSFLAVDDKYKVNENLAVNLNICEPVLTYSRLISLMGFKLD  6050

Query  64    YQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVAVPTG  123
               ++GY  +FIT++EAI+ VR W+GFDVEG HATRE +GTN PLQ+GFSTGV+ V   TG
Sbjct  6051  LTLDGYSKLFITKDEAIKRVRGWVGFDVEGAHATRENIGTNFPLQIGFSTGVDFVVEATG  6110

Query  124   YVDTPNNTDFSRVSAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSDRVVF  183
                  +   F +  AK PPG++FKHLIPLM KG  W++VRI+IVQMLSD L +LSD VVF
Sbjct  6111  LFAERDCYTFKKTVAKAPPGEKFKHLIPLMSKGQKWDIVRIRIVQMLSDYLLDLSDSVVF  6170

Query  184   VLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNPFMID  243
             + W+  FELT ++YF K+G E  C +C  RATC+++ +  Y CW HS   DYVYNP ++D
Sbjct  6171  ITWSASFELTCLRYFAKLGRELNCNVCSNRATCYNSRTGYYGCWRHSYTCDYVYNPLIVD  6230

Query  244   VQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEYPIIGDEL  303
             +QQWG+TG+L SNHD+ C VH  AHVAS DAIMTRCLA+++CF K V+W +EYPII +E+
Sbjct  6231  IQQWGYTGSLTSNHDIICNVHKGAHVASADAIMTRCLAIYDCFCKSVNWNLEYPIISNEV  6290

Query  304   KINAACRKVQHMVVKAALLADKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDKAYKI  363
              IN +CR +Q +++KAA+L +++ + +DIGNPK + CV   D E+KFYDA P    A  +
Sbjct  6291  SINTSCRLLQRVMLKAAMLCNRYNLCYDIGNPKGLACVK--DYEFKFYDAFPV---AKSV  6345

Query  364   EELFYSYATHSDKFTDGVCLFWNCNVDRYPANSIVCRFDTRVLSNLNLPGCDGGSLYVNK  423
             ++LFY Y  H D F DG+C+FWNCNVD+YP+NSIVCRFDTRVL+ LNLPGC+GGSLYVNK
Sbjct  6346  KQLFYVYDVHKDNFKDGLCMFWNCNVDKYPSNSIVCRFDTRVLNKLNLPGCNGGSLYVNK  6405

Query  424   HAFHTPAFDKSAFVNLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLGGAV  483
             HAFHT  F ++ F NLK +PFFYYSD+PC          +DYVPL+SATCITRCNLGGAV
Sbjct  6406  HAFHTNPFTRTVFENLKPMPFFYYSDTPCVYVDGLESKQVDYVPLRSATCITRCNLGGAV  6465

Query  484   CRHHANEYRLYLDAYNMMISAGFSLWVYKQFDTYNLWNTFTRLQ  527
             C  HA EY  YL++YN++ +AGF+ WVYK FD YNLWNTFT LQ
Sbjct  6466  CSKHAEEYCNYLESYNIVTTAGFTFWVYKNFDFYNLWNTFTTLQ  6509


>sp|P0C6X6|R1AB_CVHOC Replicase polyprotein 1ab OS=Human coronavirus 
OC43 OX=31631 GN=rep PE=3 SV=1
Length=7095

 Score = 663 bits (1711),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/524 (58%), Positives = 387/524 (74%), Gaps = 6/524 (1%)

Query  5     TGLFKDCSKVITGLHPTQAPTHLSVDTKFKTEGLCVDIPGIPKD-MTYRRLISMMGFKMN  63
             T LFKDCSK  +G HP  AP+ L+VD K+K  G      GI    +TY RLIS+MGFK++
Sbjct  5903  TNLFKDCSKSYSGYHPAHAPSFLAVDDKYKATGDLAVCLGIGDSAVTYSRLISLMGFKLD  5962

Query  64    YQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVAVPTG  123
               ++GY  +FIT+EEA++ VRAW+GFD EG HAT +++GTN PLQLGFSTG++ V   TG
Sbjct  5963  VTLDGYCKLFITKEEAVKRVRAWVGFDAEGAHATLDSIGTNFPLQLGFSTGIDFVVEATG  6022

Query  124   YVDTPNNTDFSRVSAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSDRVVF  183
                  +   F +  AK PPG+QFKHLIPLM +G  W+VVR +IVQM +D L +LSD VV 
Sbjct  6023  LFADRDGYSFKKAVAKAPPGEQFKHLIPLMTRGHRWDVVRPRIVQMFADHLIDLSDCVVL  6082

Query  184   VLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNPFMID  243
             V WA  FELT ++YF K+G E +C +C +RAT +++ +  Y CW HS+  DY+YNP ++D
Sbjct  6083  VTWAANFELTCLRYFAKVGREISCNVCTKRATVYNSRTGYYGCWRHSVTCDYLYNPLIVD  6142

Query  244   VQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEYPIIGDEL  303
             +QQWG+ G+L SNHDLYC VH  AHVAS DAIMTRCLAV++CF   ++W +EYPII +EL
Sbjct  6143  IQQWGYIGSLSSNHDLYCSVHKGAHVASSDAIMTRCLAVYDCFCNNINWNVEYPIISNEL  6202

Query  304   KINAACRKVQHMVVKAALLADKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDKAYKI  363
              IN +CR +Q +++KAA+L +++ + +DIGNPK I CV   D ++KFYDAQP       +
Sbjct  6203  SINTSCRVLQRVILKAAMLCNRYTLCYDIGNPKGIACVK--DFDFKFYDAQPI---VKSV  6257

Query  364   EELFYSYATHSDKFTDGVCLFWNCNVDRYPANSIVCRFDTRVLSNLNLPGCDGGSLYVNK  423
             + L YS+  H D F DG+C+FWNCNVD+YP N++VCRFDTRVL+NLNLPGC+GGSLYVNK
Sbjct  6258  KTLLYSFEAHKDSFKDGLCMFWNCNVDKYPPNAVVCRFDTRVLNNLNLPGCNGGSLYVNK  6317

Query  424   HAFHTPAFDKSAFVNLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLGGAV  483
             HAFHT  F ++AF +LK +PFFYYSD+PC          +DYVPLKSATCITRCNLGGAV
Sbjct  6318  HAFHTKPFARAAFEHLKPMPFFYYSDTPCVYMDGMDAKQVDYVPLKSATCITRCNLGGAV  6377

Query  484   CRHHANEYRLYLDAYNMMISAGFSLWVYKQFDTYNLWNTFTRLQ  527
             C  HA EYR YL++YN   +AGF+ WVYK FD YNLWNTFT+LQ
Sbjct  6378  CLKHAEEYREYLESYNTATTAGFTFWVYKTFDFYNLWNTFTKLQ  6421


>sp|P0C6X3|R1AB_CVHN2 Replicase polyprotein 1ab OS=Human coronavirus 
HKU1 (isolate N2) OX=443240 GN=rep PE=3 SV=1
Length=7152

 Score = 662 bits (1708),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/524 (59%), Positives = 385/524 (73%), Gaps = 6/524 (1%)

Query  5     TGLFKDCSKVITGLHPTQAPTHLSVDTKFKT-EGLCVDIPGIPKDMTYRRLISMMGFKMN  63
             T LFKDCSK   G HP  AP+ LSVD K+K  E L V +      +TY RLIS+MGFK++
Sbjct  5961  TNLFKDCSKNFLGYHPAHAPSFLSVDDKYKVNEDLAVCLNICEPVLTYSRLISLMGFKLD  6020

Query  64    YQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVAVPTG  123
               ++GY   FIT++EAI+ VR W+GFDVEG HATR+ +GTN PLQ+GFSTGV+ V   TG
Sbjct  6021  LTLDGYSKFFITKDEAIKRVRGWVGFDVEGAHATRDNIGTNFPLQIGFSTGVDFVVEATG  6080

Query  124   YVDTPNNTDFSRVSAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSDRVVF  183
                  +   F R  AK PPGD FKHLIPLM KG  W+VVRI+IVQMLSD L +LSD VVF
Sbjct  6081  LFAERDCYIFKRTVAKAPPGDNFKHLIPLMSKGQKWDVVRIRIVQMLSDYLLDLSDSVVF  6140

Query  184   VLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNPFMID  243
             + W+  FELT ++YF K+G E  C +C  RATC+++ +  Y CW HS   DYVYNP ++D
Sbjct  6141  ITWSASFELTCLRYFAKLGRELNCDVCPNRATCYNSRTGYYGCWRHSYTCDYVYNPLIVD  6200

Query  244   VQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEYPIIGDEL  303
             +QQWG+TG+L SNHD+ C VH  AHVAS DAIMTRCLA+++CF K V+W +EYPII +E+
Sbjct  6201  IQQWGYTGSLTSNHDIICNVHKGAHVASSDAIMTRCLAIYDCFCKSVNWNLEYPIISNEV  6260

Query  304   KINAACRKVQHMVVKAALLADKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDKAYKI  363
              IN +CR +Q +++KAA+L +++ + +DIGNPK I CV   D E+KFYDA P       +
Sbjct  6261  SINTSCRLLQRVMLKAAMLCNRYNLCYDIGNPKGIACVK--DYEFKFYDASPV---VKSV  6315

Query  364   EELFYSYATHSDKFTDGVCLFWNCNVDRYPANSIVCRFDTRVLSNLNLPGCDGGSLYVNK  423
             ++LFY Y  H D F DG+C+FWNCNVD+YP+NSIVCRFDTRVL+ LNLPGC+GGSLYVNK
Sbjct  6316  KQLFYVYDVHKDNFKDGLCMFWNCNVDKYPSNSIVCRFDTRVLNKLNLPGCNGGSLYVNK  6375

Query  424   HAFHTPAFDKSAFVNLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLGGAV  483
             HAFHT  F ++ F NLK +PFFYYSD+PC          +DYVPL+SATCITRCNLGGAV
Sbjct  6376  HAFHTNPFTRTVFENLKPMPFFYYSDTPCVYVDGLESKQVDYVPLRSATCITRCNLGGAV  6435

Query  484   CRHHANEYRLYLDAYNMMISAGFSLWVYKQFDTYNLWNTFTRLQ  527
             C  HA +Y  YL++YN+  +AGF+ WVYK FD YNLWNTFT LQ
Sbjct  6436  CSKHAEDYCKYLESYNVATTAGFTFWVYKTFDFYNLWNTFTMLQ  6479


>sp|P0C6X0|R1AB_CVBQ Replicase polyprotein 1ab OS=Bovine coronavirus 
(strain Quebec) OX=11133 GN=rep PE=3 SV=1
Length=7059

 Score = 662 bits (1707),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/524 (58%), Positives = 387/524 (74%), Gaps = 6/524 (1%)

Query  5     TGLFKDCSKVITGLHPTQAPTHLSVDTKFKTEGLCVDIPGIPKD-MTYRRLISMMGFKMN  63
             T LFKDCSK  +G HP  AP+ L+VD K+K  G      GI    +TY RLIS+MGFK++
Sbjct  5903  TNLFKDCSKSYSGYHPAHAPSFLAVDDKYKATGDLAVCLGIGDSAVTYSRLISLMGFKLD  5962

Query  64    YQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVAVPTG  123
               ++GY  +FIT+EEA++ VRAW+GFD EG HATR+++GTN PLQLGFSTG++ V   TG
Sbjct  5963  VTLDGYCKLFITKEEAVKRVRAWVGFDAEGAHATRDSIGTNFPLQLGFSTGIDFVVEATG  6022

Query  124   YVDTPNNTDFSRVSAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSDRVVF  183
                  +   F +  AK PPG+QFKHLIPLM +G  W+VVR +IVQM +D L +LSD VV 
Sbjct  6023  LFADRDGYSFKKAVAKAPPGEQFKHLIPLMTRGQRWDVVRPRIVQMFADHLIDLSDCVVL  6082

Query  184   VLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNPFMID  243
             V WA  FELT ++YF K+G E +C +  +RAT +++ +  Y CW HS+  DY+YNP ++D
Sbjct  6083  VTWAANFELTCLRYFAKVGREISCNVSTKRATAYNSRTGYYGCWRHSVTCDYLYNPLIVD  6142

Query  244   VQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEYPIIGDEL  303
             +QQWG+ G+L SNHDLYC VH  AHVAS DAIMTRCLAV++CF   ++W +EYPII +EL
Sbjct  6143  IQQWGYIGSLSSNHDLYCSVHKGAHVASSDAIMTRCLAVYDCFCNNINWNVEYPIISNEL  6202

Query  304   KINAACRKVQHMVVKAALLADKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDKAYKI  363
              IN +CR +Q +++KAA+L +++ + +DIGNPKAI CV   D ++KFYDAQP       +
Sbjct  6203  SINTSCRVLQRVMLKAAMLCNRYTLCYDIGNPKAIACVK--DFDFKFYDAQPI---VKSV  6257

Query  364   EELFYSYATHSDKFTDGVCLFWNCNVDRYPANSIVCRFDTRVLSNLNLPGCDGGSLYVNK  423
             + L Y +  H D F DG+C+FWNCNVD+YP N++VCRFDTRVL+NLNLPGC+GGSLYVNK
Sbjct  6258  KTLLYFFEAHKDSFKDGLCMFWNCNVDKYPPNAVVCRFDTRVLNNLNLPGCNGGSLYVNK  6317

Query  424   HAFHTPAFDKSAFVNLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLGGAV  483
             HAFHT  F ++AF +LK +PFFYYSD+PC          +DYVPLKSATCITRCNLGGAV
Sbjct  6318  HAFHTKPFSRAAFEHLKPMPFFYYSDTPCVYMDGMDAKQVDYVPLKSATCITRCNLGGAV  6377

Query  484   CRHHANEYRLYLDAYNMMISAGFSLWVYKQFDTYNLWNTFTRLQ  527
             C  HA EYR YL++YN   +AGF+ WVYK FD YNLWNTFT+LQ
Sbjct  6378  CLKHAEEYREYLESYNTATTAGFTFWVYKTFDFYNLWNTFTKLQ  6421


>sp|P0C6W9|R1AB_CVBM Replicase polyprotein 1ab OS=Bovine coronavirus 
(strain Mebus) OX=11132 GN=rep PE=3 SV=1
Length=7094

 Score = 660 bits (1702),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/524 (57%), Positives = 386/524 (74%), Gaps = 6/524 (1%)

Query  5     TGLFKDCSKVITGLHPTQAPTHLSVDTKFKTEGLCVDIPGIPKD-MTYRRLISMMGFKMN  63
             T LFKDCSK  +G HP  AP+ L+VD K+K  G      GI    +TY RL S+MGFK++
Sbjct  5903  TNLFKDCSKSYSGYHPAHAPSFLAVDDKYKATGDLAVCLGIGDSAVTYSRLTSLMGFKLD  5962

Query  64    YQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVAVPTG  123
               ++GY  +FIT+EEA++ VRAW+GFD EG HATR+++GTN PLQLGFSTG++ V   TG
Sbjct  5963  VTLDGYCKLFITKEEAVKRVRAWVGFDAEGAHATRDSIGTNFPLQLGFSTGIDFVVEATG  6022

Query  124   YVDTPNNTDFSRVSAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSDRVVF  183
                  +   F +  AK PPG+QFKHLIPLM +G  W+VVR +IVQM +D L +LSD VV 
Sbjct  6023  LFADRDGYSFKKAVAKAPPGEQFKHLIPLMTRGQRWDVVRPRIVQMFADHLIDLSDCVVL  6082

Query  184   VLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNPFMID  243
             V WA  FELT ++YF K+G E +C +C +RAT +++ +  Y CW HS+  DY+YNP ++D
Sbjct  6083  VTWAANFELTCLRYFAKVGREISCNVCTKRATAYNSRTGYYGCWRHSVTCDYLYNPLIVD  6142

Query  244   VQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEYPIIGDEL  303
             +QQWG+ G+L SNHDLYC VH  AHVAS DAIMTRCLAV++CF   ++W +EYPII +EL
Sbjct  6143  IQQWGYIGSLSSNHDLYCSVHKGAHVASSDAIMTRCLAVYDCFCNNINWNVEYPIISNEL  6202

Query  304   KINAACRKVQHMVVKAALLADKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDKAYKI  363
              IN +CR +Q +++KAA+L +++ + +DIGNPKAI CV   D ++KFYDAQP       +
Sbjct  6203  SINTSCRVLQRVMLKAAMLCNRYTLCYDIGNPKAIACVK--DFDFKFYDAQPI---VKSV  6257

Query  364   EELFYSYATHSDKFTDGVCLFWNCNVDRYPANSIVCRFDTRVLSNLNLPGCDGGSLYVNK  423
             + L Y +  H D F DG+C+FWNCNVD+YP N++VCRFDTRVL+NLNLPGC+GGSLYVNK
Sbjct  6258  KTLLYFFEAHKDSFKDGLCMFWNCNVDKYPPNAVVCRFDTRVLNNLNLPGCNGGSLYVNK  6317

Query  424   HAFHTPAFDKSAFVNLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLGGAV  483
             HAFHT  F ++AF +LK +PFFYYSD+PC          +DYVPLKSATCITRCNL GAV
Sbjct  6318  HAFHTKPFSRAAFEHLKPMPFFYYSDTPCVYMDGMDAKQVDYVPLKSATCITRCNLVGAV  6377

Query  484   CRHHANEYRLYLDAYNMMISAGFSLWVYKQFDTYNLWNTFTRLQ  527
             C  HA EYR YL++YN   +AGF+ WVYK FD YNLWNTFT+LQ
Sbjct  6378  CLKHAEEYREYLNSYNTATTAGFTFWVYKTFDFYNLWNTFTKLQ  6421


>sp|P0C6Y0|R1AB_CVMJH Replicase polyprotein 1ab OS=Murine coronavirus 
(strain JHM) OX=11144 GN=rep PE=1 SV=1
Length=7180

 Score = 656 bits (1693),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/524 (58%), Positives = 385/524 (73%), Gaps = 8/524 (2%)

Query  5     TGLFKDCSKVITGLHPTQAPTHLSVDTKFKTEG-LCVDIPGIPKDMTYRRLISMMGFKMN  63
             T LFKDCSK   G+ P      L+VD K+K  G L V +      +TY RLIS+MGFK++
Sbjct  5991  TNLFKDCSKSYVGIPP--CAFLLAVDDKYKVSGNLAVCLNVADSAVTYSRLISLMGFKLD  6048

Query  64    YQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVAVPTG  123
               ++GY  +FITR+EAI+ VRAW+GFD EG HATR+++GTN PLQLGFSTG++ V   TG
Sbjct  6049  LTLDGYCKLFITRDEAIKRVRAWVGFDAEGAHATRDSIGTNFPLQLGFSTGIDFVVEATG  6108

Query  124   YVDTPNNTDFSRVSAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSDRVVF  183
                  +   F + +A+ PPG+QFKHL+PLM +G  W+VVRI+IVQMLSD L +L+D VV 
Sbjct  6109  MFAERDGYVFKKAAARAPPGEQFKHLVPLMSRGQKWDVVRIRIVQMLSDHLVDLADSVVL  6168

Query  184   VLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNPFMID  243
             V WA  FELT ++YF K+G E  C +C++RATCF++ +  Y CW HS   DY+YNP ++D
Sbjct  6169  VTWAASFELTCLRYFAKVGKEVVCSVCNKRATCFNSRTGYYGCWRHSYSCDYLYNPLIVD  6228

Query  244   VQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEYPIIGDEL  303
             +QQWG+TG+L SNHD  C VH  AHVAS DAIMTRCLAVH+CF K V+W +EYPII +E+
Sbjct  6229  IQQWGYTGSLTSNHDPICSVHKGAHVASSDAIMTRCLAVHDCFCKSVNWNLEYPIISNEV  6288

Query  304   KINAACRKVQHMVVKAALLADKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDKAYKI  363
              +N +CR +Q ++ +AA+L +++ V +DIGNPK + CV   D  +KFYDA P       +
Sbjct  6289  SVNTSCRLLQRVMFRAAMLCNRYDVCYDIGNPKGLACVKGYD--FKFYDASPV---VKSV  6343

Query  364   EELFYSYATHSDKFTDGVCLFWNCNVDRYPANSIVCRFDTRVLSNLNLPGCDGGSLYVNK  423
             ++  Y Y  H D+F DG+C+FWNCNVD+YPAN++VCRFDTRVLS LNLPGC+GGSLYVNK
Sbjct  6344  KQFVYKYEAHKDQFLDGLCMFWNCNVDKYPANAVVCRFDTRVLSKLNLPGCNGGSLYVNK  6403

Query  424   HAFHTPAFDKSAFVNLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLGGAV  483
             HAFHT  F ++AF NLK +PFFYYSD+PC          +DYVPL+SATCITRCNLGGAV
Sbjct  6404  HAFHTNPFTRAAFENLKPMPFFYYSDTPCVYMEGMESKQVDYVPLRSATCITRCNLGGAV  6463

Query  484   CRHHANEYRLYLDAYNMMISAGFSLWVYKQFDTYNLWNTFTRLQ  527
             C  HA EYR YL++YN   +AGF+ WVYK FD YNLWNTFTRLQ
Sbjct  6464  CLKHAEEYREYLESYNTATTAGFTFWVYKTFDFYNLWNTFTRLQ  6507


>sp|P0C6Y3|R1AB_IBVM Replicase polyprotein 1ab OS=Avian infectious 
bronchitis virus (strain M41) OX=11127 GN=rep PE=1 SV=1
Length=6631

 Score = 596 bits (1536),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/525 (53%), Positives = 367/525 (70%), Gaps = 7/525 (1%)

Query  5     TGLFKDCSKVITGLHPTQAPTHLSVDTKFKTEGLCVDIPGIP--KDMTYRRLISMMGFKM  62
             TGLFK C+K  +G+HP  A T  ++   +K       +  +    ++TY+ LIS++GFKM
Sbjct  5472  TGLFKICNKEFSGVHPAYAVTTKALAATYKVNDELAALVNVEAGSEITYKHLISLLGFKM  5531

Query  63    NYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVAVPT  122
             +  V G  NMFITR+EAIR+VR W+GFDVE  HA    +GTNLP Q+GFSTG + V  P 
Sbjct  5532  SVNVEGCHNMFITRDEAIRNVRGWVGFDVEATHACGTNIGTNLPFQVGFSTGADFVVTPE  5591

Query  123   GYVDTPNNTDFSRVSAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSDRVV  182
             G VDT    +F  V++K PPG+QF HL  L     PW+VVR +IVQML+D L N+SD VV
Sbjct  5592  GLVDTSIGNNFEPVNSKAPPGEQFNHLRALFKSAKPWHVVRPRIVQMLADNLCNVSDCVV  5651

Query  183   FVLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNPFMI  242
             FV W HG ELT+++YFVKIG ++ C  C  RAT F++ +  YACW H +GFD+VYNP ++
Sbjct  5652  FVTWCHGLELTTLRYFVKIGKDQVCS-CGSRATTFNSHTQAYACWKHCLGFDFVYNPLLV  5710

Query  243   DVQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEYPIIGDE  302
             D+QQWG++GNLQ NHDL+C VHG+AHVAS DAIMTRCLA++  F + V+W + YP I +E
Sbjct  5711  DIQQWGYSGNLQFNHDLHCNVHGHAHVASADAIMTRCLAINNAFCQDVNWDLTYPHIANE  5770

Query  303   LKINAACRKVQHMVVKAALLADKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDKAYK  362
              ++N++CR +Q M + A + A K  V++DIGNPK IKCV + D+ ++FYD  P      +
Sbjct  5771  DEVNSSCRYLQRMYLNACVDALKVNVVYDIGNPKGIKCVRRGDLNFRFYDKNPIVPNVKQ  5830

Query  363   IEELFYSYATHSDKFTDGVCLFWNCNVDRYPANSIVCRFDTRVLSNLNLPGCDGGSLYVN  422
              E   Y Y  H DKF DG+C+FWNCNVD YP NS+VCR+DTR LS  NLPGC+GGSLYVN
Sbjct  5831  FE---YDYNQHKDKFADGLCMFWNCNVDCYPDNSLVCRYDTRNLSVFNLPGCNGGSLYVN  5887

Query  423   KHAFHTPAFDKSAFVNLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLGGA  482
             KHAFHTP FD+++F NLK +PFF+Y  SPCE+     V+  D V L +  CIT+CN+GGA
Sbjct  5888  KHAFHTPKFDRTSFRNLKAMPFFFYDSSPCETIQLDGVAQ-DLVSLATKDCITKCNIGGA  5946

Query  483   VCRHHANEYRLYLDAYNMMISAGFSLWVYKQFDTYNLWNTFTRLQ  527
             VC+ HA  Y  ++ +YN  ++AGF+ WV   F+ YNLW +F+ LQ
Sbjct  5947  VCKKHAQMYADFVTSYNAAVTAGFTFWVTNNFNPYNLWKSFSALQ  5991


>sp|P0C6Y2|R1AB_IBVBC Replicase polyprotein 1ab OS=Avian infectious 
bronchitis virus (strain Beaudette CK) OX=160235 GN=rep 
PE=3 SV=1
Length=6629

 Score = 593 bits (1528),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/525 (53%), Positives = 366/525 (70%), Gaps = 7/525 (1%)

Query  5     TGLFKDCSKVITGLHPTQAPTHLSVDTKFKTEGLCVDIPGIP--KDMTYRRLISMMGFKM  62
             TGLFK C+K  +G+HP  A T  ++   +K       +  +    ++TY+ LIS++GFKM
Sbjct  5470  TGLFKICNKEFSGVHPAYAVTTKALAATYKVNDELAALVNVEAGSEITYKHLISLLGFKM  5529

Query  63    NYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVAVPT  122
             +  V G  NMFITR+EAIR+VR W+GFDVE  HA    +GTNLP Q+GFSTG + V  P 
Sbjct  5530  SVNVEGCHNMFITRDEAIRNVRGWVGFDVEATHACGTNIGTNLPFQVGFSTGADFVVTPE  5589

Query  123   GYVDTPNNTDFSRVSAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSDRVV  182
             G VDT    +F  V++K PPG+QF HL  L     PW+V+R +IVQML+D L N+SD VV
Sbjct  5590  GLVDTSIGNNFEPVNSKAPPGEQFNHLRVLFKSAKPWHVIRPRIVQMLADNLCNVSDCVV  5649

Query  183   FVLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNPFMI  242
             FV W HG ELT+++YFVKIG E+ C  C  RAT F++ +  YACW H +GFD+VYNP ++
Sbjct  5650  FVTWCHGLELTTLRYFVKIGKEQVCS-CGSRATTFNSHTQAYACWKHCLGFDFVYNPLLV  5708

Query  243   DVQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEYPIIGDE  302
             D+QQWG++GNLQ NHDL+C VHG+AHVAS DAIMTRCLA++  F + V+W + YP I +E
Sbjct  5709  DIQQWGYSGNLQFNHDLHCNVHGHAHVASVDAIMTRCLAINNAFCQDVNWDLTYPHIANE  5768

Query  303   LKINAACRKVQHMVVKAALLADKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDKAYK  362
              ++N++CR +Q M + A + A K  V++DIGNPK IKCV + DV ++FYD  P      +
Sbjct  5769  DEVNSSCRYLQRMYLNACVDALKVNVVYDIGNPKGIKCVRRGDVNFRFYDKNPIVRNVKQ  5828

Query  363   IEELFYSYATHSDKFTDGVCLFWNCNVDRYPANSIVCRFDTRVLSNLNLPGCDGGSLYVN  422
              E   Y Y  H DKF DG+C+FWNCNVD YP NS+VCR+DTR LS  NLPGC+GGSLYVN
Sbjct  5829  FE---YDYNQHKDKFADGLCMFWNCNVDCYPDNSLVCRYDTRNLSVFNLPGCNGGSLYVN  5885

Query  423   KHAFHTPAFDKSAFVNLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLGGA  482
             KHAF+TP FD+ +F NLK +PFF+Y  SPCE+     V+  D V L +  CIT+CN+GGA
Sbjct  5886  KHAFYTPKFDRISFRNLKAMPFFFYDSSPCETIQVDGVAQ-DLVSLATKDCITKCNIGGA  5944

Query  483   VCRHHANEYRLYLDAYNMMISAGFSLWVYKQFDTYNLWNTFTRLQ  527
             VC+ HA  Y  ++ +YN  ++AGF+ WV  + + YNLW +F+ LQ
Sbjct  5945  VCKKHAQMYAEFVTSYNAAVTAGFTFWVTNKLNPYNLWKSFSALQ  5989


>sp|P0C6Y1|R1AB_IBVB Replicase polyprotein 1ab OS=Avian infectious 
bronchitis virus (strain Beaudette) OX=11122 GN=rep PE=1 
SV=1
Length=6629

 Score = 592 bits (1527),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/525 (53%), Positives = 366/525 (70%), Gaps = 7/525 (1%)

Query  5     TGLFKDCSKVITGLHPTQAPTHLSVDTKFKTEGLCVDIPGIP--KDMTYRRLISMMGFKM  62
             TGLFK C+K  +G+HP  A T  ++   +K       +  +    ++TY+ LIS++GFKM
Sbjct  5470  TGLFKICNKEFSGVHPAYAVTTKALAATYKVNDELAALVNVEAGSEITYKHLISLLGFKM  5529

Query  63    NYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVAVPT  122
             +  V G  NMFITR+EAIR+VR W+GFDVE  HA    +GTNLP Q+GFSTG + V  P 
Sbjct  5530  SVNVEGCHNMFITRDEAIRNVRGWVGFDVEATHACGTNIGTNLPFQVGFSTGADFVVTPE  5589

Query  123   GYVDTPNNTDFSRVSAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSDRVV  182
             G VDT    +F  V++K PPG+QF HL  L     PW+V+R +IVQML+D L N+SD VV
Sbjct  5590  GLVDTSIGNNFEPVNSKAPPGEQFNHLRVLFKSAKPWHVIRPRIVQMLADNLCNVSDCVV  5649

Query  183   FVLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNPFMI  242
             FV W HG ELT+++YFVKIG E+ C  C  RAT F++ +  YACW H +GFD+VYNP ++
Sbjct  5650  FVTWCHGLELTTLRYFVKIGKEQVCS-CGSRATTFNSHTQAYACWKHCLGFDFVYNPLLV  5708

Query  243   DVQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEYPIIGDE  302
             D+QQWG++GNLQ NHDL+C VHG+AHVAS DAIMTRCLA++  F + V+W + YP I +E
Sbjct  5709  DIQQWGYSGNLQFNHDLHCNVHGHAHVASVDAIMTRCLAINNAFCQDVNWDLTYPHIANE  5768

Query  303   LKINAACRKVQHMVVKAALLADKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDKAYK  362
              ++N++CR +Q M + A + A K  V++DIGNPK IKCV + DV ++FYD  P      +
Sbjct  5769  DEVNSSCRYLQRMYLNACVDALKVNVVYDIGNPKGIKCVRRGDVNFRFYDKNPIVRNVKQ  5828

Query  363   IEELFYSYATHSDKFTDGVCLFWNCNVDRYPANSIVCRFDTRVLSNLNLPGCDGGSLYVN  422
              E   Y Y  H DKF DG+C+FWNCNVD YP NS+VCR+DTR LS  NLPGC+GGSLYVN
Sbjct  5829  FE---YDYNQHKDKFADGLCMFWNCNVDCYPDNSLVCRYDTRNLSVFNLPGCNGGSLYVN  5885

Query  423   KHAFHTPAFDKSAFVNLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLGGA  482
             KHAF+TP FD+ +F NLK +PFF+Y  SPCE+     V+  D V L +  CIT+CN+GGA
Sbjct  5886  KHAFYTPKFDRISFRNLKAMPFFFYDSSPCETIQVDGVAQ-DLVSLATKDCITKCNIGGA  5944

Query  483   VCRHHANEYRLYLDAYNMMISAGFSLWVYKQFDTYNLWNTFTRLQ  527
             VC+ HA  Y  ++ +YN  ++AGF+ WV  + + YNLW +F+ LQ
Sbjct  5945  VCKKHAQMYAEFVTSYNAAVTAGFTFWVTNKLNPYNLWKSFSALQ  5989


>sp|P0C6X5|R1AB_CVHNL Replicase polyprotein 1ab OS=Human coronavirus 
NL63 OX=277944 GN=rep PE=1 SV=1
Length=6729

 Score = 570 bits (1469),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/530 (54%), Positives = 358/530 (68%), Gaps = 15/530 (3%)

Query  1     AENVTGLFKDCSKVITGLHPTQAPTHLSVDTKFKTEG-LCVDIPGIPKDMTYRRLISMMG  59
             +  V GLFK+C++    L PT A T LS+  +FKT G L V I G     TY  +IS MG
Sbjct  5568  SSQVCGLFKNCTRTPLNLPPTHAHTFLSLSDQFKTTGDLAVQI-GSNNVCTYEHVISFMG  5626

Query  60    FKMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVA  119
             F+ +  + G  ++F TR+ AIR+VR W+G DVE  H   + +GTN+PLQ+GFS GVN V 
Sbjct  5627  FRFDISIPGSHSLFCTRDFAIRNVRGWLGMDVESAHVCGDNIGTNVPLQVGFSNGVNFVV  5686

Query  120   VPTGYVDTPNNTDFSRVSAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSD  179
                G V T        V AK PPG+QF+HLIPL+ KG PW +VR +IVQM+SD L NLSD
Sbjct  5687  QTEGCVSTNFGDVIKPVCAKSPPGEQFRHLIPLLRKGQPWLIVRRRIVQMISDYLSNLSD  5746

Query  180   RVVFVLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNP  239
              +VFVLWA   ELT+M+YFVKIGP +  C C   ATC+++ S+ Y C+ H++G DYVYNP
Sbjct  5747  ILVFVLWAGSLELTTMRYFVKIGPIKY-CYCGNSATCYNSVSNEYCCFKHALGCDYVYNP  5805

Query  240   FMIDVQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEYPII  299
             +  D+QQWG+ G+L  NH  +C +H N H AS DA+MTRCLAVH+CFVK VDWT+ YP I
Sbjct  5806  YAFDIQQWGYVGSLSQNHHTFCNIHRNEHDASGDAVMTRCLAVHDCFVKNVDWTVTYPFI  5865

Query  300   GDELKINAACRKVQHMVVKAALLADKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDK  359
              +E  IN   R VQ  VV+AAL   K  V+HDIGNPK ++C    D +W  YD QP +  
Sbjct  5866  ANEKFINGCGRNVQGHVVRAALKLYKPSVIHDIGNPKGVRC-AVTDAKWYCYDKQPVNS-  5923

Query  360   AYKIEELFYSYATHSDKFTDGVCLFWNCNVDRYPANSIVCRFDTRVLSNLNLPGCDGGSL  419
                ++ L Y YATH     DG+CLFWNCNVD YP  SIVCRFDTR  S  NL G +GGSL
Sbjct  5924  --NVKLLDYDYATHGQ--LDGLCLFWNCNVDMYPEFSIVCRFDTRTRSVFNLEGVNGGSL  5979

Query  420   YVNKHAFHTPAFDKSAFVNLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNL  479
             YVNKHAFHTPA+DK AFV LK +PFFY+ DS C+   +QV    +YVPL++++C+TRCN+
Sbjct  5980  YVNKHAFHTPAYDKRAFVKLKPMPFFYFDDSDCDVVQEQV----NYVPLRASSCVTRCNI  6035

Query  480   GGAVCRHHANEYRLYLDAYNMMISAGFSLWVYKQFDTYNLWNTF--TRLQ  527
             GGAVC  HAN Y+ Y++AYN    AGF++WV   FD YNLW  F  T LQ
Sbjct  6036  GGAVCSKHANLYQKYVEAYNTFTQAGFNIWVPHSFDVYNLWQIFIETNLQ  6085


>sp|P0C6X1|R1AB_CVH22 Replicase polyprotein 1ab OS=Human coronavirus 
229E OX=11137 GN=rep PE=1 SV=1
Length=6758

 Score = 565 bits (1456),  Expect = 5e-180, Method: Compositional matrix adjust.
 Identities = 278/528 (53%), Positives = 356/528 (67%), Gaps = 13/528 (2%)

Query  1     AENVTGLFKDCSKVITGLHPTQAPTHLSVDTKFKTEG-LCVDIPGIPKDMTYRRLISMMG  59
             +E+  GLFKDC++    L P+ A T+LS+  +FKT G L V I G     TY  +IS MG
Sbjct  5593  SESSCGLFKDCARNPIDLPPSHATTYLSLSDRFKTSGDLAVQI-GNNNVCTYEHVISYMG  5651

Query  60    FKMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVA  119
             F+ +  + G  ++F TR+ A+RHVR W+G DVEG H T + VGTN+PLQ+GFS GV+ VA
Sbjct  5652  FRFDVSMPGSHSLFCTRDFAMRHVRGWLGMDVEGAHVTGDNVGTNVPLQVGFSNGVDFVA  5711

Query  120   VPTGYVDTPNNTDFSRVSAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSD  179
              P G V T   +    V A+ PPG+QF H++PL+ KG PW+V+R +IVQM++D L   SD
Sbjct  5712  QPEGCVLTNTGSVVKPVRARAPPGEQFTHIVPLLRKGQPWSVLRKRIVQMIADFLAGSSD  5771

Query  180   RVVFVLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNP  239
              +VFVLWA G ELT+M+YFVKIG  +  C C   ATC+++ S+ Y C+ H++G DYVYNP
Sbjct  5772  VLVFVLWAGGLELTTMRYFVKIGAVKH-CQCGTVATCYNSVSNDYCCFKHALGCDYVYNP  5830

Query  240   FMIDVQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEYPII  299
             ++ID+QQWG+ G+L +NH   C VH N HVAS DAIMTRCLAV++CFVK VDW+I YP+I
Sbjct  5831  YVIDIQQWGYVGSLSTNHHAICNVHRNEHVASGDAIMTRCLAVYDCFVKNVDWSITYPMI  5890

Query  300   GDELKINAACRKVQHMVVKAALLADKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDK  359
              +E  IN   R VQ  +++AA+       +HDIGNPK I+C    D +W  YD  P +  
Sbjct  5891  ANENAINKGGRTVQSHIMRAAIKLYNPKAIHDIGNPKGIRCAV-TDAKWYCYDKNPINSN  5949

Query  360   AYKIEELFYSYATHSDKFTDGVCLFWNCNVDRYPANSIVCRFDTRVLSNLNLPGCDGGSL  419
                +E   Y Y TH     DG+CLFWNCNVD YP  SIVCRFDTR  S LNL G +GGSL
Sbjct  5950  VKTLE---YDYMTHGQ--MDGLCLFWNCNVDMYPEFSIVCRFDTRTRSTLNLEGVNGGSL  6004

Query  420   YVNKHAFHTPAFDKSAFVNLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNL  479
             YVN HAFHTPA+DK A   LK  PFFYY D  CE    QV    +YVPL++  CIT+CN+
Sbjct  6005  YVNNHAFHTPAYDKRAMAKLKPAPFFYYDDGSCEVVHDQV----NYVPLRATNCITKCNI  6060

Query  480   GGAVCRHHANEYRLYLDAYNMMISAGFSLWVYKQFDTYNLWNTFTRLQ  527
             GGAVC  HAN YR Y+++YN+   AGF++WV   FD YNLW TFT + 
Sbjct  6061  GGAVCSKHANLYRAYVESYNIFTQAGFNIWVPTTFDCYNLWQTFTEVN  6108


>sp|Q98VG9|R1AB_FIPV Replicase polyprotein 1ab OS=Feline coronavirus 
(strain FIPV WSU-79/1146) OX=33734 GN=rep PE=1 SV=2
Length=6709

 Score = 561 bits (1447),  Expect = 9e-179, Method: Compositional matrix adjust.
 Identities = 279/520 (54%), Positives = 353/520 (68%), Gaps = 16/520 (3%)

Query  6     GLFKDCSKVITGLHPTQAPTHLSVDTKFKT-EGLCVDIPGIPKDMTYRRLISMMGFKMNY  64
             GLFKDCSK    + P  A T++S+   FKT +GL V+I    KD+ Y  +IS MGF+   
Sbjct  5558  GLFKDCSKSEQYIPPAYATTYMSLSDNFKTSDGLAVNIG--TKDVKYANVISYMGFRFEA  5615

Query  65    QVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVAVPTGY  124
              + GY  +F TR+ A+R+VRAW+GFDVEG H   + VGTN+PLQLGFS GV+ V    G 
Sbjct  5616  NIPGYHTLFCTRDFAMRNVRAWLGFDVEGAHVCGDNVGTNVPLQLGFSNGVDFVVQTEGC  5675

Query  125   VDTPNNTDFSRVSAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSDRVVFV  184
             V T        V A+ PPG+QF HLIPLM KG PW++VR +IVQM+ D    LSD ++FV
Sbjct  5676  VVTEKGNSIEVVKARAPPGEQFAHLIPLMRKGQPWHIVRRRIVQMVCDYFDGLSDILIFV  5735

Query  185   LWAHGFELTSMKYFVKIG-PERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNPFMID  243
             LWA G ELT+M+YFVKIG P++  C C + ATC+S++   YAC+ H++G DY+YNP+ ID
Sbjct  5736  LWAGGLELTTMRYFVKIGRPQK--CECGKSATCYSSSQCVYACFKHALGCDYLYNPYCID  5793

Query  244   VQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEYPIIGDEL  303
             +QQWG+TG+L  NH   C +H N HVAS DAIMTRCLA+H+CFVKRVDW+I YP I +E 
Sbjct  5794  IQQWGYTGSLSMNHHEVCNIHRNEHVASGDAIMTRCLAIHDCFVKRVDWSIVYPFIDNEE  5853

Query  304   KINAACRKVQHMVVKAALLADKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDKAYKI  363
             KIN A R VQ  V+KAAL       +HD+GNPK I+C     + W  YD  P ++    +
Sbjct  5854  KINKAGRIVQSHVMKAALKIFNPAAIHDVGNPKGIRCATTP-IPWFCYDRDPINNNVRCL  5912

Query  364   EELFYSYATHSDKFTDGVCLFWNCNVDRYPANSIVCRFDTRVLSNLNLPGCDGGSLYVNK  423
             E   Y Y  H     +G+ LFWNCNVD YP  SIVCRFDTR  S L+L GC+GG+LYVN 
Sbjct  5913  E---YDYMVHGQ--MNGLMLFWNCNVDMYPEFSIVCRFDTRTRSKLSLEGCNGGALYVNN  5967

Query  424   HAFHTPAFDKSAFVNLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLGGAV  483
             HAFHTPA+D+ AF  LK +PFFYY DS CE    Q     +YVPLKS  CIT+CN+GGAV
Sbjct  5968  HAFHTPAYDRRAFAKLKPMPFFYYDDSNCELVDGQP----NYVPLKSNVCITKCNIGGAV  6023

Query  484   CRHHANEYRLYLDAYNMMISAGFSLWVYKQFDTYNLWNTF  523
             C+ HA  YR Y++ YNM + AGF++W  + FDTY LW+ F
Sbjct  6024  CKKHAALYRAYVEDYNMFMQAGFTIWCPQNFDTYMLWHGF  6063


>sp|P0C6Y5|R1AB_CVPPU Replicase polyprotein 1ab OS=Porcine transmissible 
gastroenteritis coronavirus (strain Purdue) OX=11151 
GN=rep PE=1 SV=1
Length=6684

 Score = 561 bits (1446),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 278/520 (53%), Positives = 353/520 (68%), Gaps = 16/520 (3%)

Query  6     GLFKDCSKVITGLHPTQAPTHLSVDTKFKT-EGLCVDIPGIPKDMTYRRLISMMGFKMNY  64
             GLFKDCSK    + P  A T++S+   FKT +GL V+I    KD+ Y  +IS MGF+   
Sbjct  5533  GLFKDCSKSEQYIPPAYATTYMSLSDNFKTSDGLAVNIG--TKDVKYANVISYMGFRFEA  5590

Query  65    QVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVAVPTGY  124
              + GY  +F TR+ A+R+VRAW+GFDVEG H   + VGTN+PLQLGFS GV+ V    G 
Sbjct  5591  NIPGYHTLFCTRDFAMRNVRAWLGFDVEGAHVCGDNVGTNVPLQLGFSNGVDFVVQTEGC  5650

Query  125   VDTPNNTDFSRVSAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSDRVVFV  184
             V T        V A+ PPG+QF HLIPLM KG PW++VR +IVQM+ D    LSD ++FV
Sbjct  5651  VITEKGNSIEVVKARAPPGEQFAHLIPLMRKGQPWHIVRRRIVQMVCDYFDGLSDILIFV  5710

Query  185   LWAHGFELTSMKYFVKIG-PERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNPFMID  243
             LWA G ELT+M+YFVKIG P++  C C + ATC+S++   YAC+ H++G DY+YNP+ ID
Sbjct  5711  LWAGGLELTTMRYFVKIGRPQK--CECGKSATCYSSSQSVYACFKHALGCDYLYNPYCID  5768

Query  244   VQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEYPIIGDEL  303
             +QQWG+TG+L  NH   C +H N HVAS DAIMTRCLA+H+CFVKRVDW+I YP I +E 
Sbjct  5769  IQQWGYTGSLSMNHHEVCNIHRNEHVASGDAIMTRCLAIHDCFVKRVDWSIVYPFIDNEE  5828

Query  304   KINAACRKVQHMVVKAALLADKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDKAYKI  363
             KIN A R VQ  V+KAAL       +HD+GNPK I+C     + W  YD  P ++    +
Sbjct  5829  KINKAGRIVQSHVMKAALKIFNPAAIHDVGNPKGIRCATTP-IPWFCYDRDPINN---NV  5884

Query  364   EELFYSYATHSDKFTDGVCLFWNCNVDRYPANSIVCRFDTRVLSNLNLPGCDGGSLYVNK  423
               L Y Y  H     +G+ LFWNCNVD YP  SIVCRFDTR  S L+L GC+GG+LYVN 
Sbjct  5885  RCLDYDYMVHGQ--MNGLMLFWNCNVDMYPEFSIVCRFDTRTRSKLSLEGCNGGALYVNN  5942

Query  424   HAFHTPAFDKSAFVNLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLGGAV  483
             HAFHTPA+D+ AF  LK +PFFYY DS CE     V    +YVPLKS  CIT+CN+GGAV
Sbjct  5943  HAFHTPAYDRRAFAKLKPMPFFYYDDSNCE----LVDGQPNYVPLKSNVCITKCNIGGAV  5998

Query  484   CRHHANEYRLYLDAYNMMISAGFSLWVYKQFDTYNLWNTF  523
             C+ HA  YR Y++ YN+ + AGF++W  + FDTY LW+ F
Sbjct  5999  CKKHAALYRAYVEDYNIFMQAGFTIWCPQNFDTYMLWHGF  6038


>sp|P0C6W0|R1AB_BC512 Replicase polyprotein 1ab OS=Bat coronavirus 
512/2005 OX=693999 GN=rep PE=3 SV=1
Length=6793

 Score = 560 bits (1443),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 272/519 (52%), Positives = 349/519 (67%), Gaps = 13/519 (3%)

Query  6     GLFKDCSKVITGLHPTQAPTHLSVDTKFKTE-GLCVDIPGIPKDMTYRRLISMMGFKMNY  64
             GLFKDC K    L P+ APT +S+   FKT+  L V I G+   + Y  +IS MGF+ + 
Sbjct  5641  GLFKDCYKGEDNLPPSHAPTFMSLSDNFKTDKDLAVQI-GVNGPVKYEHVISFMGFRFDI  5699

Query  65    QVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVAVPTGY  124
              V     +F TR+ A+R+ R W+GFDVEG H     VGTN+PLQLGFS GV+ V  P G 
Sbjct  5700  NVPNQHTLFCTRDFAMRNARGWLGFDVEGAHVIGSNVGTNVPLQLGFSNGVDFVVRPEGC  5759

Query  125   VDTPNNTDFSRVSAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSDRVVFV  184
             V T        V A+ PPGDQF HL+PL+ KG PW+V+R +IVQM SD L NLSD ++FV
Sbjct  5760  VSTEVGDVIQPVRARAPPGDQFTHLLPLLRKGQPWSVIRRRIVQMCSDYLANLSDTLIFV  5819

Query  185   LWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNPFMIDV  244
             LW+ G ELT+M+YFVK+GP +T C C +RATC+++ + T++C+ H++G DY+YN + ID+
Sbjct  5820  LWSGGLELTTMRYFVKLGPVQT-CDCGKRATCYNSTNHTFSCFRHALGSDYIYNCYCIDI  5878

Query  245   QQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEYPIIGDELK  304
             QQWG+TG+L  NH   C +H N HVAS DA MTRCLA+H+CFVK VDW+I YP I +E  
Sbjct  5879  QQWGYTGSLSMNHHEVCNIHRNEHVASGDAAMTRCLAIHDCFVKNVDWSITYPFIANEQA  5938

Query  305   INAACRKVQHMVVKAALLADKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDKAYKIE  364
             IN + R VQ  V++A L       +HD+GNPK I+CV   D  W  YD  P +     +E
Sbjct  5939  INKSGRLVQSHVMRAVLKLYNPKAIHDVGNPKGIRCVV-TDASWYCYDKNPTNTNVKMLE  5997

Query  365   ELFYSYATHSDKFTDGVCLFWNCNVDRYPANSIVCRFDTRVLSNLNLPGCDGGSLYVNKH  424
                Y Y TH     DG+CLFWNCNVD YP  S+VCRFDTR+ S LNL GC+GGSLYVN H
Sbjct  5998  ---YDYITHGQ--LDGLCLFWNCNVDMYPEFSVVCRFDTRMRSTLNLEGCNGGSLYVNNH  6052

Query  425   AFHTPAFDKSAFVNLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLGGAVC  484
             AFHTPA+DK AF  LK +PFF+Y DS CE    ++   ++YVPL+++ CITRCN+GGAVC
Sbjct  6053  AFHTPAYDKRAFAKLKAMPFFFYDDSECE----KLQDAVNYVPLRASNCITRCNVGGAVC  6108

Query  485   RHHANEYRLYLDAYNMMISAGFSLWVYKQFDTYNLWNTF  523
               H   Y  Y+ AYN   +AGF++WV   FD +NLW TF
Sbjct  6109  SKHCALYHNYVMAYNTFTTAGFTIWVPNSFDMFNLWQTF  6147


>sp|P0C6Y4|R1AB_PEDV7 Replicase polyprotein 1ab OS=Porcine epidemic 
diarrhea virus (strain CV777) OX=229032 GN=rep PE=1 SV=1
Length=6781

 Score = 560 bits (1442),  Expect = 5e-178, Method: Compositional matrix adjust.
 Identities = 270/519 (52%), Positives = 351/519 (68%), Gaps = 11/519 (2%)

Query  6     GLFKDCSKVITGLHPTQAPTHLSVDTKFKTEGLCVDIPGIPKDMTYRRLISMMGFKMNYQ  65
             GLFKDCS+    L P+ A T +S+   FKT+       G+   + Y  +IS MGF+ +  
Sbjct  5630  GLFKDCSRGDDLLPPSHANTFMSLADNFKTDQYLAVQIGVNGPIKYEHVISFMGFRFDIN  5689

Query  66    VNGYPNMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVAVPTGYV  125
             +  +  +F TR+ A+R+VR W+GFDVEG H     VGTN+PLQLGFS GV+ V  P G V
Sbjct  5690  IPNHHTLFCTRDFAMRNVRGWLGFDVEGAHVVGSNVGTNVPLQLGFSNGVDFVVRPEGCV  5749

Query  126   DTPNNTDFSRVSAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSDRVVFVL  185
              T +      V A+ PPG+QF HL+PL+ +G PW+VVR +IVQM SD L NLSD ++FVL
Sbjct  5750  VTESGDYIKPVRARAPPGEQFAHLLPLLKRGQPWDVVRKRIVQMCSDYLANLSDILIFVL  5809

Query  186   WAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNPFMIDVQ  245
             WA G ELT+M+YFVKIGP ++ C C + ATC+++A  TY C+ H++G DY+YNP+ ID+Q
Sbjct  5810  WAGGLELTTMRYFVKIGPSKS-CDCGKVATCYNSALHTYCCFKHALGCDYLYNPYCIDIQ  5868

Query  246   QWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEYPIIGDELKI  305
             QWG+ G+L  NH  +C VH N HVAS DAIMTRCLA+H+CFVK VDW+I YP IG+E  I
Sbjct  5869  QWGYKGSLSLNHHEHCNVHRNEHVASGDAIMTRCLAIHDCFVKNVDWSITYPFIGNEAVI  5928

Query  306   NAACRKVQHMVVKAALLADKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDKAYKIEE  365
             N + R VQ   +++ L       ++DIGNPK I+C    D +W  +D  P +     +E 
Sbjct  5929  NKSGRIVQSHTMRSVLKLYNPKAIYDIGNPKGIRCA-VTDAKWFCFDKNPTNSNVKTLE-  5986

Query  366   LFYSYATHSDKFTDGVCLFWNCNVDRYPANSIVCRFDTRVLSNLNLPGCDGGSLYVNKHA  425
               Y Y TH     DG+CLFWNCNVD YP  S+VCRFDTR  S LNL GC+GGSLYVN HA
Sbjct  5987  --YDYITHGQ--FDGLCLFWNCNVDMYPEFSVVCRFDTRCRSPLNLEGCNGGSLYVNNHA  6042

Query  426   FHTPAFDKSAFVNLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLGGAVCR  485
             FHTPAFDK AF  LK +PFF+Y D+ C+    ++   I+YVPL+++ CIT+CN+GGAVC 
Sbjct  6043  FHTPAFDKRAFAKLKPMPFFFYDDTECD----KLQDSINYVPLRASNCITKCNVGGAVCS  6098

Query  486   HHANEYRLYLDAYNMMISAGFSLWVYKQFDTYNLWNTFT  524
              H   Y  Y++AYN   SAGF++WV   FDTYNLW TF+
Sbjct  6099  KHCAMYHSYVNAYNTFTSAGFTIWVPTSFDTYNLWQTFS  6137


>sp|P0C6V8|R1AB_BRV1 Replicase polyprotein 1ab OS=Breda virus 
1 OX=360393 GN=rep PE=2 SV=1
Length=6733

 Score = 50.8 bits (120),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/101 (34%), Positives = 52/101 (51%), Gaps = 7/101 (7%)

Query  183   FVLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDTYACW--HHSIGFDYVYNPF  240
             F+L++   +L S+K++V+ G    C  C   A C       Y C   + ++    + N  
Sbjct  5953  FILYSCSNDLKSLKFYVEFGTNYFCS-CGELAICL-MRDGLYKCRNCYGNMSISKLVNCK  6010

Query  241   MIDVQQWGFTGNLQSNHDLYCQ-VHGNAHVASCDAIMTRCL  280
              +DVQ+      LQ  HD  CQ  HG++H A CDA+MT+CL
Sbjct  6011  YLDVQKERI--KLQDAHDAICQQFHGDSHEALCDAVMTKCL  6049


>sp|Q008X6|R1AB_WBV24 Replicase polyprotein 1ab OS=White bream 
virus (isolate Blicca bjoerkna L./Germany/DF24/00) OX=766180 
GN=rep PE=1 SV=1
Length=6872

 Score = 50.1 bits (118),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 37/110 (34%), Positives = 54/110 (49%), Gaps = 8/110 (7%)

Query  179   DRVVFVLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDTYA--CWHHS---IGF  233
             +RVV+VL+  G +L ++     +G + TC  C + AT ++   +     C HH+      
Sbjct  6074  NRVVYVLYGAGNDLRALTNLNIVG-DYTCEKCTKEATFYTIHREIVHTFCNHHAPSQFPL  6132

Query  234   DYVYNPFMIDVQQWGFTG-NLQSNHDLYC-QVHGNAHVASCDAIMTRCLA  281
                 N   ID+Q       +L + H   C Q HG+AH AS D IMT CLA
Sbjct  6133  MGTINAQAIDIQHASANKQSLTNTHAEVCNQQHGDAHTASADTIMTGCLA  6182


>sp|P0C6V7|R1AB_BEV Replicase polyprotein 1ab OS=Berne virus OX=11156 
GN=rep PE=1 SV=1
Length=6857

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 53/103 (51%), Gaps = 11/103 (11%)

Query  183   FVLWAHGFELTSMKYFVKIGPERTC--CLCDRRATCFSTASDTYACW--HHSIGFDYVYN  238
             F+L++   +L S+K++V+     TC  C C   A C     + Y C   +  +    + N
Sbjct  6077  FILYSCSNDLKSLKFYVEFD---TCYFCSCGEMAICLMRDGN-YKCRNCYGGMLISKLVN  6132

Query  239   PFMIDVQQWGFTGNLQSNHDLYCQ-VHGNAHVASCDAIMTRCL  280
                +DVQ+      LQ  HD  CQ  HG++H A CDA+MT+CL
Sbjct  6133  CKYLDVQKERV--KLQDAHDAICQQFHGDSHEALCDAVMTKCL  6173


>sp|Q9RL17|BVMO1_STRCO Baeyer-Villiger monooxygenase OS=Streptomyces 
coelicolor (strain ATCC BAA-471 / A3(2) / M145) OX=100226 
GN=SCO0300 PE=1 SV=1
Length=603

 Score = 33.5 bits (75),  Expect = 5.2, Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 37/93 (40%), Gaps = 8/93 (9%)

Query  347  EWKFYDAQPCSDKAYKIEELF--YSYATHSDKFT----DGVCLFWNCNVDRYPA-NSIVC  399
            EWK+   +     A +I E F  Y+    S   T    D     W    DR+ A  +   
Sbjct  132  EWKYAPGEEIRRHAMRIAETFDLYTDVLFSTAVTSLSWDDTTGEWIVETDRHDAFRATYV  191

Query  400  RFDTRVLSNLNLPGCDGGSLYVNKHAFHTPAFD  432
               T VLS L LPG  G   +   H FHT  +D
Sbjct  192  ITATGVLSELKLPGIPGIERF-KGHTFHTSRWD  223


>sp|Q7Z7M0|MEGF8_HUMAN Multiple epidermal growth factor-like domains 
protein 8 OS=Homo sapiens OX=9606 GN=MEGF8 PE=1 SV=2
Length=2845

 Score = 33.5 bits (75),  Expect = 6.1, Method: Composition-based stats.
 Identities = 24/86 (28%), Positives = 34/86 (40%), Gaps = 10/86 (12%)

Query  203   PERTCCLCDRRATCFSTASDTYAC-WHHSIGFDYVYNPFMIDVQQWGFTGNLQSNHDLYC  261
             PE    LC +R TC    +++  C W  S    +++  ++      G  G   S      
Sbjct  943   PEECPPLCSQRLTCEDCLANSSQCAWCQSTHTCFLFAAYLARYPHGGCRGWDDS------  996

Query  262   QVHGNAHVASCDAIMT--RCLAVHEC  285
              VH      SCD  +T   CL  HEC
Sbjct  997   -VHSEPRCRSCDGFLTCHECLQSHEC  1021


>sp|Q8G500|LEU3_BIFLO 3-isopropylmalate dehydrogenase OS=Bifidobacterium 
longum (strain NCC 2705) OX=206672 GN=leuB PE=3 SV=1
Length=343

 Score = 33.1 bits (74),  Expect = 6.2, Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 28/60 (47%), Gaps = 5/60 (8%)

Query  431  FDKSAFVNLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLGGAVCRHHANE  490
            FD   +VNL+    +    SP  + G     DID+V ++  T    C  GGAV R+   E
Sbjct  95   FDLDQYVNLRPSKLYKGVTSPLANPG-----DIDFVVVREGTEGLYCGAGGAVRRNTPQE  149


>sp|B3DTF8|LEU3_BIFLD 3-isopropylmalate dehydrogenase OS=Bifidobacterium 
longum (strain DJO10A) OX=205913 GN=leuB PE=3 SV=1
Length=343

 Score = 33.1 bits (74),  Expect = 6.2, Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 28/60 (47%), Gaps = 5/60 (8%)

Query  431  FDKSAFVNLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLGGAVCRHHANE  490
            FD   +VNL+    +    SP  + G     DID+V ++  T    C  GGAV R+   E
Sbjct  95   FDLDQYVNLRPSKLYKGVTSPLANPG-----DIDFVVVREGTEGLYCGAGGAVRRNTPQE  149


>sp|B7GUI8|LEU3_BIFLS 3-isopropylmalate dehydrogenase OS=Bifidobacterium 
longum subsp. infantis (strain ATCC 15697 / DSM 20088 
/ JCM 1222 / NCTC 11817 / S12) OX=391904 GN=leuB PE=3 SV=1
Length=343

 Score = 33.1 bits (74),  Expect = 6.4, Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 28/60 (47%), Gaps = 5/60 (8%)

Query  431  FDKSAFVNLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLGGAVCRHHANE  490
            FD   +VNL+    +    SP  + G     DID+V ++  T    C  GGAV R+   E
Sbjct  95   FDLDQYVNLRPSKLYKGVTSPLANPG-----DIDFVVVREGTEGLYCGAGGAVRRNTPQE  149


>sp|Q0D8D4|NADE_ORYSJ Glutamine-dependent NAD(+) synthetase OS=Oryza 
sativa subsp. japonica OX=39947 GN=Os07g0167100 PE=3 
SV=2
Length=735

 Score = 33.1 bits (74),  Expect = 8.8, Method: Compositional matrix adjust.
 Identities = 32/112 (29%), Positives = 46/112 (41%), Gaps = 14/112 (13%)

Query  318  KAALLADKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDKAYKIEELFYSYATHSDKF  377
            K AL+  + P+  DI    +   VP      +F D    S+     EELF + A   D  
Sbjct  134  KDALVDFQLPL--DISEVTSQDTVPFGYGFIQFLDVSLASETC---EELFTANAPRIDLA  188

Query  378  TDGVCLFWNCNVDRYPANSIVCRFDTRVLSNL---------NLPGCDGGSLY  420
             +GV +F N +   +    +  R D+   + L         N  GCDGG LY
Sbjct  189  LNGVEVFVNASGSHHQLRKLSLRIDSMRNATLACGGVYMYANQQGCDGGRLY  240


>sp|A2YII8|NADE_ORYSI Glutamine-dependent NAD(+) synthetase OS=Oryza 
sativa subsp. indica OX=39946 GN=OsI_25032 PE=3 SV=1
Length=735

 Score = 33.1 bits (74),  Expect = 8.8, Method: Compositional matrix adjust.
 Identities = 32/112 (29%), Positives = 46/112 (41%), Gaps = 14/112 (13%)

Query  318  KAALLADKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDKAYKIEELFYSYATHSDKF  377
            K AL+  + P+  DI    +   VP      +F D    S+     EELF + A   D  
Sbjct  134  KDALVDFQLPL--DISEVTSQDTVPFGYGFIQFLDVSLASETC---EELFTANAPRIDLA  188

Query  378  TDGVCLFWNCNVDRYPANSIVCRFDTRVLSNL---------NLPGCDGGSLY  420
             +GV +F N +   +    +  R D+   + L         N  GCDGG LY
Sbjct  189  LNGVEVFVNASGSHHQLRKLSLRIDSMRNATLACGGVYMYANQQGCDGGRLY  240



Lambda      K        H        a         alpha
   0.325    0.138    0.455    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 54163932156
Results from round 2


Query= YP_009725309.1 3'-to-5' exonuclease [Severe acute respiratory
syndrome coronavirus 2]

Length=527
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value
Sequences used in model and found again:

sp|P0C6W6|R1AB_BCRP3 Replicase polyprotein 1ab OS=Bat coronavirus...  941     0.0  
sp|P0DTD1|R1AB_SARS2 Replicase polyprotein 1ab OS=Severe acute re...  940     0.0  
sp|P0C6X7|R1AB_SARS Replicase polyprotein 1ab OS=Severe acute res...  938     0.0  
sp|P0C6W2|R1AB_BCHK3 Replicase polyprotein 1ab OS=Bat coronavirus...  937     0.0  
sp|P0C6V9|R1AB_BC279 Replicase polyprotein 1ab OS=Bat coronavirus...  937     0.0  
sp|P0C6W4|R1AB_BCHK5 Replicase polyprotein 1ab OS=Bat coronavirus...  905     0.0  
sp|K9N7C7|R1AB_MERS1 Replicase polyprotein 1ab OS=Middle East res...  898     0.0  
sp|P0C6W1|R1AB_BC133 Replicase polyprotein 1ab OS=Bat coronavirus...  893     0.0  
sp|P0C6W3|R1AB_BCHK4 Replicase polyprotein 1ab OS=Bat coronavirus...  891     0.0  
sp|P0C6X8|R1AB_CVM2 Replicase polyprotein 1ab OS=Murine coronavir...  888     0.0  
sp|P0C6X9|R1AB_CVMA5 Replicase polyprotein 1ab OS=Murine coronavi...  885     0.0  
sp|P0C6X4|R1AB_CVHN5 Replicase polyprotein 1ab OS=Human coronavir...  879     0.0  
sp|P0C6X2|R1AB_CVHN1 Replicase polyprotein 1ab OS=Human coronavir...  879     0.0  
sp|P0C6W8|R1AB_CVBLU Replicase polyprotein 1ab OS=Bovine coronavi...  878     0.0  
sp|P0C6W7|R1AB_CVBEN Replicase polyprotein 1ab OS=Bovine coronavi...  878     0.0  
sp|P0C6X3|R1AB_CVHN2 Replicase polyprotein 1ab OS=Human coronavir...  875     0.0  
sp|P0C6Y4|R1AB_PEDV7 Replicase polyprotein 1ab OS=Porcine epidemi...  875     0.0  
sp|P0C6X6|R1AB_CVHOC Replicase polyprotein 1ab OS=Human coronavir...  873     0.0  
sp|P0C6X0|R1AB_CVBQ Replicase polyprotein 1ab OS=Bovine coronavir...  872     0.0  
sp|P0C6W0|R1AB_BC512 Replicase polyprotein 1ab OS=Bat coronavirus...  871     0.0  
sp|P0C6X1|R1AB_CVH22 Replicase polyprotein 1ab OS=Human coronavir...  869     0.0  
sp|P0C6W9|R1AB_CVBM Replicase polyprotein 1ab OS=Bovine coronavir...  869     0.0  
sp|P0C6Y0|R1AB_CVMJH Replicase polyprotein 1ab OS=Murine coronavi...  868     0.0  
sp|P0C6X5|R1AB_CVHNL Replicase polyprotein 1ab OS=Human coronavir...  861     0.0  
sp|P0C6W5|R1AB_BCHK9 Replicase polyprotein 1ab OS=Bat coronavirus...  861     0.0  
sp|Q98VG9|R1AB_FIPV Replicase polyprotein 1ab OS=Feline coronavir...  860     0.0  
sp|P0C6Y5|R1AB_CVPPU Replicase polyprotein 1ab OS=Porcine transmi...  858     0.0  
sp|P0C6Y3|R1AB_IBVM Replicase polyprotein 1ab OS=Avian infectious...  825     0.0  
sp|P0C6Y2|R1AB_IBVBC Replicase polyprotein 1ab OS=Avian infectiou...  814     0.0  
sp|P0C6Y1|R1AB_IBVB Replicase polyprotein 1ab OS=Avian infectious...  814     0.0  
sp|Q008X6|R1AB_WBV24 Replicase polyprotein 1ab OS=White bream vir...  117     4e-26
sp|P0C6V8|R1AB_BRV1 Replicase polyprotein 1ab OS=Breda virus 1 OX...  117     4e-26
sp|P0C6V7|R1AB_BEV Replicase polyprotein 1ab OS=Berne virus OX=11...  112     2e-24

Sequences not found previously or not previously below threshold:

sp|P0C664|ZWILC_CAEBR Protein zwilch homolog OS=Caenorhabditis br...  34.2    3.9  


>sp|P0C6W6|R1AB_BCRP3 Replicase polyprotein 1ab OS=Bat coronavirus 
Rp3/2004 OX=349344 GN=rep PE=3 SV=1
Length=7071

 Score = 941 bits (2433),  Expect = 0.0, Method: Composition-based stats.
 Identities = 503/527 (95%), Positives = 521/527 (99%), Gaps = 0/527 (0%)

Query  1     AENVTGLFKDCSKVITGLHPTQAPTHLSVDTKFKTEGLCVDIPGIPKDMTYRRLISMMGF  60
             AENVTGLFKDCSK+ITGLHPTQAPTHLSVDTKFKTEGLCVDIPGIPKDMTYRRLISMMGF
Sbjct  5901  AENVTGLFKDCSKIITGLHPTQAPTHLSVDTKFKTEGLCVDIPGIPKDMTYRRLISMMGF  5960

Query  61    KMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVAV  120
             KMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATR+AVGTNLPLQLGFSTGVNLVA+
Sbjct  5961  KMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATRDAVGTNLPLQLGFSTGVNLVAI  6020

Query  121   PTGYVDTPNNTDFSRVSAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSDR  180
             PTGYVDT NNT+F+RV+AKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLK LSDR
Sbjct  6021  PTGYVDTENNTEFTRVNAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKGLSDR  6080

Query  181   VVFVLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNPF  240
             VVFVLWAHGFELTSMKYFVKIGPERTCCLCD+RATCFST+SDTYACW+HS+GFDYVYNPF
Sbjct  6081  VVFVLWAHGFELTSMKYFVKIGPERTCCLCDKRATCFSTSSDTYACWNHSVGFDYVYNPF  6140

Query  241   MIDVQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEYPIIG  300
             MIDVQQWGFTGNLQSNHD +CQVHGNAHVASCDAIMTRCLAVHECFVKRVDW++EYPIIG
Sbjct  6141  MIDVQQWGFTGNLQSNHDQHCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWSVEYPIIG  6200

Query  301   DELKINAACRKVQHMVVKAALLADKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDKA  360
             DELKIN+ACRKVQHMVVK+ALLADKFPVLHDIGNPKAIKCVPQA+VEWKFYDAQPCSDKA
Sbjct  6201  DELKINSACRKVQHMVVKSALLADKFPVLHDIGNPKAIKCVPQAEVEWKFYDAQPCSDKA  6260

Query  361   YKIEELFYSYATHSDKFTDGVCLFWNCNVDRYPANSIVCRFDTRVLSNLNLPGCDGGSLY  420
             YKIEELFYSYATH DKFTDGVCLFWNCNVDRYPAN+IVCRFDTRVLSNLNLPGCDGGSLY
Sbjct  6261  YKIEELFYSYATHHDKFTDGVCLFWNCNVDRYPANAIVCRFDTRVLSNLNLPGCDGGSLY  6320

Query  421   VNKHAFHTPAFDKSAFVNLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLG  480
             VNKHAFHTPAFDKSAF NLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLG
Sbjct  6321  VNKHAFHTPAFDKSAFTNLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLG  6380

Query  481   GAVCRHHANEYRLYLDAYNMMISAGFSLWVYKQFDTYNLWNTFTRLQ  527
             GAVCRHHANEYR YLDAYNMMISAGFSLW+YKQFDTYNLWNTFTRLQ
Sbjct  6381  GAVCRHHANEYRQYLDAYNMMISAGFSLWIYKQFDTYNLWNTFTRLQ  6427


>sp|P0DTD1|R1AB_SARS2 Replicase polyprotein 1ab OS=Severe acute 
respiratory syndrome coronavirus 2 OX=2697049 GN=rep PE=1 
SV=1
Length=7096

 Score = 940 bits (2430),  Expect = 0.0, Method: Composition-based stats.
 Identities = 527/527 (100%), Positives = 527/527 (100%), Gaps = 0/527 (0%)

Query  1     AENVTGLFKDCSKVITGLHPTQAPTHLSVDTKFKTEGLCVDIPGIPKDMTYRRLISMMGF  60
             AENVTGLFKDCSKVITGLHPTQAPTHLSVDTKFKTEGLCVDIPGIPKDMTYRRLISMMGF
Sbjct  5926  AENVTGLFKDCSKVITGLHPTQAPTHLSVDTKFKTEGLCVDIPGIPKDMTYRRLISMMGF  5985

Query  61    KMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVAV  120
             KMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVAV
Sbjct  5986  KMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVAV  6045

Query  121   PTGYVDTPNNTDFSRVSAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSDR  180
             PTGYVDTPNNTDFSRVSAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSDR
Sbjct  6046  PTGYVDTPNNTDFSRVSAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSDR  6105

Query  181   VVFVLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNPF  240
             VVFVLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNPF
Sbjct  6106  VVFVLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNPF  6165

Query  241   MIDVQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEYPIIG  300
             MIDVQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEYPIIG
Sbjct  6166  MIDVQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEYPIIG  6225

Query  301   DELKINAACRKVQHMVVKAALLADKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDKA  360
             DELKINAACRKVQHMVVKAALLADKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDKA
Sbjct  6226  DELKINAACRKVQHMVVKAALLADKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDKA  6285

Query  361   YKIEELFYSYATHSDKFTDGVCLFWNCNVDRYPANSIVCRFDTRVLSNLNLPGCDGGSLY  420
             YKIEELFYSYATHSDKFTDGVCLFWNCNVDRYPANSIVCRFDTRVLSNLNLPGCDGGSLY
Sbjct  6286  YKIEELFYSYATHSDKFTDGVCLFWNCNVDRYPANSIVCRFDTRVLSNLNLPGCDGGSLY  6345

Query  421   VNKHAFHTPAFDKSAFVNLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLG  480
             VNKHAFHTPAFDKSAFVNLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLG
Sbjct  6346  VNKHAFHTPAFDKSAFVNLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLG  6405

Query  481   GAVCRHHANEYRLYLDAYNMMISAGFSLWVYKQFDTYNLWNTFTRLQ  527
             GAVCRHHANEYRLYLDAYNMMISAGFSLWVYKQFDTYNLWNTFTRLQ
Sbjct  6406  GAVCRHHANEYRLYLDAYNMMISAGFSLWVYKQFDTYNLWNTFTRLQ  6452


>sp|P0C6X7|R1AB_SARS Replicase polyprotein 1ab OS=Severe acute 
respiratory syndrome coronavirus OX=694009 GN=rep PE=1 SV=1
Length=7073

 Score = 938 bits (2424),  Expect = 0.0, Method: Composition-based stats.
 Identities = 501/527 (95%), Positives = 520/527 (99%), Gaps = 0/527 (0%)

Query  1     AENVTGLFKDCSKVITGLHPTQAPTHLSVDTKFKTEGLCVDIPGIPKDMTYRRLISMMGF  60
             AENVTGLFKDCSK+ITGLHPTQAPTHLSVD KFKTEGLCVDIPGIPKDMTYRRLISMMGF
Sbjct  5903  AENVTGLFKDCSKIITGLHPTQAPTHLSVDIKFKTEGLCVDIPGIPKDMTYRRLISMMGF  5962

Query  61    KMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVAV  120
             KMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATR+AVGTNLPLQLGFSTGVNLVAV
Sbjct  5963  KMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATRDAVGTNLPLQLGFSTGVNLVAV  6022

Query  121   PTGYVDTPNNTDFSRVSAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSDR  180
             PTGYVDT NNT+F+RV+AKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLK LSDR
Sbjct  6023  PTGYVDTENNTEFTRVNAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKGLSDR  6082

Query  181   VVFVLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNPF  240
             VVFVLWAHGFELTSMKYFVKIGPERTCCLCD+RATCFST+SDTYACW+HS+GFDYVYNPF
Sbjct  6083  VVFVLWAHGFELTSMKYFVKIGPERTCCLCDKRATCFSTSSDTYACWNHSVGFDYVYNPF  6142

Query  241   MIDVQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEYPIIG  300
             MIDVQQWGFTGNLQSNHD +CQVHGNAHVASCDAIMTRCLAVHECFVKRVDW++EYPIIG
Sbjct  6143  MIDVQQWGFTGNLQSNHDQHCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWSVEYPIIG  6202

Query  301   DELKINAACRKVQHMVVKAALLADKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDKA  360
             DEL++N+ACRKVQHMVVK+ALLADKFPVLHDIGNPKAIKCVPQA+VEWKFYDAQPCSDKA
Sbjct  6203  DELRVNSACRKVQHMVVKSALLADKFPVLHDIGNPKAIKCVPQAEVEWKFYDAQPCSDKA  6262

Query  361   YKIEELFYSYATHSDKFTDGVCLFWNCNVDRYPANSIVCRFDTRVLSNLNLPGCDGGSLY  420
             YKIEELFYSYATH DKFTDGVCLFWNCNVDRYPAN+IVCRFDTRVLSNLNLPGCDGGSLY
Sbjct  6263  YKIEELFYSYATHHDKFTDGVCLFWNCNVDRYPANAIVCRFDTRVLSNLNLPGCDGGSLY  6322

Query  421   VNKHAFHTPAFDKSAFVNLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLG  480
             VNKHAFHTPAFDKSAF NLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLG
Sbjct  6323  VNKHAFHTPAFDKSAFTNLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLG  6382

Query  481   GAVCRHHANEYRLYLDAYNMMISAGFSLWVYKQFDTYNLWNTFTRLQ  527
             GAVCRHHANEYR YLDAYNMMISAGFSLW+YKQFDTYNLWNTFTRLQ
Sbjct  6383  GAVCRHHANEYRQYLDAYNMMISAGFSLWIYKQFDTYNLWNTFTRLQ  6429


>sp|P0C6W2|R1AB_BCHK3 Replicase polyprotein 1ab OS=Bat coronavirus 
HKU3 OX=442736 GN=rep PE=3 SV=1
Length=7067

 Score = 937 bits (2423),  Expect = 0.0, Method: Composition-based stats.
 Identities = 499/527 (95%), Positives = 520/527 (99%), Gaps = 0/527 (0%)

Query  1     AENVTGLFKDCSKVITGLHPTQAPTHLSVDTKFKTEGLCVDIPGIPKDMTYRRLISMMGF  60
             AENVTGLFKDCSK+ITGLHPTQAPTHLSVDTKFKTEGLCVDIPGIPKDMTYRRLISMMGF
Sbjct  5897  AENVTGLFKDCSKIITGLHPTQAPTHLSVDTKFKTEGLCVDIPGIPKDMTYRRLISMMGF  5956

Query  61    KMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVAV  120
             KMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATR+AVGTNLPLQLGFSTGVNLVAV
Sbjct  5957  KMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATRDAVGTNLPLQLGFSTGVNLVAV  6016

Query  121   PTGYVDTPNNTDFSRVSAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSDR  180
             PTGYVDT N+T+F+RV+AKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLK LSDR
Sbjct  6017  PTGYVDTENSTEFTRVNAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKGLSDR  6076

Query  181   VVFVLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNPF  240
             VVFVLWAHGFELTSMKYFVKIGPERTCCLCD+RATCFST+SDTYACW+HS+GFDYVYNPF
Sbjct  6077  VVFVLWAHGFELTSMKYFVKIGPERTCCLCDKRATCFSTSSDTYACWNHSVGFDYVYNPF  6136

Query  241   MIDVQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEYPIIG  300
             MIDVQQWGFTGNLQSNHD +CQVHGNAHVASCDAIMTRCLAVHECFVKRVDW++EYPIIG
Sbjct  6137  MIDVQQWGFTGNLQSNHDQHCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWSVEYPIIG  6196

Query  301   DELKINAACRKVQHMVVKAALLADKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDKA  360
             DELKINAACRKVQHMVVK+ALLADKF VLHDIGNPKAI+CVPQA+V+WKFYDAQPCSDKA
Sbjct  6197  DELKINAACRKVQHMVVKSALLADKFTVLHDIGNPKAIRCVPQAEVDWKFYDAQPCSDKA  6256

Query  361   YKIEELFYSYATHSDKFTDGVCLFWNCNVDRYPANSIVCRFDTRVLSNLNLPGCDGGSLY  420
             YKIEELFYSYATH DKFTDGVCLFWNCNVDRYPAN+IVCRFDTRVLSNLNLPGCDGGSLY
Sbjct  6257  YKIEELFYSYATHHDKFTDGVCLFWNCNVDRYPANAIVCRFDTRVLSNLNLPGCDGGSLY  6316

Query  421   VNKHAFHTPAFDKSAFVNLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLG  480
             VNKHAFHTPAFDKSAF +LKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLG
Sbjct  6317  VNKHAFHTPAFDKSAFTHLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLG  6376

Query  481   GAVCRHHANEYRLYLDAYNMMISAGFSLWVYKQFDTYNLWNTFTRLQ  527
             GAVCRHHANEYR YLDAYNMMISAGFSLW+YKQFDTYNLWNTFT+LQ
Sbjct  6377  GAVCRHHANEYRQYLDAYNMMISAGFSLWIYKQFDTYNLWNTFTKLQ  6423


>sp|P0C6V9|R1AB_BC279 Replicase polyprotein 1ab OS=Bat coronavirus 
279/2005 OX=389167 GN=rep PE=3 SV=1
Length=7079

 Score = 937 bits (2421),  Expect = 0.0, Method: Composition-based stats.
 Identities = 502/527 (95%), Positives = 518/527 (98%), Gaps = 0/527 (0%)

Query  1     AENVTGLFKDCSKVITGLHPTQAPTHLSVDTKFKTEGLCVDIPGIPKDMTYRRLISMMGF  60
             AENVTGLFKDCSK+ITGLHPTQAPTHLSVDTKFKTEGLCVDIPGIPKDMTYRRLISMMGF
Sbjct  5909  AENVTGLFKDCSKIITGLHPTQAPTHLSVDTKFKTEGLCVDIPGIPKDMTYRRLISMMGF  5968

Query  61    KMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVAV  120
             KMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATR+AVGTNLPLQLGFSTGVNLVAV
Sbjct  5969  KMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATRDAVGTNLPLQLGFSTGVNLVAV  6028

Query  121   PTGYVDTPNNTDFSRVSAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSDR  180
             PTGYVDT NNT+F+RV+AKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLK LSDR
Sbjct  6029  PTGYVDTENNTEFTRVNAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKGLSDR  6088

Query  181   VVFVLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNPF  240
             VVFVLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFST+SDTYACW+HS+GFDYVYNPF
Sbjct  6089  VVFVLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTSSDTYACWNHSVGFDYVYNPF  6148

Query  241   MIDVQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEYPIIG  300
             MIDVQQWGFTGNLQSNHD +CQVHGNAHVASCDAIMTRCLAVHECFVKRVDW++EYPIIG
Sbjct  6149  MIDVQQWGFTGNLQSNHDQHCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWSVEYPIIG  6208

Query  301   DELKINAACRKVQHMVVKAALLADKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDKA  360
             DELKINAACRKVQHMVVK+ALLADKF VLHDIGNPKAIKCVPQA+V+WKFYDAQPCSDKA
Sbjct  6209  DELKINAACRKVQHMVVKSALLADKFSVLHDIGNPKAIKCVPQAEVDWKFYDAQPCSDKA  6268

Query  361   YKIEELFYSYATHSDKFTDGVCLFWNCNVDRYPANSIVCRFDTRVLSNLNLPGCDGGSLY  420
             YKIEELFYSYATH DKFTDGVCLFWNCNVDRYPAN+IVCRFDTRVLSNLNLPGCDGGSLY
Sbjct  6269  YKIEELFYSYATHHDKFTDGVCLFWNCNVDRYPANAIVCRFDTRVLSNLNLPGCDGGSLY  6328

Query  421   VNKHAFHTPAFDKSAFVNLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLG  480
             VNKHAFHTPAFDKSAF  LKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLG
Sbjct  6329  VNKHAFHTPAFDKSAFTYLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLG  6388

Query  481   GAVCRHHANEYRLYLDAYNMMISAGFSLWVYKQFDTYNLWNTFTRLQ  527
             GAVCR HANEYR YLDAYNMMISAGFSLW+YKQFDTYNLWNTFTRLQ
Sbjct  6389  GAVCRRHANEYRQYLDAYNMMISAGFSLWIYKQFDTYNLWNTFTRLQ  6435


>sp|P0C6W4|R1AB_BCHK5 Replicase polyprotein 1ab OS=Bat coronavirus 
HKU5 OX=694008 GN=rep PE=3 SV=1
Length=7182

 Score = 905 bits (2339),  Expect = 0.0, Method: Composition-based stats.
 Identities = 328/529 (62%), Positives = 409/529 (77%), Gaps = 7/529 (1%)

Query  1     AENVTGLFKDCSKVITGLHPTQAPTHLSVDTKFKT-EGLCVDIPGIPKDMTYRRLISMMG  59
             ++ VTGL+KDCS+  +GLHP  APT++SVD K+KT + LCV++  +P ++ Y R+IS MG
Sbjct  6000  SQIVTGLYKDCSRESSGLHPAYAPTYVSVDDKYKTSDELCVNL-NVPANVPYSRVISRMG  6058

Query  60    FKMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVA  119
             FK++  +  YP +FITR+EAIR VR+WIGFDVEG HA+R A GTN+PLQLGFSTGVN V 
Sbjct  6059  FKLDASIPNYPKLFITRDEAIRQVRSWIGFDVEGAHASRNACGTNVPLQLGFSTGVNFVV  6118

Query  120   VPTGYVDTPNNTDFSRVSAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSD  179
              P G VDT   +  + ++A+PPPG+QFKHL+PLM KG  W +VR +IVQMLSDTL  LSD
Sbjct  6119  QPVGVVDTEWGSMLTSIAARPPPGEQFKHLVPLMNKGAAWPIVRRRIVQMLSDTLDKLSD  6178

Query  180   RVVFVLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNP  239
                FV WAHGFELTS  YF KIG E+ CC+C+RRA+ +S+   +YACW HS G+DYVYNP
Sbjct  6179  YCTFVCWAHGFELTSASYFCKIGKEQRCCMCNRRASTYSSPLHSYACWSHSSGYDYVYNP  6238

Query  240   FMIDVQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEYPII  299
             F +DVQQWG+ GNL +NHD YC VH  AHVAS DA+MTRCLA+H+CF++RV+W I YP I
Sbjct  6239  FFVDVQQWGYIGNLATNHDRYCSVHQGAHVASNDAVMTRCLAIHDCFIERVEWDITYPYI  6298

Query  300   GDELKINAACRKVQHMVVKAALLADKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDK  359
               E ++N+ CR V+  VV+AALLA +F  ++DIGNPK I  V    V+W +YDAQP S  
Sbjct  6299  SHEKRLNSCCRAVERNVVRAALLAGRFERVYDIGNPKGIPIVDDPVVDWHYYDAQPLS--  6356

Query  360   AYKIEELFYSYATHSDKFTDGVCLFWNCNVDRYPANSIVCRFDTRVLSNLNLPGCDGGSL  419
               K+++LFY+    +  F+DG+CLFWNCNV RYP N+IVCRFDTRV S  NLPGCDGGSL
Sbjct  6357  -KKVQQLFYTED-CAKNFSDGLCLFWNCNVPRYPNNAIVCRFDTRVHSEFNLPGCDGGSL  6414

Query  420   YVNKHAFHTPAFDKSAFVNLKQLPFFYYSDSPCESHG-KQVVSDIDYVPLKSATCITRCN  478
             YVNKHAFHTPA+D SAF +LK LPFFYYS +PCE HG   ++ DIDYVPLKSA CIT CN
Sbjct  6415  YVNKHAFHTPAYDASAFRDLKPLPFFYYSTTPCEVHGNGNMLEDIDYVPLKSAVCITACN  6474

Query  479   LGGAVCRHHANEYRLYLDAYNMMISAGFSLWVYKQFDTYNLWNTFTRLQ  527
             LGGAVCR HA EYR Y++AYN++ ++GF LW YK FD YNLW+TFT++Q
Sbjct  6475  LGGAVCRKHAAEYRDYMEAYNLVSASGFRLWCYKTFDVYNLWSTFTKIQ  6523


>sp|K9N7C7|R1AB_MERS1 Replicase polyprotein 1ab OS=Middle East 
respiratory syndrome-related coronavirus (isolate United Kingdom/H123990006/2012) 
OX=1263720 GN=rep PE=1 SV=1
Length=7078

 Score = 898 bits (2320),  Expect = 0.0, Method: Composition-based stats.
 Identities = 331/529 (63%), Positives = 407/529 (77%), Gaps = 7/529 (1%)

Query  1     AENVTGLFKDCSKVITGLHPTQAPTHLSVDTKFKT-EGLCVDIPGIPKDMTYRRLISMMG  59
             ++ VTGLFKDCS+  +GL P  APT++SVD K+KT + LCV++  +P ++ Y R+IS MG
Sbjct  5909  SQIVTGLFKDCSRETSGLSPAYAPTYVSVDDKYKTSDELCVNL-NLPANVPYSRVISRMG  5967

Query  60    FKMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVA  119
             FK++  V GYP +FITREEA+R VR+WIGFDVEG HA+R A GTN+PLQLGFSTGVN V 
Sbjct  5968  FKLDATVPGYPKLFITREEAVRQVRSWIGFDVEGAHASRNACGTNVPLQLGFSTGVNFVV  6027

Query  120   VPTGYVDTPNNTDFSRVSAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSD  179
              P G VDT      + ++A+PPPG+QFKHL+PLM+KG  W +VR +IVQMLSDTL  LSD
Sbjct  6028  QPVGVVDTEWGNMLTGIAARPPPGEQFKHLVPLMHKGAAWPIVRRRIVQMLSDTLDKLSD  6087

Query  180   RVVFVLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNP  239
                FV WAHGFELTS  YF KIG E+ CC+C+RRA  +S+   +YACW HS G+DYVYNP
Sbjct  6088  YCTFVCWAHGFELTSASYFCKIGKEQKCCMCNRRAAAYSSPLQSYACWTHSCGYDYVYNP  6147

Query  240   FMIDVQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEYPII  299
             F +DVQQWG+ GNL +NHD YC VH  AHVAS DAIMTRCLA+H CF++RVDW IEYP I
Sbjct  6148  FFVDVQQWGYVGNLATNHDRYCSVHQGAHVASNDAIMTRCLAIHSCFIERVDWDIEYPYI  6207

Query  300   GDELKINAACRKVQHMVVKAALLADKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDK  359
               E K+N+ CR V+  VV+AALLA  F  ++DIGNPK I  V    V+W ++DAQP +  
Sbjct  6208  SHEKKLNSCCRIVERNVVRAALLAGSFDKVYDIGNPKGIPIVDDPVVDWHYFDAQPLT--  6265

Query  360   AYKIEELFYSYATHSDKFTDGVCLFWNCNVDRYPANSIVCRFDTRVLSNLNLPGCDGGSL  419
               K+++LFY+    + +F DG+CLFWNCNV +YP N+IVCRFDTRV S  NLPGCDGGSL
Sbjct  6266  -RKVQQLFYTEDM-ASRFADGLCLFWNCNVPKYPNNAIVCRFDTRVHSEFNLPGCDGGSL  6323

Query  420   YVNKHAFHTPAFDKSAFVNLKQLPFFYYSDSPCESHG-KQVVSDIDYVPLKSATCITRCN  478
             YVNKHAFHTPA+D SAF +LK LPFFYYS +PCE HG   ++ DIDYVPLKSA CIT CN
Sbjct  6324  YVNKHAFHTPAYDVSAFRDLKPLPFFYYSTTPCEVHGNGSMIEDIDYVPLKSAVCITACN  6383

Query  479   LGGAVCRHHANEYRLYLDAYNMMISAGFSLWVYKQFDTYNLWNTFTRLQ  527
             LGGAVCR HA EYR Y++AYN++ ++GF LW YK FD YNLW+TFT++Q
Sbjct  6384  LGGAVCRKHATEYREYMEAYNLVSASGFRLWCYKTFDIYNLWSTFTKVQ  6432


>sp|P0C6W1|R1AB_BC133 Replicase polyprotein 1ab OS=Bat coronavirus 
133/2005 OX=389230 GN=rep PE=3 SV=1
Length=7126

 Score = 893 bits (2309),  Expect = 0.0, Method: Composition-based stats.
 Identities = 329/529 (62%), Positives = 408/529 (77%), Gaps = 8/529 (2%)

Query  1     AENVTGLFKDCSKVITGLHPTQAPTHLSVDTKFKT-EGLCVDIPGIPKDMTYRRLISMMG  59
             ++ VTGLFKDCS+   GL P  APT+LSVD K+KT + LCV++  I  ++TY R+IS MG
Sbjct  5960  SQIVTGLFKDCSREDVGLPPAYAPTYLSVDAKYKTTDELCVNL-NITPNVTYSRVISRMG  6018

Query  60    FKMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVA  119
             FK++  + GYP +FITR+EAIR VR+WIGFDVEG HA+R A GTN+PLQLGFSTGVN V 
Sbjct  6019  FKLDATIPGYPKLFITRDEAIRQVRSWIGFDVEGAHASRNACGTNVPLQLGFSTGVNFVV  6078

Query  120   VPTGYVDTPNNTDFSRVSAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSD  179
              P G VDT   +  + +SA+PPPG+QFKHL+PLM KG  W +VR +IVQMLSDTL  LSD
Sbjct  6079  QPVGVVDTEWGSMLTTISARPPPGEQFKHLVPLMNKGATWPIVRRRIVQMLSDTLDKLSD  6138

Query  180   RVVFVLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNP  239
                FV WAHGFELTS  YF KIG E+ CC+C RRA+ FS+   +YACW HS G+DYVYNP
Sbjct  6139  YCTFVCWAHGFELTSASYFCKIGKEQRCCMCSRRASTFSSPLQSYACWSHSSGYDYVYNP  6198

Query  240   FMIDVQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEYPII  299
             F +DVQQWG+ GNL +NHD YC +H  AHVAS DAIMTRCLA+++CF++RVDW + YP I
Sbjct  6199  FFVDVQQWGYVGNLATNHDRYCGIHAGAHVASSDAIMTRCLAIYDCFIERVDWDVTYPYI  6258

Query  300   GDELKINAACRKVQHMVVKAALLADKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDK  359
               E K+N+ CR V+  VV++A+L+ KF  ++DIGNPK I  + +  VEW FYDAQP S+ 
Sbjct  6259  SHEQKLNSCCRTVERNVVRSAVLSGKFDKIYDIGNPKGIPIISEP-VEWHFYDAQPLSN-  6316

Query  360   AYKIEELFYSYATHSDKFTDGVCLFWNCNVDRYPANSIVCRFDTRVLSNLNLPGCDGGSL  419
               K+++LFY+       F DG+CLFWNCNV +YP+N++VCRFDTRV S  NLPGC+GGSL
Sbjct  6317  --KVKKLFYTDDVAKQ-FEDGLCLFWNCNVSKYPSNAVVCRFDTRVHSEFNLPGCNGGSL  6373

Query  420   YVNKHAFHTPAFDKSAFVNLKQLPFFYYSDSPCESHG-KQVVSDIDYVPLKSATCITRCN  478
             YVNKHAFHTPA+D +AF +LK LPFFYYS +PCE HG   ++ DIDYVPLKSA CIT CN
Sbjct  6374  YVNKHAFHTPAYDINAFRDLKPLPFFYYSTTPCEVHGSGNMLEDIDYVPLKSAVCITACN  6433

Query  479   LGGAVCRHHANEYRLYLDAYNMMISAGFSLWVYKQFDTYNLWNTFTRLQ  527
             LGGAVCR HA EYR Y++AYN++ +AGF LWVYK FD YNLW+TF ++Q
Sbjct  6434  LGGAVCRKHAAEYRDYMEAYNIVSAAGFRLWVYKTFDIYNLWSTFVKVQ  6482


>sp|P0C6W3|R1AB_BCHK4 Replicase polyprotein 1ab OS=Bat coronavirus 
HKU4 OX=694007 GN=rep PE=1 SV=1
Length=7119

 Score = 891 bits (2302),  Expect = 0.0, Method: Composition-based stats.
 Identities = 329/529 (62%), Positives = 410/529 (78%), Gaps = 8/529 (2%)

Query  1     AENVTGLFKDCSKVITGLHPTQAPTHLSVDTKFKT-EGLCVDIPGIPKDMTYRRLISMMG  59
             ++ VTGLFKDCS+  TGL P  APT+LSVD K+KT + LCV++  I  ++TY R+IS MG
Sbjct  5953  SQIVTGLFKDCSREDTGLPPAYAPTYLSVDAKYKTTDELCVNL-NITPNVTYSRVISRMG  6011

Query  60    FKMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVA  119
             FK++  + GYP +FITR+EAIR VR+W+GFDVEG HA+R A GTN+PLQLGFSTGVN V 
Sbjct  6012  FKLDATIPGYPKLFITRDEAIRQVRSWVGFDVEGAHASRNACGTNVPLQLGFSTGVNFVV  6071

Query  120   VPTGYVDTPNNTDFSRVSAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSD  179
              P G VDT   +  + +SA+PPPG+QFKHL+PLM KG  W +VR +IVQMLSDTL  LSD
Sbjct  6072  QPVGVVDTEWGSMLTTISARPPPGEQFKHLVPLMNKGATWPIVRRRIVQMLSDTLDKLSD  6131

Query  180   RVVFVLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNP  239
                FV WAHGFELTS  YF KIG E+ C +C RRA+ FS+   +YACW HS G+DYVYNP
Sbjct  6132  YCTFVCWAHGFELTSASYFCKIGKEQRCSMCSRRASTFSSPLQSYACWSHSSGYDYVYNP  6191

Query  240   FMIDVQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEYPII  299
             F +DVQQWG+ GNL +NHD YC +H  AHVAS DAIMTRCLA+++CF++RVDW + YP I
Sbjct  6192  FFVDVQQWGYVGNLATNHDRYCGIHAGAHVASSDAIMTRCLAIYDCFIERVDWDVTYPYI  6251

Query  300   GDELKINAACRKVQHMVVKAALLADKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDK  359
               E K+N+ CR V+  VV++A+L+ KF  ++DIGNPK I  + +  VEW FYDAQP S+ 
Sbjct  6252  SHEQKLNSCCRTVERNVVRSAVLSGKFEKIYDIGNPKGIAIISEP-VEWHFYDAQPLSN-  6309

Query  360   AYKIEELFYSYATHSDKFTDGVCLFWNCNVDRYPANSIVCRFDTRVLSNLNLPGCDGGSL  419
               K+++LFY+    S +F DG+CLFWNCNV +YP+N++VCRFDTRV S  NLPGC+GGSL
Sbjct  6310  --KVKKLFYTDDV-SKQFEDGLCLFWNCNVSKYPSNAVVCRFDTRVHSEFNLPGCNGGSL  6366

Query  420   YVNKHAFHTPAFDKSAFVNLKQLPFFYYSDSPCESHG-KQVVSDIDYVPLKSATCITRCN  478
             YVNKHAFHTPA+D +AF +LK LPFFYYS +PCE HG   ++ DIDYVPLKSA CIT CN
Sbjct  6367  YVNKHAFHTPAYDINAFRDLKPLPFFYYSTTPCEVHGSGNMLEDIDYVPLKSAVCITACN  6426

Query  479   LGGAVCRHHANEYRLYLDAYNMMISAGFSLWVYKQFDTYNLWNTFTRLQ  527
             LGGAVCR HA EYR Y++AYN++ +AGF LWVYK FD YNLW+TF ++Q
Sbjct  6427  LGGAVCRKHAAEYRDYMEAYNIVSAAGFRLWVYKTFDIYNLWSTFVKVQ  6475


>sp|P0C6X8|R1AB_CVM2 Replicase polyprotein 1ab OS=Murine coronavirus 
(strain 2) OX=76344 GN=rep PE=3 SV=1
Length=7124

 Score = 888 bits (2294),  Expect = 0.0, Method: Composition-based stats.
 Identities = 304/527 (58%), Positives = 390/527 (74%), Gaps = 6/527 (1%)

Query  2     ENVTGLFKDCSKVITGLHPTQAPTHLSVDTKFKTEG-LCVDIPGIPKDMTYRRLISMMGF  60
             +  T LFKDCS+   G HP  AP+ L+VD K+K  G L V +      +TY RLIS+MGF
Sbjct  5930  QCTTNLFKDCSRSYAGYHPAHAPSFLAVDDKYKVGGDLAVCLNVADSAVTYSRLISLMGF  5989

Query  61    KMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVAV  120
             K++  ++GY  +FITR+EAIR VRAW+GFD EG HATR+++GTN PLQLGFSTG++ V  
Sbjct  5990  KLDLTLDGYCKLFITRDEAIRRVRAWVGFDAEGAHATRDSIGTNFPLQLGFSTGIDFVVE  6049

Query  121   PTGYVDTPNNTDFSRVSAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSDR  180
              TG     +   F +  A+ PPG+QFKHL+PLM +G  W+VVRI+IVQMLSD L +L+D 
Sbjct  6050  ATGMFAERDGYVFKKAVARAPPGEQFKHLVPLMSRGQKWDVVRIRIVQMLSDHLVDLADS  6109

Query  181   VVFVLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNPF  240
             VV V WA  FELT ++YF K+G E  C +C++RATCF++ +  Y CW HS   DY+YNP 
Sbjct  6110  VVLVTWAASFELTCLRYFAKVGKEVVCSVCNKRATCFNSRTGYYGCWRHSYSCDYLYNPL  6169

Query  241   MIDVQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEYPIIG  300
             ++D+QQWG+TG+L SNHDL C VH  AHVAS DAIMTRCLAVH+CF K V+W++EYPII 
Sbjct  6170  IVDIQQWGYTGSLTSNHDLICSVHKGAHVASSDAIMTRCLAVHDCFCKSVNWSLEYPIIS  6229

Query  301   DELKINAACRKVQHMVVKAALLADKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDKA  360
             +E+ +N +CR +Q ++ +AA+L +++ V +DIGNPK + CV   D  +KFYDA P     
Sbjct  6230  NEVSVNTSCRLLQRVMFRAAMLCNRYDVCYDIGNPKGLACVKGYD--FKFYDASPV---V  6284

Query  361   YKIEELFYSYATHSDKFTDGVCLFWNCNVDRYPANSIVCRFDTRVLSNLNLPGCDGGSLY  420
               +++  Y Y  H D+F DG+C+FWNCNVD+YPAN++VCRFDTRVL+ LNLPGC+GGSLY
Sbjct  6285  KSVKQFVYKYEAHKDQFLDGLCMFWNCNVDKYPANAVVCRFDTRVLNKLNLPGCNGGSLY  6344

Query  421   VNKHAFHTPAFDKSAFVNLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLG  480
             VNKHAFHT  F ++AF NLK +PFFYYSD+PC          +DYVPL+SATCITRCNLG
Sbjct  6345  VNKHAFHTSPFTRAAFENLKPMPFFYYSDTPCVYMEGMESKQVDYVPLRSATCITRCNLG  6404

Query  481   GAVCRHHANEYRLYLDAYNMMISAGFSLWVYKQFDTYNLWNTFTRLQ  527
             GAVC  HA +YR YL++YN   +AGF+ WVYK FD YNLWNTFTRLQ
Sbjct  6405  GAVCLKHAEDYREYLESYNTATTAGFTFWVYKTFDFYNLWNTFTRLQ  6451


>sp|P0C6X9|R1AB_CVMA5 Replicase polyprotein 1ab OS=Murine coronavirus 
(strain A59) OX=11142 GN=rep PE=1 SV=1
Length=7176

 Score = 885 bits (2287),  Expect = 0.0, Method: Composition-based stats.
 Identities = 303/527 (57%), Positives = 387/527 (73%), Gaps = 6/527 (1%)

Query  2     ENVTGLFKDCSKVITGLHPTQAPTHLSVDTKFKTEG-LCVDIPGIPKDMTYRRLISMMGF  60
             +  T LFKDCS+   G HP  AP+ L+VD K+K  G L V +      +TY RLIS+MGF
Sbjct  5982  QCTTNLFKDCSRSYVGYHPAHAPSFLAVDDKYKVGGDLAVCLNVADSAVTYSRLISLMGF  6041

Query  61    KMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVAV  120
             K++  ++GY  +FITR+EAI+ VRAW+GFD EG HA R+++GTN PLQLGFSTG++ V  
Sbjct  6042  KLDLTLDGYCKLFITRDEAIKRVRAWVGFDAEGAHAIRDSIGTNFPLQLGFSTGIDFVVE  6101

Query  121   PTGYVDTPNNTDFSRVSAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSDR  180
              TG     +   F + +A+ PPG+QFKHLIPLM +G  W+VVRI+IVQMLSD L +L+D 
Sbjct  6102  ATGMFAERDGYVFKKAAARAPPGEQFKHLIPLMSRGQKWDVVRIRIVQMLSDHLVDLADS  6161

Query  181   VVFVLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNPF  240
             VV V WA  FELT ++YF K+G E  C +C +RATCF++ +  Y CW HS   DY+YNP 
Sbjct  6162  VVLVTWAASFELTCLRYFAKVGREVVCSVCTKRATCFNSRTGYYGCWRHSYSCDYLYNPL  6221

Query  241   MIDVQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEYPIIG  300
             ++D+QQWG+TG+L SNHD  C VH  AHVAS DAIMTRCLAVH+CF K V+W +EYPII 
Sbjct  6222  IVDIQQWGYTGSLTSNHDPICSVHKGAHVASSDAIMTRCLAVHDCFCKSVNWNLEYPIIS  6281

Query  301   DELKINAACRKVQHMVVKAALLADKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDKA  360
             +E+ +N +CR +Q ++ +AA+L +++ V +DIGNPK + CV   D  +KFYDA P     
Sbjct  6282  NEVSVNTSCRLLQRVMFRAAMLCNRYDVCYDIGNPKGLACVKGYD--FKFYDASPV---V  6336

Query  361   YKIEELFYSYATHSDKFTDGVCLFWNCNVDRYPANSIVCRFDTRVLSNLNLPGCDGGSLY  420
               +++  Y Y  H D+F DG+C+FWNCNVD+YPAN++VCRFDTRVL+ LNLPGC+GGSLY
Sbjct  6337  KSVKQFVYKYEAHKDQFLDGLCMFWNCNVDKYPANAVVCRFDTRVLNKLNLPGCNGGSLY  6396

Query  421   VNKHAFHTPAFDKSAFVNLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLG  480
             VNKHAFHT  F ++AF NLK +PFFYYSD+PC          +DYVPL+SATCITRCNLG
Sbjct  6397  VNKHAFHTSPFTRAAFENLKPMPFFYYSDTPCVYMEGMESKQVDYVPLRSATCITRCNLG  6456

Query  481   GAVCRHHANEYRLYLDAYNMMISAGFSLWVYKQFDTYNLWNTFTRLQ  527
             GAVC  HA EYR YL++YN   +AGF+ WVYK FD YNLWNTFTRLQ
Sbjct  6457  GAVCLKHAEEYREYLESYNTATTAGFTFWVYKTFDFYNLWNTFTRLQ  6503


>sp|P0C6X4|R1AB_CVHN5 Replicase polyprotein 1ab OS=Human coronavirus 
HKU1 (isolate N5) OX=443241 GN=rep PE=3 SV=1
Length=7132

 Score = 879 bits (2272),  Expect = 0.0, Method: Composition-based stats.
 Identities = 306/525 (58%), Positives = 390/525 (74%), Gaps = 6/525 (1%)

Query  4     VTGLFKDCSKVITGLHPTQAPTHLSVDTKFKT-EGLCVDIPGIPKDMTYRRLISMMGFKM  62
              T LFKDCSK   G HP  AP+ L+VD K+K  E L V++      +TY RLIS+MGFK+
Sbjct  5940  TTNLFKDCSKSCLGYHPAHAPSFLAVDDKYKVNENLAVNLNICEPVLTYSRLISLMGFKL  5999

Query  63    NYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVAVPT  122
             +  ++GY  +FIT++EAI+ VR W+GFDVEG HATRE +GTN PLQ+GFSTGV+ V   T
Sbjct  6000  DLTLDGYSKLFITKDEAIKRVRGWVGFDVEGAHATRENIGTNFPLQIGFSTGVDFVVEAT  6059

Query  123   GYVDTPNNTDFSRVSAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSDRVV  182
             G     +   F +  AK PPG++FKHLIPLM KG  W++VRI+IVQMLSD L +LSD VV
Sbjct  6060  GLFAERDCYTFKKTVAKAPPGEKFKHLIPLMSKGQKWDIVRIRIVQMLSDYLLDLSDSVV  6119

Query  183   FVLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNPFMI  242
             F+ W+  FELT ++YF K+G E  C +C  RATC+++ +  Y CW HS   DYVYNP ++
Sbjct  6120  FITWSASFELTCLRYFAKLGRELNCNVCSNRATCYNSRTGYYGCWRHSYTCDYVYNPLIV  6179

Query  243   DVQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEYPIIGDE  302
             D+QQWG+TG+L SNHD+ C VH  AHVAS DAIMTRCLA+++CF K V+W +EYPII +E
Sbjct  6180  DIQQWGYTGSLTSNHDIICNVHKGAHVASADAIMTRCLAIYDCFCKSVNWNLEYPIISNE  6239

Query  303   LKINAACRKVQHMVVKAALLADKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDKAYK  362
             + IN +CR +Q +++KAA+L +++ + +DIGNPK + CV   D E+KFYDA P    A  
Sbjct  6240  VSINTSCRLLQRVMLKAAMLCNRYNLCYDIGNPKGLACVK--DYEFKFYDAFPV---AKS  6294

Query  363   IEELFYSYATHSDKFTDGVCLFWNCNVDRYPANSIVCRFDTRVLSNLNLPGCDGGSLYVN  422
             +++LFY Y  H D F DG+C+FWNCNVD+YP+NSIVCRFDTRVL+ LNLPGC+GGSLYVN
Sbjct  6295  VKQLFYVYDVHKDNFKDGLCMFWNCNVDKYPSNSIVCRFDTRVLNKLNLPGCNGGSLYVN  6354

Query  423   KHAFHTPAFDKSAFVNLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLGGA  482
             KHAFHT  F ++ F NLK +PFFYYSD+PC          +DYVPL+SATCITRCNLGGA
Sbjct  6355  KHAFHTNPFTRTVFENLKPMPFFYYSDTPCVYVDGLESKQVDYVPLRSATCITRCNLGGA  6414

Query  483   VCRHHANEYRLYLDAYNMMISAGFSLWVYKQFDTYNLWNTFTRLQ  527
             VC  HA EY  YL++YN++ +AGF+ WVYK FD YNLWNTFT LQ
Sbjct  6415  VCSKHAEEYCNYLESYNIVTTAGFTFWVYKTFDFYNLWNTFTTLQ  6459


>sp|P0C6X2|R1AB_CVHN1 Replicase polyprotein 1ab OS=Human coronavirus 
HKU1 (isolate N1) OX=443239 GN=rep PE=3 SV=1
Length=7182

 Score = 879 bits (2271),  Expect = 0.0, Method: Composition-based stats.
 Identities = 306/525 (58%), Positives = 390/525 (74%), Gaps = 6/525 (1%)

Query  4     VTGLFKDCSKVITGLHPTQAPTHLSVDTKFKT-EGLCVDIPGIPKDMTYRRLISMMGFKM  62
              T LFKDCSK   G HP  AP+ L+VD K+K  E L V++      +TY RLIS+MGFK+
Sbjct  5990  TTNLFKDCSKSCLGYHPAHAPSFLAVDDKYKVNENLAVNLNICEPVLTYSRLISLMGFKL  6049

Query  63    NYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVAVPT  122
             +  ++GY  +FIT++EAI+ VR W+GFDVEG HATRE +GTN PLQ+GFSTGV+ V   T
Sbjct  6050  DLTLDGYSKLFITKDEAIKRVRGWVGFDVEGAHATRENIGTNFPLQIGFSTGVDFVVEAT  6109

Query  123   GYVDTPNNTDFSRVSAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSDRVV  182
             G     +   F +  AK PPG++FKHLIPLM KG  W++VRI+IVQMLSD L +LSD VV
Sbjct  6110  GLFAERDCYTFKKTVAKAPPGEKFKHLIPLMSKGQKWDIVRIRIVQMLSDYLLDLSDSVV  6169

Query  183   FVLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNPFMI  242
             F+ W+  FELT ++YF K+G E  C +C  RATC+++ +  Y CW HS   DYVYNP ++
Sbjct  6170  FITWSASFELTCLRYFAKLGRELNCNVCSNRATCYNSRTGYYGCWRHSYTCDYVYNPLIV  6229

Query  243   DVQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEYPIIGDE  302
             D+QQWG+TG+L SNHD+ C VH  AHVAS DAIMTRCLA+++CF K V+W +EYPII +E
Sbjct  6230  DIQQWGYTGSLTSNHDIICNVHKGAHVASADAIMTRCLAIYDCFCKSVNWNLEYPIISNE  6289

Query  303   LKINAACRKVQHMVVKAALLADKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDKAYK  362
             + IN +CR +Q +++KAA+L +++ + +DIGNPK + CV   D E+KFYDA P    A  
Sbjct  6290  VSINTSCRLLQRVMLKAAMLCNRYNLCYDIGNPKGLACVK--DYEFKFYDAFPV---AKS  6344

Query  363   IEELFYSYATHSDKFTDGVCLFWNCNVDRYPANSIVCRFDTRVLSNLNLPGCDGGSLYVN  422
             +++LFY Y  H D F DG+C+FWNCNVD+YP+NSIVCRFDTRVL+ LNLPGC+GGSLYVN
Sbjct  6345  VKQLFYVYDVHKDNFKDGLCMFWNCNVDKYPSNSIVCRFDTRVLNKLNLPGCNGGSLYVN  6404

Query  423   KHAFHTPAFDKSAFVNLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLGGA  482
             KHAFHT  F ++ F NLK +PFFYYSD+PC          +DYVPL+SATCITRCNLGGA
Sbjct  6405  KHAFHTNPFTRTVFENLKPMPFFYYSDTPCVYVDGLESKQVDYVPLRSATCITRCNLGGA  6464

Query  483   VCRHHANEYRLYLDAYNMMISAGFSLWVYKQFDTYNLWNTFTRLQ  527
             VC  HA EY  YL++YN++ +AGF+ WVYK FD YNLWNTFT LQ
Sbjct  6465  VCSKHAEEYCNYLESYNIVTTAGFTFWVYKNFDFYNLWNTFTTLQ  6509


>sp|P0C6W8|R1AB_CVBLU Replicase polyprotein 1ab OS=Bovine coronavirus 
(strain 98TXSF-110-LUN) OX=233264 GN=rep PE=3 SV=1
Length=7094

 Score = 878 bits (2270),  Expect = 0.0, Method: Composition-based stats.
 Identities = 304/527 (58%), Positives = 391/527 (74%), Gaps = 6/527 (1%)

Query  2     ENVTGLFKDCSKVITGLHPTQAPTHLSVDTKFK-TEGLCVDIPGIPKDMTYRRLISMMGF  60
             +  T LFKDCSK  +G HP  AP+ L+VD K+K T  L V +      +TY RLIS+MGF
Sbjct  5900  QCSTNLFKDCSKSYSGYHPAHAPSFLAVDDKYKATGDLAVCLGIGDSAVTYSRLISLMGF  5959

Query  61    KMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVAV  120
             K++  ++GY  +FIT+EEA++ VRAW+GFD EG HATR+++GTN PLQLGFSTG++ V  
Sbjct  5960  KLDVTLDGYCKLFITKEEAVKRVRAWVGFDAEGAHATRDSIGTNFPLQLGFSTGIDFVVE  6019

Query  121   PTGYVDTPNNTDFSRVSAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSDR  180
              TG     +   F +  AK PPG+QFKHLIPLM +G  W+VVR +IVQM +D L +LSD 
Sbjct  6020  ATGLFADRDGYSFKKAVAKAPPGEQFKHLIPLMTRGQRWDVVRPRIVQMFADHLIDLSDC  6079

Query  181   VVFVLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNPF  240
             VV V WA  FELT ++YF K+G E +C +C +RAT +++ +  Y CW HS+  DY+YNP 
Sbjct  6080  VVLVTWAANFELTCLRYFAKVGREISCNVCTKRATAYNSRTGYYGCWRHSVTCDYLYNPL  6139

Query  241   MIDVQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEYPIIG  300
             ++D+QQWG+ G+L SNHDLYC VH  AHVAS DAIMTRCLAV++CF   ++W +EYPII 
Sbjct  6140  IVDIQQWGYIGSLSSNHDLYCSVHKGAHVASSDAIMTRCLAVYDCFCNNINWNVEYPIIS  6199

Query  301   DELKINAACRKVQHMVVKAALLADKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDKA  360
             +EL IN +CR +Q +++KAA+L +++ + +DIGNPKAI CV   D ++KFYDAQP     
Sbjct  6200  NELSINTSCRVLQRVMLKAAMLCNRYTLCYDIGNPKAIACVK--DFDFKFYDAQPI---V  6254

Query  361   YKIEELFYSYATHSDKFTDGVCLFWNCNVDRYPANSIVCRFDTRVLSNLNLPGCDGGSLY  420
               ++ L YS+  H D F DG+C+FWNCNVD+YP N++VCRFDTRVL+NLNLPGC+GGSLY
Sbjct  6255  KSVKTLLYSFEAHKDSFKDGLCMFWNCNVDKYPPNAVVCRFDTRVLNNLNLPGCNGGSLY  6314

Query  421   VNKHAFHTPAFDKSAFVNLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLG  480
             VNKHAFHT  F ++AF +LK +PFFYYSD+PC          +DYVPLKSATCITRCNLG
Sbjct  6315  VNKHAFHTKPFSRAAFEHLKPMPFFYYSDTPCVYMDGMDAKQVDYVPLKSATCITRCNLG  6374

Query  481   GAVCRHHANEYRLYLDAYNMMISAGFSLWVYKQFDTYNLWNTFTRLQ  527
             GAVC  HA EYR YL++YN   +AGF+ WVYK FD YNLWNTFT+LQ
Sbjct  6375  GAVCLKHAEEYREYLESYNTATTAGFTFWVYKTFDFYNLWNTFTKLQ  6421


>sp|P0C6W7|R1AB_CVBEN Replicase polyprotein 1ab OS=Bovine coronavirus 
(strain 98TXSF-110-ENT) OX=233262 GN=rep PE=3 SV=1
Length=7094

 Score = 878 bits (2270),  Expect = 0.0, Method: Composition-based stats.
 Identities = 304/527 (58%), Positives = 391/527 (74%), Gaps = 6/527 (1%)

Query  2     ENVTGLFKDCSKVITGLHPTQAPTHLSVDTKFK-TEGLCVDIPGIPKDMTYRRLISMMGF  60
             +  T LFKDCSK  +G HP  AP+ L+VD K+K T  L V +      +TY RLIS+MGF
Sbjct  5900  QCSTNLFKDCSKSYSGYHPAHAPSFLAVDDKYKATGDLAVCLGIGDSAVTYSRLISLMGF  5959

Query  61    KMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVAV  120
             K++  ++GY  +FIT+EEA++ VRAW+GFD EG HATR+++GTN PLQLGFSTG++ V  
Sbjct  5960  KLDVTLDGYCKLFITKEEAVKRVRAWVGFDAEGAHATRDSIGTNFPLQLGFSTGIDFVVE  6019

Query  121   PTGYVDTPNNTDFSRVSAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSDR  180
              TG     +   F +  AK PPG+QFKHLIPLM +G  W+VVR +IVQM +D L +LSD 
Sbjct  6020  ATGLFADRDGYSFKKAVAKAPPGEQFKHLIPLMTRGQRWDVVRPRIVQMFADHLIDLSDC  6079

Query  181   VVFVLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNPF  240
             VV V WA  FELT ++YF K+G E +C +C +RAT +++ +  Y CW HS+  DY+YNP 
Sbjct  6080  VVLVTWAANFELTCLRYFAKVGREISCNVCTKRATAYNSRTGYYGCWRHSVTCDYLYNPL  6139

Query  241   MIDVQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEYPIIG  300
             ++D+QQWG+ G+L SNHDLYC VH  AHVAS DAIMTRCLAV++CF   ++W +EYPII 
Sbjct  6140  IVDIQQWGYIGSLSSNHDLYCSVHKGAHVASSDAIMTRCLAVYDCFCNNINWNVEYPIIS  6199

Query  301   DELKINAACRKVQHMVVKAALLADKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDKA  360
             +EL IN +CR +Q +++KAA+L +++ + +DIGNPKAI CV   D ++KFYDAQP     
Sbjct  6200  NELSINTSCRVLQRVMLKAAMLCNRYTLCYDIGNPKAIACVK--DFDFKFYDAQPI---V  6254

Query  361   YKIEELFYSYATHSDKFTDGVCLFWNCNVDRYPANSIVCRFDTRVLSNLNLPGCDGGSLY  420
               ++ L YS+  H D F DG+C+FWNCNVD+YP N++VCRFDTRVL+NLNLPGC+GGSLY
Sbjct  6255  KSVKTLLYSFEAHKDSFKDGLCMFWNCNVDKYPPNAVVCRFDTRVLNNLNLPGCNGGSLY  6314

Query  421   VNKHAFHTPAFDKSAFVNLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLG  480
             VNKHAFHT  F ++AF +LK +PFFYYSD+PC          +DYVPLKSATCITRCNLG
Sbjct  6315  VNKHAFHTKPFSRAAFEHLKPMPFFYYSDTPCVYMDGMDAKQVDYVPLKSATCITRCNLG  6374

Query  481   GAVCRHHANEYRLYLDAYNMMISAGFSLWVYKQFDTYNLWNTFTRLQ  527
             GAVC  HA EYR YL++YN   +AGF+ WVYK FD YNLWNTFT+LQ
Sbjct  6375  GAVCLKHAEEYREYLESYNTATTAGFTFWVYKTFDFYNLWNTFTKLQ  6421


>sp|P0C6X3|R1AB_CVHN2 Replicase polyprotein 1ab OS=Human coronavirus 
HKU1 (isolate N2) OX=443240 GN=rep PE=3 SV=1
Length=7152

 Score = 875 bits (2261),  Expect = 0.0, Method: Composition-based stats.
 Identities = 308/525 (59%), Positives = 385/525 (73%), Gaps = 6/525 (1%)

Query  4     VTGLFKDCSKVITGLHPTQAPTHLSVDTKFKT-EGLCVDIPGIPKDMTYRRLISMMGFKM  62
              T LFKDCSK   G HP  AP+ LSVD K+K  E L V +      +TY RLIS+MGFK+
Sbjct  5960  TTNLFKDCSKNFLGYHPAHAPSFLSVDDKYKVNEDLAVCLNICEPVLTYSRLISLMGFKL  6019

Query  63    NYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVAVPT  122
             +  ++GY   FIT++EAI+ VR W+GFDVEG HATR+ +GTN PLQ+GFSTGV+ V   T
Sbjct  6020  DLTLDGYSKFFITKDEAIKRVRGWVGFDVEGAHATRDNIGTNFPLQIGFSTGVDFVVEAT  6079

Query  123   GYVDTPNNTDFSRVSAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSDRVV  182
             G     +   F R  AK PPGD FKHLIPLM KG  W+VVRI+IVQMLSD L +LSD VV
Sbjct  6080  GLFAERDCYIFKRTVAKAPPGDNFKHLIPLMSKGQKWDVVRIRIVQMLSDYLLDLSDSVV  6139

Query  183   FVLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNPFMI  242
             F+ W+  FELT ++YF K+G E  C +C  RATC+++ +  Y CW HS   DYVYNP ++
Sbjct  6140  FITWSASFELTCLRYFAKLGRELNCDVCPNRATCYNSRTGYYGCWRHSYTCDYVYNPLIV  6199

Query  243   DVQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEYPIIGDE  302
             D+QQWG+TG+L SNHD+ C VH  AHVAS DAIMTRCLA+++CF K V+W +EYPII +E
Sbjct  6200  DIQQWGYTGSLTSNHDIICNVHKGAHVASSDAIMTRCLAIYDCFCKSVNWNLEYPIISNE  6259

Query  303   LKINAACRKVQHMVVKAALLADKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDKAYK  362
             + IN +CR +Q +++KAA+L +++ + +DIGNPK I CV   D E+KFYDA P       
Sbjct  6260  VSINTSCRLLQRVMLKAAMLCNRYNLCYDIGNPKGIACVK--DYEFKFYDASPV---VKS  6314

Query  363   IEELFYSYATHSDKFTDGVCLFWNCNVDRYPANSIVCRFDTRVLSNLNLPGCDGGSLYVN  422
             +++LFY Y  H D F DG+C+FWNCNVD+YP+NSIVCRFDTRVL+ LNLPGC+GGSLYVN
Sbjct  6315  VKQLFYVYDVHKDNFKDGLCMFWNCNVDKYPSNSIVCRFDTRVLNKLNLPGCNGGSLYVN  6374

Query  423   KHAFHTPAFDKSAFVNLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLGGA  482
             KHAFHT  F ++ F NLK +PFFYYSD+PC          +DYVPL+SATCITRCNLGGA
Sbjct  6375  KHAFHTNPFTRTVFENLKPMPFFYYSDTPCVYVDGLESKQVDYVPLRSATCITRCNLGGA  6434

Query  483   VCRHHANEYRLYLDAYNMMISAGFSLWVYKQFDTYNLWNTFTRLQ  527
             VC  HA +Y  YL++YN+  +AGF+ WVYK FD YNLWNTFT LQ
Sbjct  6435  VCSKHAEDYCKYLESYNVATTAGFTFWVYKTFDFYNLWNTFTMLQ  6479


>sp|P0C6Y4|R1AB_PEDV7 Replicase polyprotein 1ab OS=Porcine epidemic 
diarrhea virus (strain CV777) OX=229032 GN=rep PE=1 SV=1
Length=6781

 Score = 875 bits (2260),  Expect = 0.0, Method: Composition-based stats.
 Identities = 270/521 (52%), Positives = 351/521 (67%), Gaps = 11/521 (2%)

Query  5     TGLFKDCSKVITGLHPTQAPTHLSVDTKFKTEGLCVDIPGIPKDMTYRRLISMMGFKMNY  64
              GLFKDCS+    L P+ A T +S+   FKT+       G+   + Y  +IS MGF+ + 
Sbjct  5629  CGLFKDCSRGDDLLPPSHANTFMSLADNFKTDQYLAVQIGVNGPIKYEHVISFMGFRFDI  5688

Query  65    QVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVAVPTGY  124
              +  +  +F TR+ A+R+VR W+GFDVEG H     VGTN+PLQLGFS GV+ V  P G 
Sbjct  5689  NIPNHHTLFCTRDFAMRNVRGWLGFDVEGAHVVGSNVGTNVPLQLGFSNGVDFVVRPEGC  5748

Query  125   VDTPNNTDFSRVSAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSDRVVFV  184
             V T +      V A+ PPG+QF HL+PL+ +G PW+VVR +IVQM SD L NLSD ++FV
Sbjct  5749  VVTESGDYIKPVRARAPPGEQFAHLLPLLKRGQPWDVVRKRIVQMCSDYLANLSDILIFV  5808

Query  185   LWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNPFMIDV  244
             LWA G ELT+M+YFVKIGP ++C  C + ATC+++A  TY C+ H++G DY+YNP+ ID+
Sbjct  5809  LWAGGLELTTMRYFVKIGPSKSC-DCGKVATCYNSALHTYCCFKHALGCDYLYNPYCIDI  5867

Query  245   QQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEYPIIGDELK  304
             QQWG+ G+L  NH  +C VH N HVAS DAIMTRCLA+H+CFVK VDW+I YP IG+E  
Sbjct  5868  QQWGYKGSLSLNHHEHCNVHRNEHVASGDAIMTRCLAIHDCFVKNVDWSITYPFIGNEAV  5927

Query  305   INAACRKVQHMVVKAALLADKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDKAYKIE  364
             IN + R VQ   +++ L       ++DIGNPK I+C    D +W  +D  P +     +E
Sbjct  5928  INKSGRIVQSHTMRSVLKLYNPKAIYDIGNPKGIRCA-VTDAKWFCFDKNPTNSNVKTLE  5986

Query  365   ELFYSYATHSDKFTDGVCLFWNCNVDRYPANSIVCRFDTRVLSNLNLPGCDGGSLYVNKH  424
                Y Y TH     DG+CLFWNCNVD YP  S+VCRFDTR  S LNL GC+GGSLYVN H
Sbjct  5987  ---YDYITHGQ--FDGLCLFWNCNVDMYPEFSVVCRFDTRCRSPLNLEGCNGGSLYVNNH  6041

Query  425   AFHTPAFDKSAFVNLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLGGAVC  484
             AFHTPAFDK AF  LK +PFF+Y D+ C+    ++   I+YVPL+++ CIT+CN+GGAVC
Sbjct  6042  AFHTPAFDKRAFAKLKPMPFFFYDDTECD----KLQDSINYVPLRASNCITKCNVGGAVC  6097

Query  485   RHHANEYRLYLDAYNMMISAGFSLWVYKQFDTYNLWNTFTR  525
               H   Y  Y++AYN   SAGF++WV   FDTYNLW TF+ 
Sbjct  6098  SKHCAMYHSYVNAYNTFTSAGFTIWVPTSFDTYNLWQTFSN  6138


>sp|P0C6X6|R1AB_CVHOC Replicase polyprotein 1ab OS=Human coronavirus 
OC43 OX=31631 GN=rep PE=3 SV=1
Length=7095

 Score = 873 bits (2255),  Expect = 0.0, Method: Composition-based stats.
 Identities = 302/527 (57%), Positives = 389/527 (74%), Gaps = 6/527 (1%)

Query  2     ENVTGLFKDCSKVITGLHPTQAPTHLSVDTKFK-TEGLCVDIPGIPKDMTYRRLISMMGF  60
             +  T LFKDCSK  +G HP  AP+ L+VD K+K T  L V +      +TY RLIS+MGF
Sbjct  5900  QCSTNLFKDCSKSYSGYHPAHAPSFLAVDDKYKATGDLAVCLGIGDSAVTYSRLISLMGF  5959

Query  61    KMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVAV  120
             K++  ++GY  +FIT+EEA++ VRAW+GFD EG HAT +++GTN PLQLGFSTG++ V  
Sbjct  5960  KLDVTLDGYCKLFITKEEAVKRVRAWVGFDAEGAHATLDSIGTNFPLQLGFSTGIDFVVE  6019

Query  121   PTGYVDTPNNTDFSRVSAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSDR  180
              TG     +   F +  AK PPG+QFKHLIPLM +G  W+VVR +IVQM +D L +LSD 
Sbjct  6020  ATGLFADRDGYSFKKAVAKAPPGEQFKHLIPLMTRGHRWDVVRPRIVQMFADHLIDLSDC  6079

Query  181   VVFVLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNPF  240
             VV V WA  FELT ++YF K+G E +C +C +RAT +++ +  Y CW HS+  DY+YNP 
Sbjct  6080  VVLVTWAANFELTCLRYFAKVGREISCNVCTKRATVYNSRTGYYGCWRHSVTCDYLYNPL  6139

Query  241   MIDVQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEYPIIG  300
             ++D+QQWG+ G+L SNHDLYC VH  AHVAS DAIMTRCLAV++CF   ++W +EYPII 
Sbjct  6140  IVDIQQWGYIGSLSSNHDLYCSVHKGAHVASSDAIMTRCLAVYDCFCNNINWNVEYPIIS  6199

Query  301   DELKINAACRKVQHMVVKAALLADKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDKA  360
             +EL IN +CR +Q +++KAA+L +++ + +DIGNPK I CV   D ++KFYDAQP     
Sbjct  6200  NELSINTSCRVLQRVILKAAMLCNRYTLCYDIGNPKGIACVK--DFDFKFYDAQPI---V  6254

Query  361   YKIEELFYSYATHSDKFTDGVCLFWNCNVDRYPANSIVCRFDTRVLSNLNLPGCDGGSLY  420
               ++ L YS+  H D F DG+C+FWNCNVD+YP N++VCRFDTRVL+NLNLPGC+GGSLY
Sbjct  6255  KSVKTLLYSFEAHKDSFKDGLCMFWNCNVDKYPPNAVVCRFDTRVLNNLNLPGCNGGSLY  6314

Query  421   VNKHAFHTPAFDKSAFVNLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLG  480
             VNKHAFHT  F ++AF +LK +PFFYYSD+PC          +DYVPLKSATCITRCNLG
Sbjct  6315  VNKHAFHTKPFARAAFEHLKPMPFFYYSDTPCVYMDGMDAKQVDYVPLKSATCITRCNLG  6374

Query  481   GAVCRHHANEYRLYLDAYNMMISAGFSLWVYKQFDTYNLWNTFTRLQ  527
             GAVC  HA EYR YL++YN   +AGF+ WVYK FD YNLWNTFT+LQ
Sbjct  6375  GAVCLKHAEEYREYLESYNTATTAGFTFWVYKTFDFYNLWNTFTKLQ  6421


>sp|P0C6X0|R1AB_CVBQ Replicase polyprotein 1ab OS=Bovine coronavirus 
(strain Quebec) OX=11133 GN=rep PE=3 SV=1
Length=7059

 Score = 872 bits (2254),  Expect = 0.0, Method: Composition-based stats.
 Identities = 302/527 (57%), Positives = 389/527 (74%), Gaps = 6/527 (1%)

Query  2     ENVTGLFKDCSKVITGLHPTQAPTHLSVDTKFK-TEGLCVDIPGIPKDMTYRRLISMMGF  60
             +  T LFKDCSK  +G HP  AP+ L+VD K+K T  L V +      +TY RLIS+MGF
Sbjct  5900  QCSTNLFKDCSKSYSGYHPAHAPSFLAVDDKYKATGDLAVCLGIGDSAVTYSRLISLMGF  5959

Query  61    KMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVAV  120
             K++  ++GY  +FIT+EEA++ VRAW+GFD EG HATR+++GTN PLQLGFSTG++ V  
Sbjct  5960  KLDVTLDGYCKLFITKEEAVKRVRAWVGFDAEGAHATRDSIGTNFPLQLGFSTGIDFVVE  6019

Query  121   PTGYVDTPNNTDFSRVSAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSDR  180
              TG     +   F +  AK PPG+QFKHLIPLM +G  W+VVR +IVQM +D L +LSD 
Sbjct  6020  ATGLFADRDGYSFKKAVAKAPPGEQFKHLIPLMTRGQRWDVVRPRIVQMFADHLIDLSDC  6079

Query  181   VVFVLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNPF  240
             VV V WA  FELT ++YF K+G E +C +  +RAT +++ +  Y CW HS+  DY+YNP 
Sbjct  6080  VVLVTWAANFELTCLRYFAKVGREISCNVSTKRATAYNSRTGYYGCWRHSVTCDYLYNPL  6139

Query  241   MIDVQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEYPIIG  300
             ++D+QQWG+ G+L SNHDLYC VH  AHVAS DAIMTRCLAV++CF   ++W +EYPII 
Sbjct  6140  IVDIQQWGYIGSLSSNHDLYCSVHKGAHVASSDAIMTRCLAVYDCFCNNINWNVEYPIIS  6199

Query  301   DELKINAACRKVQHMVVKAALLADKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDKA  360
             +EL IN +CR +Q +++KAA+L +++ + +DIGNPKAI CV   D ++KFYDAQP     
Sbjct  6200  NELSINTSCRVLQRVMLKAAMLCNRYTLCYDIGNPKAIACVK--DFDFKFYDAQPI---V  6254

Query  361   YKIEELFYSYATHSDKFTDGVCLFWNCNVDRYPANSIVCRFDTRVLSNLNLPGCDGGSLY  420
               ++ L Y +  H D F DG+C+FWNCNVD+YP N++VCRFDTRVL+NLNLPGC+GGSLY
Sbjct  6255  KSVKTLLYFFEAHKDSFKDGLCMFWNCNVDKYPPNAVVCRFDTRVLNNLNLPGCNGGSLY  6314

Query  421   VNKHAFHTPAFDKSAFVNLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLG  480
             VNKHAFHT  F ++AF +LK +PFFYYSD+PC          +DYVPLKSATCITRCNLG
Sbjct  6315  VNKHAFHTKPFSRAAFEHLKPMPFFYYSDTPCVYMDGMDAKQVDYVPLKSATCITRCNLG  6374

Query  481   GAVCRHHANEYRLYLDAYNMMISAGFSLWVYKQFDTYNLWNTFTRLQ  527
             GAVC  HA EYR YL++YN   +AGF+ WVYK FD YNLWNTFT+LQ
Sbjct  6375  GAVCLKHAEEYREYLESYNTATTAGFTFWVYKTFDFYNLWNTFTKLQ  6421


>sp|P0C6W0|R1AB_BC512 Replicase polyprotein 1ab OS=Bat coronavirus 
512/2005 OX=693999 GN=rep PE=3 SV=1
Length=6793

 Score = 871 bits (2251),  Expect = 0.0, Method: Composition-based stats.
 Identities = 269/521 (52%), Positives = 346/521 (66%), Gaps = 11/521 (2%)

Query  5     TGLFKDCSKVITGLHPTQAPTHLSVDTKFKTEGLCVDIPGIPKDMTYRRLISMMGFKMNY  64
              GLFKDC K    L P+ APT +S+   FKT+       G+   + Y  +IS MGF+ + 
Sbjct  5640  CGLFKDCYKGEDNLPPSHAPTFMSLSDNFKTDKDLAVQIGVNGPVKYEHVISFMGFRFDI  5699

Query  65    QVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVAVPTGY  124
              V     +F TR+ A+R+ R W+GFDVEG H     VGTN+PLQLGFS GV+ V  P G 
Sbjct  5700  NVPNQHTLFCTRDFAMRNARGWLGFDVEGAHVIGSNVGTNVPLQLGFSNGVDFVVRPEGC  5759

Query  125   VDTPNNTDFSRVSAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSDRVVFV  184
             V T        V A+ PPGDQF HL+PL+ KG PW+V+R +IVQM SD L NLSD ++FV
Sbjct  5760  VSTEVGDVIQPVRARAPPGDQFTHLLPLLRKGQPWSVIRRRIVQMCSDYLANLSDTLIFV  5819

Query  185   LWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNPFMIDV  244
             LW+ G ELT+M+YFVK+GP +TC  C +RATC+++ + T++C+ H++G DY+YN + ID+
Sbjct  5820  LWSGGLELTTMRYFVKLGPVQTC-DCGKRATCYNSTNHTFSCFRHALGSDYIYNCYCIDI  5878

Query  245   QQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEYPIIGDELK  304
             QQWG+TG+L  NH   C +H N HVAS DA MTRCLA+H+CFVK VDW+I YP I +E  
Sbjct  5879  QQWGYTGSLSMNHHEVCNIHRNEHVASGDAAMTRCLAIHDCFVKNVDWSITYPFIANEQA  5938

Query  305   INAACRKVQHMVVKAALLADKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDKAYKIE  364
             IN + R VQ  V++A L       +HD+GNPK I+CV   D  W  YD  P +     +E
Sbjct  5939  INKSGRLVQSHVMRAVLKLYNPKAIHDVGNPKGIRCV-VTDASWYCYDKNPTNTNVKMLE  5997

Query  365   ELFYSYATHSDKFTDGVCLFWNCNVDRYPANSIVCRFDTRVLSNLNLPGCDGGSLYVNKH  424
                Y Y TH     DG+CLFWNCNVD YP  S+VCRFDTR+ S LNL GC+GGSLYVN H
Sbjct  5998  ---YDYITHGQ--LDGLCLFWNCNVDMYPEFSVVCRFDTRMRSTLNLEGCNGGSLYVNNH  6052

Query  425   AFHTPAFDKSAFVNLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLGGAVC  484
             AFHTPA+DK AF  LK +PFF+Y DS CE    ++   ++YVPL+++ CITRCN+GGAVC
Sbjct  6053  AFHTPAYDKRAFAKLKAMPFFFYDDSECE----KLQDAVNYVPLRASNCITRCNVGGAVC  6108

Query  485   RHHANEYRLYLDAYNMMISAGFSLWVYKQFDTYNLWNTFTR  525
               H   Y  Y+ AYN   +AGF++WV   FD +NLW TF  
Sbjct  6109  SKHCALYHNYVMAYNTFTTAGFTIWVPNSFDMFNLWQTFKN  6149


>sp|P0C6X1|R1AB_CVH22 Replicase polyprotein 1ab OS=Human coronavirus 
229E OX=11137 GN=rep PE=1 SV=1
Length=6758

 Score = 869 bits (2246),  Expect = 0.0, Method: Composition-based stats.
 Identities = 273/527 (52%), Positives = 352/527 (67%), Gaps = 11/527 (2%)

Query  1     AENVTGLFKDCSKVITGLHPTQAPTHLSVDTKFKTEGLCVDIPGIPKDMTYRRLISMMGF  60
             +E+  GLFKDC++    L P+ A T+LS+  +FKT G      G     TY  +IS MGF
Sbjct  5593  SESSCGLFKDCARNPIDLPPSHATTYLSLSDRFKTSGDLAVQIGNNNVCTYEHVISYMGF  5652

Query  61    KMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVAV  120
             + +  + G  ++F TR+ A+RHVR W+G DVEG H T + VGTN+PLQ+GFS GV+ VA 
Sbjct  5653  RFDVSMPGSHSLFCTRDFAMRHVRGWLGMDVEGAHVTGDNVGTNVPLQVGFSNGVDFVAQ  5712

Query  121   PTGYVDTPNNTDFSRVSAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSDR  180
             P G V T   +    V A+ PPG+QF H++PL+ KG PW+V+R +IVQM++D L   SD 
Sbjct  5713  PEGCVLTNTGSVVKPVRARAPPGEQFTHIVPLLRKGQPWSVLRKRIVQMIADFLAGSSDV  5772

Query  181   VVFVLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNPF  240
             +VFVLWA G ELT+M+YFVKIG  + C  C   ATC+++ S+ Y C+ H++G DYVYNP+
Sbjct  5773  LVFVLWAGGLELTTMRYFVKIGAVKHC-QCGTVATCYNSVSNDYCCFKHALGCDYVYNPY  5831

Query  241   MIDVQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEYPIIG  300
             +ID+QQWG+ G+L +NH   C VH N HVAS DAIMTRCLAV++CFVK VDW+I YP+I 
Sbjct  5832  VIDIQQWGYVGSLSTNHHAICNVHRNEHVASGDAIMTRCLAVYDCFVKNVDWSITYPMIA  5891

Query  301   DELKINAACRKVQHMVVKAALLADKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDKA  360
             +E  IN   R VQ  +++AA+       +HDIGNPK I+C    D +W  YD  P +   
Sbjct  5892  NENAINKGGRTVQSHIMRAAIKLYNPKAIHDIGNPKGIRCA-VTDAKWYCYDKNPINSNV  5950

Query  361   YKIEELFYSYATHSDKFTDGVCLFWNCNVDRYPANSIVCRFDTRVLSNLNLPGCDGGSLY  420
               +E   Y Y TH     DG+CLFWNCNVD YP  SIVCRFDTR  S LNL G +GGSLY
Sbjct  5951  KTLE---YDYMTHGQ--MDGLCLFWNCNVDMYPEFSIVCRFDTRTRSTLNLEGVNGGSLY  6005

Query  421   VNKHAFHTPAFDKSAFVNLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLG  480
             VN HAFHTPA+DK A   LK  PFFYY D  CE         ++YVPL++  CIT+CN+G
Sbjct  6006  VNNHAFHTPAYDKRAMAKLKPAPFFYYDDGSCEVVH----DQVNYVPLRATNCITKCNIG  6061

Query  481   GAVCRHHANEYRLYLDAYNMMISAGFSLWVYKQFDTYNLWNTFTRLQ  527
             GAVC  HAN YR Y+++YN+   AGF++WV   FD YNLW TFT + 
Sbjct  6062  GAVCSKHANLYRAYVESYNIFTQAGFNIWVPTTFDCYNLWQTFTEVN  6108


>sp|P0C6W9|R1AB_CVBM Replicase polyprotein 1ab OS=Bovine coronavirus 
(strain Mebus) OX=11132 GN=rep PE=3 SV=1
Length=7094

 Score = 869 bits (2245),  Expect = 0.0, Method: Composition-based stats.
 Identities = 301/527 (57%), Positives = 388/527 (74%), Gaps = 6/527 (1%)

Query  2     ENVTGLFKDCSKVITGLHPTQAPTHLSVDTKFK-TEGLCVDIPGIPKDMTYRRLISMMGF  60
             +  T LFKDCSK  +G HP  AP+ L+VD K+K T  L V +      +TY RL S+MGF
Sbjct  5900  QCSTNLFKDCSKSYSGYHPAHAPSFLAVDDKYKATGDLAVCLGIGDSAVTYSRLTSLMGF  5959

Query  61    KMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVAV  120
             K++  ++GY  +FIT+EEA++ VRAW+GFD EG HATR+++GTN PLQLGFSTG++ V  
Sbjct  5960  KLDVTLDGYCKLFITKEEAVKRVRAWVGFDAEGAHATRDSIGTNFPLQLGFSTGIDFVVE  6019

Query  121   PTGYVDTPNNTDFSRVSAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSDR  180
              TG     +   F +  AK PPG+QFKHLIPLM +G  W+VVR +IVQM +D L +LSD 
Sbjct  6020  ATGLFADRDGYSFKKAVAKAPPGEQFKHLIPLMTRGQRWDVVRPRIVQMFADHLIDLSDC  6079

Query  181   VVFVLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNPF  240
             VV V WA  FELT ++YF K+G E +C +C +RAT +++ +  Y CW HS+  DY+YNP 
Sbjct  6080  VVLVTWAANFELTCLRYFAKVGREISCNVCTKRATAYNSRTGYYGCWRHSVTCDYLYNPL  6139

Query  241   MIDVQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEYPIIG  300
             ++D+QQWG+ G+L SNHDLYC VH  AHVAS DAIMTRCLAV++CF   ++W +EYPII 
Sbjct  6140  IVDIQQWGYIGSLSSNHDLYCSVHKGAHVASSDAIMTRCLAVYDCFCNNINWNVEYPIIS  6199

Query  301   DELKINAACRKVQHMVVKAALLADKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDKA  360
             +EL IN +CR +Q +++KAA+L +++ + +DIGNPKAI CV   D ++KFYDAQP     
Sbjct  6200  NELSINTSCRVLQRVMLKAAMLCNRYTLCYDIGNPKAIACVK--DFDFKFYDAQPI---V  6254

Query  361   YKIEELFYSYATHSDKFTDGVCLFWNCNVDRYPANSIVCRFDTRVLSNLNLPGCDGGSLY  420
               ++ L Y +  H D F DG+C+FWNCNVD+YP N++VCRFDTRVL+NLNLPGC+GGSLY
Sbjct  6255  KSVKTLLYFFEAHKDSFKDGLCMFWNCNVDKYPPNAVVCRFDTRVLNNLNLPGCNGGSLY  6314

Query  421   VNKHAFHTPAFDKSAFVNLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLG  480
             VNKHAFHT  F ++AF +LK +PFFYYSD+PC          +DYVPLKSATCITRCNL 
Sbjct  6315  VNKHAFHTKPFSRAAFEHLKPMPFFYYSDTPCVYMDGMDAKQVDYVPLKSATCITRCNLV  6374

Query  481   GAVCRHHANEYRLYLDAYNMMISAGFSLWVYKQFDTYNLWNTFTRLQ  527
             GAVC  HA EYR YL++YN   +AGF+ WVYK FD YNLWNTFT+LQ
Sbjct  6375  GAVCLKHAEEYREYLNSYNTATTAGFTFWVYKTFDFYNLWNTFTKLQ  6421


>sp|P0C6Y0|R1AB_CVMJH Replicase polyprotein 1ab OS=Murine coronavirus 
(strain JHM) OX=11144 GN=rep PE=1 SV=1
Length=7180

 Score = 868 bits (2243),  Expect = 0.0, Method: Composition-based stats.
 Identities = 302/527 (57%), Positives = 386/527 (73%), Gaps = 8/527 (2%)

Query  2     ENVTGLFKDCSKVITGLHPTQAPTHLSVDTKFKTEG-LCVDIPGIPKDMTYRRLISMMGF  60
             +  T LFKDCSK   G+ P      L+VD K+K  G L V +      +TY RLIS+MGF
Sbjct  5988  QCTTNLFKDCSKSYVGIPP--CAFLLAVDDKYKVSGNLAVCLNVADSAVTYSRLISLMGF  6045

Query  61    KMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVAV  120
             K++  ++GY  +FITR+EAI+ VRAW+GFD EG HATR+++GTN PLQLGFSTG++ V  
Sbjct  6046  KLDLTLDGYCKLFITRDEAIKRVRAWVGFDAEGAHATRDSIGTNFPLQLGFSTGIDFVVE  6105

Query  121   PTGYVDTPNNTDFSRVSAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSDR  180
              TG     +   F + +A+ PPG+QFKHL+PLM +G  W+VVRI+IVQMLSD L +L+D 
Sbjct  6106  ATGMFAERDGYVFKKAAARAPPGEQFKHLVPLMSRGQKWDVVRIRIVQMLSDHLVDLADS  6165

Query  181   VVFVLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNPF  240
             VV V WA  FELT ++YF K+G E  C +C++RATCF++ +  Y CW HS   DY+YNP 
Sbjct  6166  VVLVTWAASFELTCLRYFAKVGKEVVCSVCNKRATCFNSRTGYYGCWRHSYSCDYLYNPL  6225

Query  241   MIDVQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEYPIIG  300
             ++D+QQWG+TG+L SNHD  C VH  AHVAS DAIMTRCLAVH+CF K V+W +EYPII 
Sbjct  6226  IVDIQQWGYTGSLTSNHDPICSVHKGAHVASSDAIMTRCLAVHDCFCKSVNWNLEYPIIS  6285

Query  301   DELKINAACRKVQHMVVKAALLADKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDKA  360
             +E+ +N +CR +Q ++ +AA+L +++ V +DIGNPK + CV   D  +KFYDA P     
Sbjct  6286  NEVSVNTSCRLLQRVMFRAAMLCNRYDVCYDIGNPKGLACVKGYD--FKFYDASPV---V  6340

Query  361   YKIEELFYSYATHSDKFTDGVCLFWNCNVDRYPANSIVCRFDTRVLSNLNLPGCDGGSLY  420
               +++  Y Y  H D+F DG+C+FWNCNVD+YPAN++VCRFDTRVLS LNLPGC+GGSLY
Sbjct  6341  KSVKQFVYKYEAHKDQFLDGLCMFWNCNVDKYPANAVVCRFDTRVLSKLNLPGCNGGSLY  6400

Query  421   VNKHAFHTPAFDKSAFVNLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLG  480
             VNKHAFHT  F ++AF NLK +PFFYYSD+PC          +DYVPL+SATCITRCNLG
Sbjct  6401  VNKHAFHTNPFTRAAFENLKPMPFFYYSDTPCVYMEGMESKQVDYVPLRSATCITRCNLG  6460

Query  481   GAVCRHHANEYRLYLDAYNMMISAGFSLWVYKQFDTYNLWNTFTRLQ  527
             GAVC  HA EYR YL++YN   +AGF+ WVYK FD YNLWNTFTRLQ
Sbjct  6461  GAVCLKHAEEYREYLESYNTATTAGFTFWVYKTFDFYNLWNTFTRLQ  6507


>sp|P0C6X5|R1AB_CVHNL Replicase polyprotein 1ab OS=Human coronavirus 
NL63 OX=277944 GN=rep PE=1 SV=1
Length=6729

 Score = 861 bits (2225),  Expect = 0.0, Method: Composition-based stats.
 Identities = 280/529 (53%), Positives = 353/529 (67%), Gaps = 13/529 (2%)

Query  1     AENVTGLFKDCSKVITGLHPTQAPTHLSVDTKFKTEGLCVDIPGIPKDMTYRRLISMMGF  60
             +  V GLFK+C++    L PT A T LS+  +FKT G      G     TY  +IS MGF
Sbjct  5568  SSQVCGLFKNCTRTPLNLPPTHAHTFLSLSDQFKTTGDLAVQIGSNNVCTYEHVISFMGF  5627

Query  61    KMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVAV  120
             + +  + G  ++F TR+ AIR+VR W+G DVE  H   + +GTN+PLQ+GFS GVN V  
Sbjct  5628  RFDISIPGSHSLFCTRDFAIRNVRGWLGMDVESAHVCGDNIGTNVPLQVGFSNGVNFVVQ  5687

Query  121   PTGYVDTPNNTDFSRVSAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSDR  180
               G V T        V AK PPG+QF+HLIPL+ KG PW +VR +IVQM+SD L NLSD 
Sbjct  5688  TEGCVSTNFGDVIKPVCAKSPPGEQFRHLIPLLRKGQPWLIVRRRIVQMISDYLSNLSDI  5747

Query  181   VVFVLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNPF  240
             +VFVLWA   ELT+M+YFVKIGP + C  C   ATC+++ S+ Y C+ H++G DYVYNP+
Sbjct  5748  LVFVLWAGSLELTTMRYFVKIGPIKYC-YCGNSATCYNSVSNEYCCFKHALGCDYVYNPY  5806

Query  241   MIDVQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEYPIIG  300
               D+QQWG+ G+L  NH  +C +H N H AS DA+MTRCLAVH+CFVK VDWT+ YP I 
Sbjct  5807  AFDIQQWGYVGSLSQNHHTFCNIHRNEHDASGDAVMTRCLAVHDCFVKNVDWTVTYPFIA  5866

Query  301   DELKINAACRKVQHMVVKAALLADKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDKA  360
             +E  IN   R VQ  VV+AAL   K  V+HDIGNPK ++C    D +W  YD QP +   
Sbjct  5867  NEKFINGCGRNVQGHVVRAALKLYKPSVIHDIGNPKGVRCA-VTDAKWYCYDKQPVNSN-  5924

Query  361   YKIEELFYSYATHSDKFTDGVCLFWNCNVDRYPANSIVCRFDTRVLSNLNLPGCDGGSLY  420
               ++ L Y YATH     DG+CLFWNCNVD YP  SIVCRFDTR  S  NL G +GGSLY
Sbjct  5925  --VKLLDYDYATHGQ--LDGLCLFWNCNVDMYPEFSIVCRFDTRTRSVFNLEGVNGGSLY  5980

Query  421   VNKHAFHTPAFDKSAFVNLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLG  480
             VNKHAFHTPA+DK AFV LK +PFFY+ DS C+         ++YVPL++++C+TRCN+G
Sbjct  5981  VNKHAFHTPAYDKRAFVKLKPMPFFYFDDSDCDVVQ----EQVNYVPLRASSCVTRCNIG  6036

Query  481   GAVCRHHANEYRLYLDAYNMMISAGFSLWVYKQFDTYNLWNTF--TRLQ  527
             GAVC  HAN Y+ Y++AYN    AGF++WV   FD YNLW  F  T LQ
Sbjct  6037  GAVCSKHANLYQKYVEAYNTFTQAGFNIWVPHSFDVYNLWQIFIETNLQ  6085


>sp|P0C6W5|R1AB_BCHK9 Replicase polyprotein 1ab OS=Bat coronavirus 
HKU9 OX=694006 GN=rep PE=1 SV=1
Length=6930

 Score = 861 bits (2225),  Expect = 0.0, Method: Composition-based stats.
 Identities = 321/534 (60%), Positives = 388/534 (73%), Gaps = 11/534 (2%)

Query  1     AENVTGLFKDCSKVITGLHPTQAPTHLSVDTKFK-TEGLCVDIPGIPKDMTYRRLISMMG  59
             +E   GLFKDC+K    L P  APT +SV+ KFK  E LCV        M Y RLIS MG
Sbjct  5767  SEVTVGLFKDCAKAE-PLGPAYAPTFVSVNDKFKLNESLCVHFDTTELQMPYNRLISKMG  5825

Query  60    FKMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVA  119
             FK +  + GY  +FITRE+AIR VR W+GFDVEG HA    +GTNLPLQ+GFSTGVN V 
Sbjct  5826  FKFDLNIPGYSKLFITREQAIREVRGWVGFDVEGAHACGPNIGTNLPLQIGFSTGVNFVV  5885

Query  120   VPTGYVDTPNNTDFSRVSAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSD  179
              P+GY+DT + +  + V +K PPGDQFKHLIPLM KG PW+VVR +IV+ML DTL  +SD
Sbjct  5886  TPSGYIDTESGSRLANVVSKAPPGDQFKHLIPLMRKGEPWSVVRKRIVEMLCDTLDGVSD  5945

Query  180   RVVFVLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDTYACWHHSI---GFDYV  236
              V FV WAHGFELT++ YF K+GPER C +C RRAT FS+    Y+CW H     G D+V
Sbjct  5946  TVTFVTWAHGFELTTLHYFAKVGPERKCFMCPRRATLFSSVYGAYSCWSHHRHIGGADFV  6005

Query  237   YNPFMIDVQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEY  296
             YNPF++DVQQWG+ GNLQ NHD  C VH  AHVASCDAIMTRCLA+H+CF   V+W +EY
Sbjct  6006  YNPFLVDVQQWGYVGNLQVNHDNVCDVHKGAHVASCDAIMTRCLAIHDCFCGEVNWDVEY  6065

Query  297   PIIGDELKINAACRKVQHMVVKAALLADKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPC  356
             PII +EL IN ACR VQ +V+KAA+ A     ++DIGNPKAIK        W FYD  P 
Sbjct  6066  PIIANELAINRACRSVQRVVLKAAVKALHIETIYDIGNPKAIKVYGVNVNNWNFYDTNPV  6125

Query  357   SDKAYKIEELFYSYATHSDKFTDGVCLFWNCNVDRYPANSIVCRFDTRVLSNLNLPGCDG  416
                   +++L Y Y  H D+F DG+ +FWNCNVD YP N++VCRFDTRVLS LNL GC+G
Sbjct  6126  ---VEGVKQLHYVYDVHRDQFKDGLAMFWNCNVDCYPHNALVCRFDTRVLSKLNLAGCNG  6182

Query  417   GSLYVNKHAFHTPAFDKSAFVNLKQLPFFYYSDSPCES---HGKQVVSDIDYVPLKSATC  473
             GSLYVN+HAFHT AF+K+AFVNLK LPFFYYSD+ CE+        VS++DYVPLKS  C
Sbjct  6183  GSLYVNQHAFHTDAFNKNAFVNLKPLPFFYYSDTACENATGVSTNYVSEVDYVPLKSNVC  6242

Query  474   ITRCNLGGAVCRHHANEYRLYLDAYNMMISAGFSLWVYKQFDTYNLWNTFTRLQ  527
             ITRCNLGGAVC+ HA+EYR +L++YN M+SAGF+LWV K FD +NLW+TF +LQ
Sbjct  6243  ITRCNLGGAVCKKHADEYRNFLESYNTMVSAGFTLWVDKTFDVFNLWSTFVKLQ  6296


>sp|Q98VG9|R1AB_FIPV Replicase polyprotein 1ab OS=Feline coronavirus 
(strain FIPV WSU-79/1146) OX=33734 GN=rep PE=1 SV=2
Length=6709

 Score = 860 bits (2223),  Expect = 0.0, Method: Composition-based stats.
 Identities = 278/523 (53%), Positives = 351/523 (67%), Gaps = 14/523 (3%)

Query  4     VTGLFKDCSKVITGLHPTQAPTHLSVDTKFKT-EGLCVDIPGIPKDMTYRRLISMMGFKM  62
               GLFKDCSK    + P  A T++S+   FKT +GL V+I    KD+ Y  +IS MGF+ 
Sbjct  5556  TCGLFKDCSKSEQYIPPAYATTYMSLSDNFKTSDGLAVNIG--TKDVKYANVISYMGFRF  5613

Query  63    NYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVAVPT  122
                + GY  +F TR+ A+R+VRAW+GFDVEG H   + VGTN+PLQLGFS GV+ V    
Sbjct  5614  EANIPGYHTLFCTRDFAMRNVRAWLGFDVEGAHVCGDNVGTNVPLQLGFSNGVDFVVQTE  5673

Query  123   GYVDTPNNTDFSRVSAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSDRVV  182
             G V T        V A+ PPG+QF HLIPLM KG PW++VR +IVQM+ D    LSD ++
Sbjct  5674  GCVVTEKGNSIEVVKARAPPGEQFAHLIPLMRKGQPWHIVRRRIVQMVCDYFDGLSDILI  5733

Query  183   FVLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNPFMI  242
             FVLWA G ELT+M+YFVKIG  + C  C + ATC+S++   YAC+ H++G DY+YNP+ I
Sbjct  5734  FVLWAGGLELTTMRYFVKIGRPQKCE-CGKSATCYSSSQCVYACFKHALGCDYLYNPYCI  5792

Query  243   DVQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEYPIIGDE  302
             D+QQWG+TG+L  NH   C +H N HVAS DAIMTRCLA+H+CFVKRVDW+I YP I +E
Sbjct  5793  DIQQWGYTGSLSMNHHEVCNIHRNEHVASGDAIMTRCLAIHDCFVKRVDWSIVYPFIDNE  5852

Query  303   LKINAACRKVQHMVVKAALLADKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDKAYK  362
              KIN A R VQ  V+KAAL       +HD+GNPK I+C     + W  YD  P ++    
Sbjct  5853  EKINKAGRIVQSHVMKAALKIFNPAAIHDVGNPKGIRCATTP-IPWFCYDRDPINNNVRC  5911

Query  363   IEELFYSYATHSDKFTDGVCLFWNCNVDRYPANSIVCRFDTRVLSNLNLPGCDGGSLYVN  422
             +E   Y Y  H     +G+ LFWNCNVD YP  SIVCRFDTR  S L+L GC+GG+LYVN
Sbjct  5912  LE---YDYMVHGQ--MNGLMLFWNCNVDMYPEFSIVCRFDTRTRSKLSLEGCNGGALYVN  5966

Query  423   KHAFHTPAFDKSAFVNLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLGGA  482
              HAFHTPA+D+ AF  LK +PFFYY DS CE    Q     +YVPLKS  CIT+CN+GGA
Sbjct  5967  NHAFHTPAYDRRAFAKLKPMPFFYYDDSNCELVDGQP----NYVPLKSNVCITKCNIGGA  6022

Query  483   VCRHHANEYRLYLDAYNMMISAGFSLWVYKQFDTYNLWNTFTR  525
             VC+ HA  YR Y++ YNM + AGF++W  + FDTY LW+ F  
Sbjct  6023  VCKKHAALYRAYVEDYNMFMQAGFTIWCPQNFDTYMLWHGFVN  6065


>sp|P0C6Y5|R1AB_CVPPU Replicase polyprotein 1ab OS=Porcine transmissible 
gastroenteritis coronavirus (strain Purdue) OX=11151 
GN=rep PE=1 SV=1
Length=6684

 Score = 858 bits (2217),  Expect = 0.0, Method: Composition-based stats.
 Identities = 277/523 (53%), Positives = 350/523 (67%), Gaps = 14/523 (3%)

Query  4     VTGLFKDCSKVITGLHPTQAPTHLSVDTKFKT-EGLCVDIPGIPKDMTYRRLISMMGFKM  62
               GLFKDCSK    + P  A T++S+   FKT +GL V+I    KD+ Y  +IS MGF+ 
Sbjct  5531  TCGLFKDCSKSEQYIPPAYATTYMSLSDNFKTSDGLAVNIG--TKDVKYANVISYMGFRF  5588

Query  63    NYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVAVPT  122
                + GY  +F TR+ A+R+VRAW+GFDVEG H   + VGTN+PLQLGFS GV+ V    
Sbjct  5589  EANIPGYHTLFCTRDFAMRNVRAWLGFDVEGAHVCGDNVGTNVPLQLGFSNGVDFVVQTE  5648

Query  123   GYVDTPNNTDFSRVSAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSDRVV  182
             G V T        V A+ PPG+QF HLIPLM KG PW++VR +IVQM+ D    LSD ++
Sbjct  5649  GCVITEKGNSIEVVKARAPPGEQFAHLIPLMRKGQPWHIVRRRIVQMVCDYFDGLSDILI  5708

Query  183   FVLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNPFMI  242
             FVLWA G ELT+M+YFVKIG  + C  C + ATC+S++   YAC+ H++G DY+YNP+ I
Sbjct  5709  FVLWAGGLELTTMRYFVKIGRPQKCE-CGKSATCYSSSQSVYACFKHALGCDYLYNPYCI  5767

Query  243   DVQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEYPIIGDE  302
             D+QQWG+TG+L  NH   C +H N HVAS DAIMTRCLA+H+CFVKRVDW+I YP I +E
Sbjct  5768  DIQQWGYTGSLSMNHHEVCNIHRNEHVASGDAIMTRCLAIHDCFVKRVDWSIVYPFIDNE  5827

Query  303   LKINAACRKVQHMVVKAALLADKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDKAYK  362
              KIN A R VQ  V+KAAL       +HD+GNPK I+C     + W  YD  P ++    
Sbjct  5828  EKINKAGRIVQSHVMKAALKIFNPAAIHDVGNPKGIRCATTP-IPWFCYDRDPINNNVRC  5886

Query  363   IEELFYSYATHSDKFTDGVCLFWNCNVDRYPANSIVCRFDTRVLSNLNLPGCDGGSLYVN  422
                L Y Y  H     +G+ LFWNCNVD YP  SIVCRFDTR  S L+L GC+GG+LYVN
Sbjct  5887  ---LDYDYMVHGQ--MNGLMLFWNCNVDMYPEFSIVCRFDTRTRSKLSLEGCNGGALYVN  5941

Query  423   KHAFHTPAFDKSAFVNLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLGGA  482
              HAFHTPA+D+ AF  LK +PFFYY DS CE    Q     +YVPLKS  CIT+CN+GGA
Sbjct  5942  NHAFHTPAYDRRAFAKLKPMPFFYYDDSNCELVDGQP----NYVPLKSNVCITKCNIGGA  5997

Query  483   VCRHHANEYRLYLDAYNMMISAGFSLWVYKQFDTYNLWNTFTR  525
             VC+ HA  YR Y++ YN+ + AGF++W  + FDTY LW+ F  
Sbjct  5998  VCKKHAALYRAYVEDYNIFMQAGFTIWCPQNFDTYMLWHGFVN  6040


>sp|P0C6Y3|R1AB_IBVM Replicase polyprotein 1ab OS=Avian infectious 
bronchitis virus (strain M41) OX=11127 GN=rep PE=1 SV=1
Length=6631

 Score = 825 bits (2132),  Expect = 0.0, Method: Composition-based stats.
 Identities = 277/525 (53%), Positives = 367/525 (70%), Gaps = 7/525 (1%)

Query  5     TGLFKDCSKVITGLHPTQAPTHLSVDTKFKTEGLCVDIPGIP--KDMTYRRLISMMGFKM  62
             TGLFK C+K  +G+HP  A T  ++   +K       +  +    ++TY+ LIS++GFKM
Sbjct  5472  TGLFKICNKEFSGVHPAYAVTTKALAATYKVNDELAALVNVEAGSEITYKHLISLLGFKM  5531

Query  63    NYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVAVPT  122
             +  V G  NMFITR+EAIR+VR W+GFDVE  HA    +GTNLP Q+GFSTG + V  P 
Sbjct  5532  SVNVEGCHNMFITRDEAIRNVRGWVGFDVEATHACGTNIGTNLPFQVGFSTGADFVVTPE  5591

Query  123   GYVDTPNNTDFSRVSAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSDRVV  182
             G VDT    +F  V++K PPG+QF HL  L     PW+VVR +IVQML+D L N+SD VV
Sbjct  5592  GLVDTSIGNNFEPVNSKAPPGEQFNHLRALFKSAKPWHVVRPRIVQMLADNLCNVSDCVV  5651

Query  183   FVLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNPFMI  242
             FV W HG ELT+++YFVKIG ++ C  C  RAT F++ +  YACW H +GFD+VYNP ++
Sbjct  5652  FVTWCHGLELTTLRYFVKIGKDQVCS-CGSRATTFNSHTQAYACWKHCLGFDFVYNPLLV  5710

Query  243   DVQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEYPIIGDE  302
             D+QQWG++GNLQ NHDL+C VHG+AHVAS DAIMTRCLA++  F + V+W + YP I +E
Sbjct  5711  DIQQWGYSGNLQFNHDLHCNVHGHAHVASADAIMTRCLAINNAFCQDVNWDLTYPHIANE  5770

Query  303   LKINAACRKVQHMVVKAALLADKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDKAYK  362
              ++N++CR +Q M + A + A K  V++DIGNPK IKCV + D+ ++FYD  P      +
Sbjct  5771  DEVNSSCRYLQRMYLNACVDALKVNVVYDIGNPKGIKCVRRGDLNFRFYDKNPIVPNVKQ  5830

Query  363   IEELFYSYATHSDKFTDGVCLFWNCNVDRYPANSIVCRFDTRVLSNLNLPGCDGGSLYVN  422
              E   Y Y  H DKF DG+C+FWNCNVD YP NS+VCR+DTR LS  NLPGC+GGSLYVN
Sbjct  5831  FE---YDYNQHKDKFADGLCMFWNCNVDCYPDNSLVCRYDTRNLSVFNLPGCNGGSLYVN  5887

Query  423   KHAFHTPAFDKSAFVNLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLGGA  482
             KHAFHTP FD+++F NLK +PFF+Y  SPCE+     V+  D V L +  CIT+CN+GGA
Sbjct  5888  KHAFHTPKFDRTSFRNLKAMPFFFYDSSPCETIQLDGVAQ-DLVSLATKDCITKCNIGGA  5946

Query  483   VCRHHANEYRLYLDAYNMMISAGFSLWVYKQFDTYNLWNTFTRLQ  527
             VC+ HA  Y  ++ +YN  ++AGF+ WV   F+ YNLW +F+ LQ
Sbjct  5947  VCKKHAQMYADFVTSYNAAVTAGFTFWVTNNFNPYNLWKSFSALQ  5991


>sp|P0C6Y2|R1AB_IBVBC Replicase polyprotein 1ab OS=Avian infectious 
bronchitis virus (strain Beaudette CK) OX=160235 GN=rep 
PE=3 SV=1
Length=6629

 Score = 814 bits (2102),  Expect = 0.0, Method: Composition-based stats.
 Identities = 276/525 (53%), Positives = 366/525 (70%), Gaps = 7/525 (1%)

Query  5     TGLFKDCSKVITGLHPTQAPTHLSVDTKFKTEGLCVDIPGIP--KDMTYRRLISMMGFKM  62
             TGLFK C+K  +G+HP  A T  ++   +K       +  +    ++TY+ LIS++GFKM
Sbjct  5470  TGLFKICNKEFSGVHPAYAVTTKALAATYKVNDELAALVNVEAGSEITYKHLISLLGFKM  5529

Query  63    NYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVAVPT  122
             +  V G  NMFITR+EAIR+VR W+GFDVE  HA    +GTNLP Q+GFSTG + V  P 
Sbjct  5530  SVNVEGCHNMFITRDEAIRNVRGWVGFDVEATHACGTNIGTNLPFQVGFSTGADFVVTPE  5589

Query  123   GYVDTPNNTDFSRVSAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSDRVV  182
             G VDT    +F  V++K PPG+QF HL  L     PW+V+R +IVQML+D L N+SD VV
Sbjct  5590  GLVDTSIGNNFEPVNSKAPPGEQFNHLRVLFKSAKPWHVIRPRIVQMLADNLCNVSDCVV  5649

Query  183   FVLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNPFMI  242
             FV W HG ELT+++YFVKIG E+ C  C  RAT F++ +  YACW H +GFD+VYNP ++
Sbjct  5650  FVTWCHGLELTTLRYFVKIGKEQVCS-CGSRATTFNSHTQAYACWKHCLGFDFVYNPLLV  5708

Query  243   DVQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEYPIIGDE  302
             D+QQWG++GNLQ NHDL+C VHG+AHVAS DAIMTRCLA++  F + V+W + YP I +E
Sbjct  5709  DIQQWGYSGNLQFNHDLHCNVHGHAHVASVDAIMTRCLAINNAFCQDVNWDLTYPHIANE  5768

Query  303   LKINAACRKVQHMVVKAALLADKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDKAYK  362
              ++N++CR +Q M + A + A K  V++DIGNPK IKCV + DV ++FYD  P      +
Sbjct  5769  DEVNSSCRYLQRMYLNACVDALKVNVVYDIGNPKGIKCVRRGDVNFRFYDKNPIVRNVKQ  5828

Query  363   IEELFYSYATHSDKFTDGVCLFWNCNVDRYPANSIVCRFDTRVLSNLNLPGCDGGSLYVN  422
              E   Y Y  H DKF DG+C+FWNCNVD YP NS+VCR+DTR LS  NLPGC+GGSLYVN
Sbjct  5829  FE---YDYNQHKDKFADGLCMFWNCNVDCYPDNSLVCRYDTRNLSVFNLPGCNGGSLYVN  5885

Query  423   KHAFHTPAFDKSAFVNLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLGGA  482
             KHAF+TP FD+ +F NLK +PFF+Y  SPCE+     V+  D V L +  CIT+CN+GGA
Sbjct  5886  KHAFYTPKFDRISFRNLKAMPFFFYDSSPCETIQVDGVAQ-DLVSLATKDCITKCNIGGA  5944

Query  483   VCRHHANEYRLYLDAYNMMISAGFSLWVYKQFDTYNLWNTFTRLQ  527
             VC+ HA  Y  ++ +YN  ++AGF+ WV  + + YNLW +F+ LQ
Sbjct  5945  VCKKHAQMYAEFVTSYNAAVTAGFTFWVTNKLNPYNLWKSFSALQ  5989


>sp|P0C6Y1|R1AB_IBVB Replicase polyprotein 1ab OS=Avian infectious 
bronchitis virus (strain Beaudette) OX=11122 GN=rep PE=1 
SV=1
Length=6629

 Score = 814 bits (2102),  Expect = 0.0, Method: Composition-based stats.
 Identities = 276/525 (53%), Positives = 366/525 (70%), Gaps = 7/525 (1%)

Query  5     TGLFKDCSKVITGLHPTQAPTHLSVDTKFKTEGLCVDIPGIP--KDMTYRRLISMMGFKM  62
             TGLFK C+K  +G+HP  A T  ++   +K       +  +    ++TY+ LIS++GFKM
Sbjct  5470  TGLFKICNKEFSGVHPAYAVTTKALAATYKVNDELAALVNVEAGSEITYKHLISLLGFKM  5529

Query  63    NYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVAVPT  122
             +  V G  NMFITR+EAIR+VR W+GFDVE  HA    +GTNLP Q+GFSTG + V  P 
Sbjct  5530  SVNVEGCHNMFITRDEAIRNVRGWVGFDVEATHACGTNIGTNLPFQVGFSTGADFVVTPE  5589

Query  123   GYVDTPNNTDFSRVSAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSDRVV  182
             G VDT    +F  V++K PPG+QF HL  L     PW+V+R +IVQML+D L N+SD VV
Sbjct  5590  GLVDTSIGNNFEPVNSKAPPGEQFNHLRVLFKSAKPWHVIRPRIVQMLADNLCNVSDCVV  5649

Query  183   FVLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNPFMI  242
             FV W HG ELT+++YFVKIG E+ C  C  RAT F++ +  YACW H +GFD+VYNP ++
Sbjct  5650  FVTWCHGLELTTLRYFVKIGKEQVCS-CGSRATTFNSHTQAYACWKHCLGFDFVYNPLLV  5708

Query  243   DVQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEYPIIGDE  302
             D+QQWG++GNLQ NHDL+C VHG+AHVAS DAIMTRCLA++  F + V+W + YP I +E
Sbjct  5709  DIQQWGYSGNLQFNHDLHCNVHGHAHVASVDAIMTRCLAINNAFCQDVNWDLTYPHIANE  5768

Query  303   LKINAACRKVQHMVVKAALLADKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDKAYK  362
              ++N++CR +Q M + A + A K  V++DIGNPK IKCV + DV ++FYD  P      +
Sbjct  5769  DEVNSSCRYLQRMYLNACVDALKVNVVYDIGNPKGIKCVRRGDVNFRFYDKNPIVRNVKQ  5828

Query  363   IEELFYSYATHSDKFTDGVCLFWNCNVDRYPANSIVCRFDTRVLSNLNLPGCDGGSLYVN  422
              E   Y Y  H DKF DG+C+FWNCNVD YP NS+VCR+DTR LS  NLPGC+GGSLYVN
Sbjct  5829  FE---YDYNQHKDKFADGLCMFWNCNVDCYPDNSLVCRYDTRNLSVFNLPGCNGGSLYVN  5885

Query  423   KHAFHTPAFDKSAFVNLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLGGA  482
             KHAF+TP FD+ +F NLK +PFF+Y  SPCE+     V+  D V L +  CIT+CN+GGA
Sbjct  5886  KHAFYTPKFDRISFRNLKAMPFFFYDSSPCETIQVDGVAQ-DLVSLATKDCITKCNIGGA  5944

Query  483   VCRHHANEYRLYLDAYNMMISAGFSLWVYKQFDTYNLWNTFTRLQ  527
             VC+ HA  Y  ++ +YN  ++AGF+ WV  + + YNLW +F+ LQ
Sbjct  5945  VCKKHAQMYAEFVTSYNAAVTAGFTFWVTNKLNPYNLWKSFSALQ  5989


>sp|Q008X6|R1AB_WBV24 Replicase polyprotein 1ab OS=White bream 
virus (isolate Blicca bjoerkna L./Germany/DF24/00) OX=766180 
GN=rep PE=1 SV=1
Length=6872

 Score = 117 bits (293),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 37/110 (34%), Positives = 54/110 (49%), Gaps = 8/110 (7%)

Query  179   DRVVFVLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDTYA--CWHHS---IGF  233
             +RVV+VL+  G +L ++     +G + TC  C + AT ++   +     C HH+      
Sbjct  6074  NRVVYVLYGAGNDLRALTNLNIVG-DYTCEKCTKEATFYTIHREIVHTFCNHHAPSQFPL  6132

Query  234   DYVYNPFMIDVQQWGFTG-NLQSNHDLYC-QVHGNAHVASCDAIMTRCLA  281
                 N   ID+Q       +L + H   C Q HG+AH AS D IMT CLA
Sbjct  6133  MGTINAQAIDIQHASANKQSLTNTHAEVCNQQHGDAHTASADTIMTGCLA  6182


>sp|P0C6V8|R1AB_BRV1 Replicase polyprotein 1ab OS=Breda virus 
1 OX=360393 GN=rep PE=2 SV=1
Length=6733

 Score = 117 bits (293),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 37/134 (28%), Positives = 60/134 (45%), Gaps = 21/134 (16%)

Query  183   FVLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDTYACW--HHSIGFDYVYNPF  240
             F+L++   +L S+K++V+ G    C  C   A C       Y C   + ++    + N  
Sbjct  5953  FILYSCSNDLKSLKFYVEFGTNYFCS-CGELAICL-MRDGLYKCRNCYGNMSISKLVNCK  6010

Query  241   MIDVQQWGFTGNLQSNHDLYCQ-VHGNAHVASCDAIMTRC--LAVHEC------------  285
              +DVQ+      LQ  HD  CQ  HG++H A CDA+MT+C  LA ++             
Sbjct  6011  YLDVQKERI--KLQDAHDAICQQFHGDSHEALCDAVMTKCLYLASYDAAFKDTIHVKYKD  6068

Query  286   FVKRVDWTIEYPII  299
                 + + I  P +
Sbjct  6069  LCLEIQYKITSPYV  6082


>sp|P0C6V7|R1AB_BEV Replicase polyprotein 1ab OS=Berne virus OX=11156 
GN=rep PE=1 SV=1
Length=6857

 Score = 112 bits (280),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 33/101 (33%), Positives = 50/101 (50%), Gaps = 7/101 (7%)

Query  183   FVLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDTYACW--HHSIGFDYVYNPF  240
             F+L++   +L S+K++V+      C  C   A C       Y C   +  +    + N  
Sbjct  6077  FILYSCSNDLKSLKFYVEFDTCYFCS-CGEMAICL-MRDGNYKCRNCYGGMLISKLVNCK  6134

Query  241   MIDVQQWGFTGNLQSNHDLYCQ-VHGNAHVASCDAIMTRCL  280
              +DVQ+      LQ  HD  CQ  HG++H A CDA+MT+CL
Sbjct  6135  YLDVQKERV--KLQDAHDAICQQFHGDSHEALCDAVMTKCL  6173


>sp|P0C664|ZWILC_CAEBR Protein zwilch homolog OS=Caenorhabditis 
briggsae OX=6238 GN=zwl-1 PE=3 SV=1
Length=639

 Score = 34.2 bits (77),  Expect = 3.9, Method: Composition-based stats.
 Identities = 11/34 (32%), Positives = 21/34 (62%), Gaps = 0/34 (0%)

Query  162  VRIKIVQMLSDTLKNLSDRVVFVLWAHGFELTSM  195
            +R +I+   SDTL+  SD + F+L     +L+++
Sbjct  447  LRGRIINKFSDTLQFPSDELTFILKTCENDLSTL  480



Lambda      K        H        a         alpha
   0.318    0.144    0.478    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0441    0.140     1.90     42.6     43.6 

Effective search space used: 54163932156

Search has CONVERGED!


  Database: uniprot_sprot.fasta
    Posted date:  Apr 8, 2021  2:26 PM
  Number of letters in database: 203,519,613
  Number of sequences in database:  564,638



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40