#WARNING:no index is registered index "YP_009725305.1" in "https://rest.uniprot.org/uniprotkb/" url "https://rest.uniprot.org/uniprotkb/YP_009725305.1.txt".
Please visit the UniProt website(https://www.uniprot.org), and get a proper ID/AC for your query protein.

Contact Molecules for Homologous Proteins

[Full Bars]
[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]
[Back to HOMCOS]

[SupCon3D]
[help] 		seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
3540848 113 67 YP_009725305.1()
QUERYSEQ 
NNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [YP_009725305.1()]

113
region name description
1-8 DISORDER predicted by DISOPRED

MONOMER
113
pdb_id a1 identity[%]2 description
6w4b B 100.0 R1AB_SARS2 Non-structural protein 9 
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HETERO
113 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
7cyq[18] A R1AB_SARS2 RNA-directed RNA polymerase[926 aa] I 100.0
/100.0		 12
/12		 R1AB_SARS2 Non-structural protein 9
7egq[2] G R1AB_SARS2 Non-structural protein 10[131 aa] F 100.0
/100.0		 1
/1		 R1AB_SARS2 Non-structural protein 9
7egq[2] H R1AB_SARS2 Proofreading exoribonuclease[523 aa] F 100.0
/100.0		 1
/1		 R1AB_SARS2 Non-structural protein 9
7eiz[1] I R1AB_SARS2 Proofreading exoribonuclease[523 aa] E 100.0
/100.0		 1
/1		 R1AB_SARS2 Non-structural protein 9
8dqu[12] A Nanobody[127 aa] C 100.0
/100.0		 15
/15		 R1AB_SARS2 Non-structural protein 9
2j98[2] B R1A_CVH22 REPLICASE POLYPROTEIN 1AB[102 aa] A 66.7
/43.4		 15
/15		 R1A_CVH22 REPLICASE POLYPROTEIN 1AB
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
NUCLEOTIDE
113 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
8gwb[1] H RNA (5'-R(P*AP*U)-3') G 100.0
/100.0		 1
/1		 R1AB_SARS2 Non-structural protein 9
8gwe[1] H RNA (5'-R(P*AP*UP*UP*A)-3') G 100.0
/100.0		 1
/1		 R1AB_SARS2 Non-structural protein 9
8sqj[1] H SARS-CoV-2 5' UTR E 100.0
/100.0		 1
/1		 R1AB_SARS2 Non-structural protein 9
8sqk[1] H SARS-CoV-2 5' UTR E 100.0
/100.0		 1
/1		 R1AB_SARS2 Non-structural protein 9
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
COMPOUND
113 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
7cyq[1] L GDP
GUANOSINE-5'-DIPHOSPHATE[28 atoms] 		I 100.0
/100.0		 1
/1		 R1AB_SARS2 Non-structural protein 9
7kri[12] E X0Y
1,3-dimethyl-1H-pyrrolo[3,4-d]pyrimidine-2,4(3H,6H.. 		A 100.0
/100.0		 6
/7		 R1AB_SARS2 Non-structural protein 9
7n3k[8] I ODN
(1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14.. 		A 100.0
/100.0		 5
/5		 R1AB_SARS2 Non-structural protein 9
7n3k[8] J ODN
(1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14.. 		A 100.0
/100.0		 2
/3		 R1AB_SARS2 Non-structural protein 9
8gw1[2] T U5P
URIDINE-5'-MONOPHOSPHATE[20 atoms] 		I 100.0
/100.0		 1
/1		 R1AB_SARS2 Non-structural protein 9
8gwf[2] L GTP
GUANOSINE-5'-TRIPHOSPHATE[32 atoms] 		I 100.0
/100.0		 1
/1		 R1AB_SARS2 Non-structural protein 9
8gwi[1] L GTP
GUANOSINE-5'-TRIPHOSPHATE[32 atoms] 		I 100.0
/100.0		 1
/1		 R1AB_SARS2 Non-structural protein 9
8gwk[1] T F86
[(2~{R},3~{S},4~{R},5~{R})-5-(4-azanylpyrrolo[2,1-.. 		I 100.0
/100.0		 1
/1		 R1AB_SARS2 Non-structural protein 9
8gwm[1] S 6GS
2'-deoxy-2'-fluoro-2'-methyluridine 5'-(trihydroge.. 		G 100.0
/100.0		 1
/1		 R1AB_SARS2 Non-structural protein 9
8sq9[1] O WSB
5'-O-[(S)-hydroxy{[(S)-hydroxy(phosphonooxy)phosph.. 		E 100.0
/100.0		 1
/1		 R1AB_SARS2 Non-structural protein 9
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
METAL
113 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
7cyq[1] M MG
MAGNESIUM ION[1 atoms] 		I 100.0
/100.0		 1
/1		 R1AB_SARS2 Non-structural protein 9
8sq9[1] N MG
MAGNESIUM ION[1 atoms] 		E 100.0
/100.0		 1
/1		 R1AB_SARS2 Non-structural protein 9
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
HOMO
113 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
1qz8[2] A R1AB_CVHSA polyprotein 1ab[111 aa] A 100.0
/97.3		 6
/6		 R1AB_CVHSA polyprotein 1ab
1qz8[20] B R1AB_CVHSA polyprotein 1ab[110 aa] A 100.0
/97.3		 17
/17		 R1AB_CVHSA polyprotein 1ab
1uw7[2] A R1AB_CVHSA NSP9[122 aa] A 100.0
/97.3		 21
/24		 R1AB_CVHSA NSP9
6w9q[16] A R1AB_SARS2 3C-like proteinase peptide, Non-structural protein.. A 100.0
/100.0		 20
/24		 R1AB_SARS2 3C-like proteinase peptide, Non-structural protein..
7kri[6] B R1AB_SARS2 Non-structural protein 9[127 aa] A 100.0
/100.0		 1
/1		 R1AB_SARS2 Non-structural protein 9
7kri[6] C R1AB_SARS2 Non-structural protein 9[123 aa] A 100.0
/100.0		 5
/5		 R1AB_SARS2 Non-structural protein 9
7kri[6] C R1AB_SARS2 Non-structural protein 9[123 aa] A 100.0
/100.0		 15
/18		 R1AB_SARS2 Non-structural protein 9
8dqu[12] D R1AB_SARS2 Non-structural protein 9[74 aa] C 100.0
/100.0		 26
/26		 R1AB_SARS2 Non-structural protein 9
2j97[2] A R1A_CVH22 REPLICASE POLYPROTEIN 1AB[98 aa] A 86.4
/54.9		 22
/22		 R1A_CVH22 REPLICASE POLYPROTEIN 1AB
5hiy[6] B R1AB_PEDV7 Non-structural protein 9[96 aa] A 44.4
/49.3		 9
/10		 R1AB_PEDV7 Non-structural protein 9
5c94[2] A R1AB_IBVM Non-structural protein 9[116 aa] A 64.7
/39.6		 17
/21		 R1AB_IBVM Non-structural protein 9
5ym6[4] B X2G6C4_9NIDO nsp9[99 aa] A 73.7
/38.5		 19
/19		 X2G6C4_9NIDO nsp9
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
113 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
1qz8[4] C SO4
SULFATE ION[5 atoms] 		A 100.0
/97.3		 2
/2		 R1AB_CVHSA polyprotein 1ab
1qz8[10] C SO4
SULFATE ION[5 atoms] 		A 100.0
/97.3		 3
/3		 R1AB_CVHSA polyprotein 1ab
1qz8[6] E SO4
SULFATE ION[5 atoms] 		A 66.7
/97.3		 3
/3		 R1AB_CVHSA polyprotein 1ab
1qz8[8] F SO4
SULFATE ION[5 atoms] 		B 50.0
/97.3		 2
/2		 R1AB_CVHSA polyprotein 1ab
2j97[4] C SO4
SULFATE ION[5 atoms] 		A 40.0
/54.9		 5
/5		 R1A_CVH22 REPLICASE POLYPROTEIN 1AB
6wc1[2] C SO4
SULFATE ION[5 atoms] 		A 100.0
/100.0		 2
/2		 SARS-coV-2 Non-structural protein 9
6wxd[1] D SO4
SULFATE ION[5 atoms] 		B 100.0
/100.0		 3
/3		 R1AB_SARS2 Non-structural protein 9
7bwq[1] K SO4
SULFATE ION[5 atoms] 		F 100.0
/100.0		 2
/2		 Nsp9
7kri[3] J SO4
SULFATE ION[5 atoms] 		C 100.0
/100.0		 1
/1		 R1AB_SARS2 Non-structural protein 9
7n3k[8] K SO4
SULFATE ION[5 atoms] 		A 100.0
/100.0		 1
/1		 R1AB_SARS2 Non-structural protein 9
3ee7[5] E PO4
PHOSPHATE ION[5 atoms] 		A 75.0
/96.2		 4
/4		 R1A_CVHSA Replicase polyprotein 1a
3ee7[4] F PO4
PHOSPHATE ION[5 atoms] 		A 100.0
/96.2		 1
/1		 R1A_CVHSA Replicase polyprotein 1a
3ee7[1] M PO4
PHOSPHATE ION[5 atoms] 		B 66.7
/96.3		 3
/3		 R1A_CVHSA Replicase polyprotein 1a
3ee7[1] P PO4
PHOSPHATE ION[5 atoms] 		D 100.0
/96.3		 1
/1		 R1A_CVHSA Replicase polyprotein 1a
6w9q[2] B PO4
PHOSPHATE ION[5 atoms] 		A 100.0
/100.0		 1
/1		 R1AB_SARS2 3C-like proteinase peptide, Non-structural protein..
7kri[8] K MLI
MALONATE ION[7 atoms] 		A 100.0
/100.0		 3
/3		 R1AB_SARS2 Non-structural protein 9
7thm[1] I POP
PYROPHOSPHATE 2-[9 atoms] 		E 100.0
/100.0		 1
/1		 R1AB_SARS2 Non-structural protein 9
2j97[2] B MPD
(4S)-2-METHYL-2,4-PENTANEDIOL[8 atoms] 		A 100.0
/54.9		 4
/5		 R1A_CVH22 REPLICASE POLYPROTEIN 1AB
2j98[1] C DTT
2,3-DIHYDROXY-1,4-DITHIOBUTANE[8 atoms] 		A 50.0
/43.4		 6
/6		 R1A_CVH22 REPLICASE POLYPROTEIN 1AB
3ee7[6] H GOL
GLYCEROL[6 atoms] 		A 100.0
/96.2		 1
/1		 R1A_CVHSA Replicase polyprotein 1a
3ee7[3] I GOL
GLYCEROL[6 atoms] 		A 75.0
/96.2		 4
/4		 R1A_CVHSA Replicase polyprotein 1a
3ee7[1] J GOL
GLYCEROL[6 atoms] 		A 100.0
/96.2		 6
/6		 R1A_CVHSA Replicase polyprotein 1a
3ee7[2] N GOL
GLYCEROL[6 atoms] 		B 100.0
/96.3		 4
/4		 R1A_CVHSA Replicase polyprotein 1a
3ee7[1] O GOL
GLYCEROL[6 atoms] 		B 100.0
/96.3		 3
/3		 R1A_CVHSA Replicase polyprotein 1a
3ee7[1] S GOL
GLYCEROL[6 atoms] 		C 100.0
/96.3		 4
/4		 R1A_CVHSA Replicase polyprotein 1a
3ee7[1] T GOL
GLYCEROL[6 atoms] 		C 100.0
/96.3		 2
/2		 R1A_CVHSA Replicase polyprotein 1a
3ee7[5] BA GOL
GLYCEROL[6 atoms] 		D 100.0
/96.3		 2
/2		 R1A_CVHSA Replicase polyprotein 1a
3ee7[1] X GOL
GLYCEROL[6 atoms] 		D 100.0
/96.3		 4
/4		 R1A_CVHSA Replicase polyprotein 1a
3ee7[1] Y GOL
GLYCEROL[6 atoms] 		D 100.0
/96.3		 3
/3		 R1A_CVHSA Replicase polyprotein 1a
5c94[2] B PEG
DI(HYDROXYETHYL)ETHER[7 atoms] 		A 25.0
/39.6		 4
/4		 R1AB_IBVM Non-structural protein 9
5c94[2] C PEG
DI(HYDROXYETHYL)ETHER[7 atoms] 		A 80.0
/39.6		 5
/5		 R1AB_IBVM Non-structural protein 9
5c94[2] C PEG
DI(HYDROXYETHYL)ETHER[7 atoms] 		A 40.0
/39.6		 5
/5		 R1AB_IBVM Non-structural protein 9
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.