HOMCOS(prot_sch_conbars.cgi):

		Contact Molecules for Homologous Proteins
[Full Bars]	[SiteTable]	Summary Bars[0.0 %]	[Back to Search Page]	[Back to HOMCOS]
	[help]	seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]	[show] [download] [help]

PID

QueryLength

Homolgous Sequence in PDB

UniProt Query

TITLE

1679080

427

Q14653(IRF3_HUMAN)

RecName: Full=Interferon regulatory factor 3 ; Short=IRF-3 ;

QUERYSEQ

MGTPKPRILPWLVSQLDLGQLEGVAWVNKSRTRFRIPWKHGLRQDAQQEDFGIFQAWAEATGAYVPGRDKPDLPTWKRNFRSALNRKEGLRLAEDRSKDPHDPHKIYEFVNSGVGDFSQPDTSPDTNGGGSTSDTQEDILDELLGNMVLA
PLPDPGPPSLAVAPEPCPQPLRSPSLDNPTPFPNLGPSENPLKRLLVPGEEWEFEVTAFYRGRQVFQQTISCPEGLRLVGSEVGDRTLPGWPVTLPDPGMSLTDRGVMSYVRHVLSCLGGGLALWRAGQWLWAQRLGHCHTYWAVSEELL
PNSGHGPDGEVPKDKEGGVFDLGPFIVDLITFTEGSGRSPRYALWFCVGESWPQDQPWTKRLVMVKVVPTCLRALVEMARVGGASSLENTVDLHISNSHPLSLTSDQYKAYLQDLVEGMDFQGPGES

[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [Q14653(IRF3_HUMAN)]

427
	region	name	description
	1-427	CHAIN	/note="Interferon regulatory factor 3" /id="PRO_0000154553"
	5-111	DNA_BIND	/note="IRF tryptophan pentad repeat"
	91-136	REGION	/note="Disordered"
	141-427	REGION	/note="Mediates interaction with ZDHHC11"
	200-360	REGION	/note="Interaction with HERC5"
	91-106	COMPBIAS	/note="Basic and acidic residues"
	115-136	COMPBIAS	/note="Polar residues"
	1-427	DISORDER	predicted by DISOPRED

MONOMER

427

pdb_id a¹ identity[%]² description

1qwt B 100.0 IRF3_HUMAN Interferon regulatory factor 3

2pi0 D 100.0 IRF3_HUMAN Interferon regulatory factor 3

1.a¹:asym_id for the homologue. 2.identity[%]²:sequence identity between the query and the homologue.

HETERO

427 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

1t2k[1] F ATF2_HUMAN Cyclic-AMP-dependent transcription factor ATF-2[61.. C 100.0
/100.0 3
/3 IRF3_HUMAN Interferon regulatory factor 3

5jej[1] B STING_HUMAN Stimulator of interferon genes protein[10 aa] D 100.0
/100.0 15
/15 IRF3_HUMAN Interferon regulatory factor 3

5jej[1] C STING_HUMAN Stimulator of interferon genes protein[4 aa] D 100.0
/100.0 2
/2 IRF3_HUMAN Interferon regulatory factor 3

5jej[1] C STING_HUMAN Stimulator of interferon genes protein[4 aa] E 100.0
/100.0 5
/5 IRF3_HUMAN Interferon regulatory factor 3

5jej[1] A STING_HUMAN Stimulator of interferon genes protein[21 aa] E 100.0
/100.0 15
/15 IRF3_HUMAN Interferon regulatory factor 3

5jek[1] C MAVS peptide[14 aa] A 100.0
/100.0 13
/13 IRF3_HUMAN Interferon regulatory factor 3

5jek[1] D MAVS peptide[16 aa] B 100.0
/100.0 12
/12 IRF3_HUMAN Interferon regulatory factor 3

5jel[2] B Phosphorylated TRIF peptide[14 aa] A 100.0
/100.0 16
/16 IRF3_HUMAN Interferon regulatory factor 3

5jeo[2] A Rotavirus NSP1 peptide[10 aa] B 100.0
/100.0 17
/17 IRF3_HUMAN Interferon regulatory factor 3

5jer[4] A Rotavirus NSP1 peptide[10 aa] E 100.0
/100.0 14
/14 IRF3_HUMAN Interferon regulatory factor 3

5jer[1] D Rotavirus NSP1 peptide[10 aa] F 100.0
/100.0 1
/1 IRF3_HUMAN Interferon regulatory factor 3

1zoq[2] B CBP_HUMAN CREB-binding protein[47 aa] A 100.0
/100.0 18
/18 IRF3_HUMAN Interferon regulatory factor 3

5jem[7] B CBP_HUMAN CREB-binding protein[42 aa] A 100.0
/99.0 18
/18 IRF3_HUMAN Interferon regulatory factor 3

5jem[4] D CBP_HUMAN CREB-binding protein[42 aa] A 100.0
/99.0 3
/3 IRF3_HUMAN Interferon regulatory factor 3

7jfm[1] D CBP_HUMAN CREB-binding protein[37 aa] A 100.0
/75.3 1
/1 IRF3_MOUSE Interferon regulatory factor 3

7jfm[1] D CBP_HUMAN CREB-binding protein[37 aa] C 70.6
/75.6 17
/17 IRF3_MOUSE Interferon regulatory factor 3

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

NUCLEOTIDE

427 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

1t2k[2] A 31-MER C 100.0
/100.0 9
/9 IRF3_HUMAN Interferon regulatory factor 3

1t2k[2] B 31-MER C 100.0
/100.0 17
/17 IRF3_HUMAN Interferon regulatory factor 3

2o61[1] A 36-MER C 100.0
/100.0 11
/34 TF65_HUMAN IRF7_HUMAN IRF3_HUMAN Transcription factor p65/Interferon regulatory fac..

2o61[1] B 34-MER C 100.0
/100.0 13
/36 TF65_HUMAN IRF7_HUMAN IRF3_HUMAN Transcription factor p65/Interferon regulatory fac..

2o6g[4] A interferon-b enhancer C 100.0
/100.0 12
/12 IRF3_HUMAN Interferon regulatory factor 3

2o6g[4] B interferon-b enhancer C 100.0
/100.0 16
/16 IRF3_HUMAN Interferon regulatory factor 3

2pi0[4] A PRDIII-I region of human interferon-B promoter str.. C 100.0
/100.0 12
/12 IRF3_HUMAN Interferon regulatory factor 3

2pi0[4] B PRDIII-I region of human interferon-B promoter str.. C 100.0
/100.0 13
/13 IRF3_HUMAN Interferon regulatory factor 3

7jm4[8] A Interferon-Stimulated Response Elements C 70.0
/43.3 10
/10 IRF4_HUMAN Interferon regulatory factor 4

7jm4[6] B Interferon-Stimulated Response Elements C 12.5
/43.3 8
/9 IRF4_HUMAN Interferon regulatory factor 4

7rh2[2] F DNA (5'-D(*GP*CP*TP*TP*TP*CP*TP*CP*GP*GP*TP*TP*TP*.. G 30.0
/44.2 10
/11 Q99419_HUMAN ICSAT transcription factor

7o56[3] B DNA (5'-D(P*AP*AP*TP*AP*AP*AP*AP*GP*AP*AP*AP*CP*CP.. A 77.8
/43.0 9
/9 IRF4_HUMAN Interferon regulatory factor 4

7o56[2] C DNA (5'-D(P*TP*TP*TP*AP*CP*TP*TP*TP*CP*GP*GP*TP*TP.. A 25.0
/43.0 12
/13 IRF4_HUMAN Interferon regulatory factor 4

7ogs[4] C DNA (5'-D(P*TP*GP*TP*AP*CP*TP*TP*TP*CP*GP*GP*TP*TP.. A 27.3
/43.0 11
/13 IRF4_HUMAN Interferon regulatory factor 4

7ogs[4] D DNA (5'-D(P*AP*TP*AP*AP*CP*TP*GP*AP*AP*AP*CP*CP*GP.. A 66.7
/43.0 12
/12 IRF4_HUMAN Interferon regulatory factor 4

7oot[2] C DNA (5'-D(P*TP*CP*AP*AP*CP*TP*GP*AP*AP*AP*CP*CP*GP.. A 72.7
/43.0 11
/11 IRF4_HUMAN Interferon regulatory factor 4

7oot[2] D DNA (5'-D(P*AP*GP*CP*TP*TP*TP*CP*TP*CP*GP*GP*TP*TP.. A 25.0
/43.0 12
/13 IRF4_HUMAN Interferon regulatory factor 4

2irf[4] F DNA (5'-D(*TP*TP*CP*AP*CP*TP*TP*TP*CP*AP*CP*(5IU)P.. G 50.0
/39.4 10
/10 IRF2_MOUSE INTERFERON REGULATORY FACTOR 2

2irf[3] A DNA (5'-D(P*AP*AP*GP*TP*GP*AP*AP*AP*GP*(5IU)P*GP*A.. H 45.5
/39.4 11
/11 IRF2_MOUSE INTERFERON REGULATORY FACTOR 2

2irf[2] E DNA (5'-D(*TP*TP*CP*AP*CP*TP*TP*TP*CP*AP*CP*(5IU)P.. I 50.0
/39.4 10
/10 IRF2_MOUSE INTERFERON REGULATORY FACTOR 2

1if1[2] A DNA (26-MER) C 50.0
/38.7 22
/22 IRF1_MOUSE PROTEIN (INTERFERON REGULATORY FACTOR 1)

1if1[1] B DNA (26-MER) C 50.0
/38.7 2
/2 IRF1_MOUSE PROTEIN (INTERFERON REGULATORY FACTOR 1)

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

METAL

427 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

3qu3[3] D NA
SODIUM ION[1 atoms] A 25.0
/46.5 4
/4 IRF7_MOUSE Interferon regulatory factor 7

3qu6[1] K NA
SODIUM ION[1 atoms] A 100.0
/99.0 2
/2 Q7Z5G6_HUMAN IRF3 protein

3qu6[2] L NA
SODIUM ION[1 atoms] A 100.0
/99.0 5
/5 Q7Z5G6_HUMAN IRF3 protein

3qu6[2] D ZN
ZINC ION[1 atoms] A 100.0
/99.0 2
/2 Q7Z5G6_HUMAN IRF3 protein

3qu6[1] E ZN
ZINC ION[1 atoms] A 100.0
/99.0 2
/2 Q7Z5G6_HUMAN IRF3 protein

3qu6[2] F ZN
ZINC ION[1 atoms] A 100.0
/99.0 2
/2 Q7Z5G6_HUMAN IRF3 protein

3qu6[4] G ZN
ZINC ION[1 atoms] A 100.0
/99.0 4
/4 Q7Z5G6_HUMAN IRF3 protein

3qu6[4] H CL
CHLORIDE ION[1 atoms] A 100.0
/99.0 4
/4 Q7Z5G6_HUMAN IRF3 protein

3qu6[1] I CL
CHLORIDE ION[1 atoms] A 100.0
/99.0 1
/1 Q7Z5G6_HUMAN IRF3 protein

3qu6[2] M CL
CHLORIDE ION[1 atoms] A 100.0
/99.0 4
/4 Q7Z5G6_HUMAN IRF3 protein

5bvi[2] C CL
CHLORIDE ION[1 atoms] A 16.7
/28.2 6
/6 Q5SUZ4_MOUSE Interferon regulatory factor 4

5bvi[1] D CL
CHLORIDE ION[1 atoms] A 16.7
/28.2 6
/6 Q5SUZ4_MOUSE Interferon regulatory factor 4

5bvi[1] E CL
CHLORIDE ION[1 atoms] A 0.0
/28.2 2
/2 Q5SUZ4_MOUSE Interferon regulatory factor 4

6td4[1] B CL
CHLORIDE ION[1 atoms] A 100.0
/45.5 1
/1 IRF4_HUMAN Interferon regulatory factor 4

2irf[6] M K
POTASSIUM ION[1 atoms] G 25.0
/39.4 4
/4 IRF2_MOUSE INTERFERON REGULATORY FACTOR 2

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

HOMO

427 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

1qwt[5] B IRF3_HUMAN Interferon regulatory factor 3[239 aa] A 100.0
/100.0 9
/9 IRF3_HUMAN Interferon regulatory factor 3

1qwt[1] A IRF3_HUMAN Interferon regulatory factor 3[239 aa] B 100.0
/100.0 10
/10 IRF3_HUMAN Interferon regulatory factor 3

5jej[16] E IRF3_HUMAN Interferon regulatory factor 3[233 aa] D 100.0
/100.0 20
/20 IRF3_HUMAN Interferon regulatory factor 3

2o6g[3] E IRF3_HUMAN Interferon regulatory factor 3[110 aa] C 100.0
/100.0 3
/3 IRF3_HUMAN Interferon regulatory factor 3

2o6g[2] C IRF3_HUMAN Interferon regulatory factor 3[110 aa] E 100.0
/100.0 3
/3 IRF3_HUMAN Interferon regulatory factor 3

2pi0[1] C IRF3_HUMAN Interferon regulatory factor 3[98 aa] E 100.0
/100.0 1
/1 IRF3_HUMAN Interferon regulatory factor 3

7jfm[2] C IRF3_MOUSE Interferon regulatory factor 3[194 aa] A 78.9
/75.3 38
/38 IRF3_MOUSE Interferon regulatory factor 3

7o56[1] E IRF4_HUMAN Interferon regulatory factor 4[112 aa] D 50.0
/43.3 2
/2 IRF4_HUMAN Interferon regulatory factor 4

7o56[1] D IRF4_HUMAN Interferon regulatory factor 4[109 aa] E 50.0
/43.3 2
/2 IRF4_HUMAN Interferon regulatory factor 4

3dsh[2] A IRF5_HUMAN Interferon regulatory factor 5[236 aa] A 34.4
/34.3 61
/62 IRF5_HUMAN Interferon regulatory factor 5

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

PRECIPITANT

427 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

3a77[2] E ACY
ACETIC ACID[4 atoms] A 100.0
/100.0 5
/5 IRF3_HUMAN Interferon regulatory factor 3

3a77[4] F MPD
(4S)-2-METHYL-2,4-PENTANEDIOL[8 atoms] A 100.0
/100.0 5
/5 IRF3_HUMAN Interferon regulatory factor 3

3qu3[1] F EDO
1,2-ETHANEDIOL[4 atoms] B 50.0
/46.5 2
/2 IRF7_MOUSE Interferon regulatory factor 7

3qu3[2] G EDO
1,2-ETHANEDIOL[4 atoms] B 0.0
/46.5 3
/3 IRF7_MOUSE Interferon regulatory factor 7

3qu3[1] J EDO
1,2-ETHANEDIOL[4 atoms] C 0.0
/46.5 2
/5 IRF7_MOUSE Interferon regulatory factor 7

1qwt[2] C PO4
PHOSPHATE ION[5 atoms] A 100.0
/100.0 4
/4 IRF3_HUMAN Interferon regulatory factor 3

1qwt[2] D PO4
PHOSPHATE ION[5 atoms] A 100.0
/100.0 6
/6 IRF3_HUMAN Interferon regulatory factor 3

1qwt[2] E PO4
PHOSPHATE ION[5 atoms] A 100.0
/100.0 3
/3 IRF3_HUMAN Interferon regulatory factor 3

1qwt[1] I PO4
PHOSPHATE ION[5 atoms] B 100.0
/100.0 4
/4 IRF3_HUMAN Interferon regulatory factor 3

1qwt[1] J PO4
PHOSPHATE ION[5 atoms] B 100.0
/100.0 4
/4 IRF3_HUMAN Interferon regulatory factor 3

5jeo[4] C PO4
PHOSPHATE ION[5 atoms] B 100.0
/100.0 4
/4 IRF3_HUMAN Interferon regulatory factor 3

5jeo[4] D PO4
PHOSPHATE ION[5 atoms] B 100.0
/100.0 3
/3 IRF3_HUMAN Interferon regulatory factor 3

5jeo[2] E PO4
PHOSPHATE ION[5 atoms] B 100.0
/100.0 2
/2 IRF3_HUMAN Interferon regulatory factor 3

7oot[1] E PO4
PHOSPHATE ION[5 atoms] B 0.0
/43.0 2
/2 IRF4_HUMAN Interferon regulatory factor 4

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

MONOMER
427
	pdb_id	a¹	identity[%]²	description
	1qwt	B	100.0	IRF3_HUMAN Interferon regulatory factor 3
	2pi0	D	100.0	IRF3_HUMAN Interferon regulatory factor 3
	1.a¹:asym_id for the homologue. 2.identity[%]²:sequence identity between the query and the homologue.

HETERO
427	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	1t2k[1]	F	ATF2_HUMAN Cyclic-AMP-dependent transcription factor ATF-2[61..	C	100.0 /100.0	3 /3	IRF3_HUMAN Interferon regulatory factor 3
	5jej[1]	B	STING_HUMAN Stimulator of interferon genes protein[10 aa]	D	100.0 /100.0	15 /15	IRF3_HUMAN Interferon regulatory factor 3
	5jej[1]	C	STING_HUMAN Stimulator of interferon genes protein[4 aa]	D	100.0 /100.0	2 /2	IRF3_HUMAN Interferon regulatory factor 3
	5jej[1]	C	STING_HUMAN Stimulator of interferon genes protein[4 aa]	E	100.0 /100.0	5 /5	IRF3_HUMAN Interferon regulatory factor 3
	5jej[1]	A	STING_HUMAN Stimulator of interferon genes protein[21 aa]	E	100.0 /100.0	15 /15	IRF3_HUMAN Interferon regulatory factor 3
	5jek[1]	C	MAVS peptide[14 aa]	A	100.0 /100.0	13 /13	IRF3_HUMAN Interferon regulatory factor 3
	5jek[1]	D	MAVS peptide[16 aa]	B	100.0 /100.0	12 /12	IRF3_HUMAN Interferon regulatory factor 3
	5jel[2]	B	Phosphorylated TRIF peptide[14 aa]	A	100.0 /100.0	16 /16	IRF3_HUMAN Interferon regulatory factor 3
	5jeo[2]	A	Rotavirus NSP1 peptide[10 aa]	B	100.0 /100.0	17 /17	IRF3_HUMAN Interferon regulatory factor 3
	5jer[4]	A	Rotavirus NSP1 peptide[10 aa]	E	100.0 /100.0	14 /14	IRF3_HUMAN Interferon regulatory factor 3
	5jer[1]	D	Rotavirus NSP1 peptide[10 aa]	F	100.0 /100.0	1 /1	IRF3_HUMAN Interferon regulatory factor 3
	1zoq[2]	B	CBP_HUMAN CREB-binding protein[47 aa]	A	100.0 /100.0	18 /18	IRF3_HUMAN Interferon regulatory factor 3
	5jem[7]	B	CBP_HUMAN CREB-binding protein[42 aa]	A	100.0 /99.0	18 /18	IRF3_HUMAN Interferon regulatory factor 3
	5jem[4]	D	CBP_HUMAN CREB-binding protein[42 aa]	A	100.0 /99.0	3 /3	IRF3_HUMAN Interferon regulatory factor 3
	7jfm[1]	D	CBP_HUMAN CREB-binding protein[37 aa]	A	100.0 /75.3	1 /1	IRF3_MOUSE Interferon regulatory factor 3
	7jfm[1]	D	CBP_HUMAN CREB-binding protein[37 aa]	C	70.6 /75.6	17 /17	IRF3_MOUSE Interferon regulatory factor 3
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
NUCLEOTIDE
427	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	1t2k[2]	A	31-MER	C	100.0 /100.0	9 /9	IRF3_HUMAN Interferon regulatory factor 3
	1t2k[2]	B	31-MER	C	100.0 /100.0	17 /17	IRF3_HUMAN Interferon regulatory factor 3
	2o61[1]	A	36-MER	C	100.0 /100.0	11 /34	TF65_HUMAN IRF7_HUMAN IRF3_HUMAN Transcription factor p65/Interferon regulatory fac..
	2o61[1]	B	34-MER	C	100.0 /100.0	13 /36	TF65_HUMAN IRF7_HUMAN IRF3_HUMAN Transcription factor p65/Interferon regulatory fac..
	2o6g[4]	A	interferon-b enhancer	C	100.0 /100.0	12 /12	IRF3_HUMAN Interferon regulatory factor 3
	2o6g[4]	B	interferon-b enhancer	C	100.0 /100.0	16 /16	IRF3_HUMAN Interferon regulatory factor 3
	2pi0[4]	A	PRDIII-I region of human interferon-B promoter str..	C	100.0 /100.0	12 /12	IRF3_HUMAN Interferon regulatory factor 3
	2pi0[4]	B	PRDIII-I region of human interferon-B promoter str..	C	100.0 /100.0	13 /13	IRF3_HUMAN Interferon regulatory factor 3
	7jm4[8]	A	Interferon-Stimulated Response Elements	C	70.0 /43.3	10 /10	IRF4_HUMAN Interferon regulatory factor 4
	7jm4[6]	B	Interferon-Stimulated Response Elements	C	12.5 /43.3	8 /9	IRF4_HUMAN Interferon regulatory factor 4
	7rh2[2]	F	DNA (5'-D(GPCPTPTPTPCPTPCPGPGPTPTPTP..	G	30.0 /44.2	10 /11	Q99419_HUMAN ICSAT transcription factor
	7o56[3]	B	DNA (5'-D(PAPAPTPAPAPAPAPGPAPAPAPCP*CP..	A	77.8 /43.0	9 /9	IRF4_HUMAN Interferon regulatory factor 4
	7o56[2]	C	DNA (5'-D(PTPTPTPAPCPTPTPTPCPGPGPTP*TP..	A	25.0 /43.0	12 /13	IRF4_HUMAN Interferon regulatory factor 4
	7ogs[4]	C	DNA (5'-D(PTPGPTPAPCPTPTPTPCPGPGPTP*TP..	A	27.3 /43.0	11 /13	IRF4_HUMAN Interferon regulatory factor 4
	7ogs[4]	D	DNA (5'-D(PAPTPAPAPCPTPGPAPAPAPCPCP*GP..	A	66.7 /43.0	12 /12	IRF4_HUMAN Interferon regulatory factor 4
	7oot[2]	C	DNA (5'-D(PTPCPAPAPCPTPGPAPAPAPCPCP*GP..	A	72.7 /43.0	11 /11	IRF4_HUMAN Interferon regulatory factor 4
	7oot[2]	D	DNA (5'-D(PAPGPCPTPTPTPCPTPCPGPGPTP*TP..	A	25.0 /43.0	12 /13	IRF4_HUMAN Interferon regulatory factor 4
	2irf[4]	F	DNA (5'-D(TPTPCPAPCPTPTPTPCPAPCP(5IU)P..	G	50.0 /39.4	10 /10	IRF2_MOUSE INTERFERON REGULATORY FACTOR 2
	2irf[3]	A	DNA (5'-D(PAPAPGPTPGPAPAPAPGP(5IU)PGPA..	H	45.5 /39.4	11 /11	IRF2_MOUSE INTERFERON REGULATORY FACTOR 2
	2irf[2]	E	DNA (5'-D(TPTPCPAPCPTPTPTPCPAPCP(5IU)P..	I	50.0 /39.4	10 /10	IRF2_MOUSE INTERFERON REGULATORY FACTOR 2
	1if1[2]	A	DNA (26-MER)	C	50.0 /38.7	22 /22	IRF1_MOUSE PROTEIN (INTERFERON REGULATORY FACTOR 1)
	1if1[1]	B	DNA (26-MER)	C	50.0 /38.7	2 /2	IRF1_MOUSE PROTEIN (INTERFERON REGULATORY FACTOR 1)
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
METAL
427	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	3qu3[3]	D	NA SODIUM ION[1 atoms]	A	25.0 /46.5	4 /4	IRF7_MOUSE Interferon regulatory factor 7
	3qu6[1]	K	NA SODIUM ION[1 atoms]	A	100.0 /99.0	2 /2	Q7Z5G6_HUMAN IRF3 protein
	3qu6[2]	L	NA SODIUM ION[1 atoms]	A	100.0 /99.0	5 /5	Q7Z5G6_HUMAN IRF3 protein
	3qu6[2]	D	ZN ZINC ION[1 atoms]	A	100.0 /99.0	2 /2	Q7Z5G6_HUMAN IRF3 protein
	3qu6[1]	E	ZN ZINC ION[1 atoms]	A	100.0 /99.0	2 /2	Q7Z5G6_HUMAN IRF3 protein
	3qu6[2]	F	ZN ZINC ION[1 atoms]	A	100.0 /99.0	2 /2	Q7Z5G6_HUMAN IRF3 protein
	3qu6[4]	G	ZN ZINC ION[1 atoms]	A	100.0 /99.0	4 /4	Q7Z5G6_HUMAN IRF3 protein
	3qu6[4]	H	CL CHLORIDE ION[1 atoms]	A	100.0 /99.0	4 /4	Q7Z5G6_HUMAN IRF3 protein
	3qu6[1]	I	CL CHLORIDE ION[1 atoms]	A	100.0 /99.0	1 /1	Q7Z5G6_HUMAN IRF3 protein
	3qu6[2]	M	CL CHLORIDE ION[1 atoms]	A	100.0 /99.0	4 /4	Q7Z5G6_HUMAN IRF3 protein
	5bvi[2]	C	CL CHLORIDE ION[1 atoms]	A	16.7 /28.2	6 /6	Q5SUZ4_MOUSE Interferon regulatory factor 4
	5bvi[1]	D	CL CHLORIDE ION[1 atoms]	A	16.7 /28.2	6 /6	Q5SUZ4_MOUSE Interferon regulatory factor 4
	5bvi[1]	E	CL CHLORIDE ION[1 atoms]	A	0.0 /28.2	2 /2	Q5SUZ4_MOUSE Interferon regulatory factor 4
	6td4[1]	B	CL CHLORIDE ION[1 atoms]	A	100.0 /45.5	1 /1	IRF4_HUMAN Interferon regulatory factor 4
	2irf[6]	M	K POTASSIUM ION[1 atoms]	G	25.0 /39.4	4 /4	IRF2_MOUSE INTERFERON REGULATORY FACTOR 2
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
HOMO
427	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	1qwt[5]	B	IRF3_HUMAN Interferon regulatory factor 3[239 aa]	A	100.0 /100.0	9 /9	IRF3_HUMAN Interferon regulatory factor 3
	1qwt[1]	A	IRF3_HUMAN Interferon regulatory factor 3[239 aa]	B	100.0 /100.0	10 /10	IRF3_HUMAN Interferon regulatory factor 3
	5jej[16]	E	IRF3_HUMAN Interferon regulatory factor 3[233 aa]	D	100.0 /100.0	20 /20	IRF3_HUMAN Interferon regulatory factor 3
	2o6g[3]	E	IRF3_HUMAN Interferon regulatory factor 3[110 aa]	C	100.0 /100.0	3 /3	IRF3_HUMAN Interferon regulatory factor 3
	2o6g[2]	C	IRF3_HUMAN Interferon regulatory factor 3[110 aa]	E	100.0 /100.0	3 /3	IRF3_HUMAN Interferon regulatory factor 3
	2pi0[1]	C	IRF3_HUMAN Interferon regulatory factor 3[98 aa]	E	100.0 /100.0	1 /1	IRF3_HUMAN Interferon regulatory factor 3
	7jfm[2]	C	IRF3_MOUSE Interferon regulatory factor 3[194 aa]	A	78.9 /75.3	38 /38	IRF3_MOUSE Interferon regulatory factor 3
	7o56[1]	E	IRF4_HUMAN Interferon regulatory factor 4[112 aa]	D	50.0 /43.3	2 /2	IRF4_HUMAN Interferon regulatory factor 4
	7o56[1]	D	IRF4_HUMAN Interferon regulatory factor 4[109 aa]	E	50.0 /43.3	2 /2	IRF4_HUMAN Interferon regulatory factor 4
	3dsh[2]	A	IRF5_HUMAN Interferon regulatory factor 5[236 aa]	A	34.4 /34.3	61 /62	IRF5_HUMAN Interferon regulatory factor 5
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
427	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	3a77[2]	E	ACY ACETIC ACID[4 atoms]	A	100.0 /100.0	5 /5	IRF3_HUMAN Interferon regulatory factor 3
	3a77[4]	F	MPD (4S)-2-METHYL-2,4-PENTANEDIOL[8 atoms]	A	100.0 /100.0	5 /5	IRF3_HUMAN Interferon regulatory factor 3
	3qu3[1]	F	EDO 1,2-ETHANEDIOL[4 atoms]	B	50.0 /46.5	2 /2	IRF7_MOUSE Interferon regulatory factor 7
	3qu3[2]	G	EDO 1,2-ETHANEDIOL[4 atoms]	B	0.0 /46.5	3 /3	IRF7_MOUSE Interferon regulatory factor 7
	3qu3[1]	J	EDO 1,2-ETHANEDIOL[4 atoms]	C	0.0 /46.5	2 /5	IRF7_MOUSE Interferon regulatory factor 7
	1qwt[2]	C	PO4 PHOSPHATE ION[5 atoms]	A	100.0 /100.0	4 /4	IRF3_HUMAN Interferon regulatory factor 3
	1qwt[2]	D	PO4 PHOSPHATE ION[5 atoms]	A	100.0 /100.0	6 /6	IRF3_HUMAN Interferon regulatory factor 3
	1qwt[2]	E	PO4 PHOSPHATE ION[5 atoms]	A	100.0 /100.0	3 /3	IRF3_HUMAN Interferon regulatory factor 3
	1qwt[1]	I	PO4 PHOSPHATE ION[5 atoms]	B	100.0 /100.0	4 /4	IRF3_HUMAN Interferon regulatory factor 3
	1qwt[1]	J	PO4 PHOSPHATE ION[5 atoms]	B	100.0 /100.0	4 /4	IRF3_HUMAN Interferon regulatory factor 3
	5jeo[4]	C	PO4 PHOSPHATE ION[5 atoms]	B	100.0 /100.0	4 /4	IRF3_HUMAN Interferon regulatory factor 3
	5jeo[4]	D	PO4 PHOSPHATE ION[5 atoms]	B	100.0 /100.0	3 /3	IRF3_HUMAN Interferon regulatory factor 3
	5jeo[2]	E	PO4 PHOSPHATE ION[5 atoms]	B	100.0 /100.0	2 /2	IRF3_HUMAN Interferon regulatory factor 3
	7oot[1]	E	PO4 PHOSPHATE ION[5 atoms]	B	0.0 /43.0	2 /2	IRF4_HUMAN Interferon regulatory factor 4
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

Contact Molecules for Homologous Proteins

Summary Bars[0.0 %]

UniProt Feature Tables [Q14653(IRF3_HUMAN)]