Contact Molecules for Homologous Proteins

[Full Bars]
[SiteTable]


Summary Bars[60 %]


[Back to Search Page]
[Back to HOMCOS]

[SupCon3D]
[help] 		seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
2960214 427 42 Q14653(IRF3_HUMAN) RecName: Full=Interferon regulatory factor 3 ; Short=IRF-3 ;
QUERYSEQ 
MGTPKPRILPWLVSQLDLGQLEGVAWVNKSRTRFRIPWKHGLRQDAQQEDFGIFQAWAEATGAYVPGRDKPDLPTWKRNFRSALNRKEGLRLAEDRSKDPHDPHKIYEFVNSGVGDFSQPDTSPDTNGGGSTSDTQEDILDELLGNMVLA
PLPDPGPPSLAVAPEPCPQPLRSPSLDNPTPFPNLGPSENPLKRLLVPGEEWEFEVTAFYRGRQVFQQTISCPEGLRLVGSEVGDRTLPGWPVTLPDPGMSLTDRGVMSYVRHVLSCLGGGLALWRAGQWLWAQRLGHCHTYWAVSEELL
PNSGHGPDGEVPKDKEGGVFDLGPFIVDLITFTEGSGRSPRYALWFCVGESWPQDQPWTKRLVMVKVVPTCLRALVEMARVGGASSLENTVDLHISNSHPLSLTSDQYKAYLQDLVEGMDFQGPGES
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [Q14653(IRF3_HUMAN)]

427
region name description
1-427 CHAIN /note="Interferon regulatory factor 3" /id="PRO_0000154553"
5-111 DNA_BIND /note="IRF tryptophan pentad repeat"
91-136 REGION /note="Disordered"
141-427 REGION /note="Mediates interaction with ZDHHC11"
200-360 REGION /note="Interaction with HERC5"
91-106 COMPBIAS /note="Basic and acidic residues"
115-136 COMPBIAS /note="Polar residues"
1-427 DISORDER predicted by DISOPRED

MONOMER
427
pdb_id a1 identity[%]2 description
1qwt B 100.0 IRF3_HUMAN Interferon regulatory factor 3
2pi0 D 100.0 IRF3_HUMAN Interferon regulatory factor 3 
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HETERO
427 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
1t2k[1] F ATF2_HUMAN Cyclic-AMP-dependent transcription factor ATF-2[61.. C 100.0
/100.0		 3
/3		 IRF3_HUMAN Interferon regulatory factor 3
5jej[1] B STING_HUMAN Stimulator of interferon genes protein[10 aa] D 100.0
/100.0		 15
/15		 IRF3_HUMAN Interferon regulatory factor 3
5jej[1] C STING_HUMAN Stimulator of interferon genes protein[4 aa] D 100.0
/100.0		 2
/2		 IRF3_HUMAN Interferon regulatory factor 3
5jej[1] C STING_HUMAN Stimulator of interferon genes protein[4 aa] E 100.0
/100.0		 5
/5		 IRF3_HUMAN Interferon regulatory factor 3
5jej[1] A STING_HUMAN Stimulator of interferon genes protein[21 aa] E 100.0
/100.0		 15
/15		 IRF3_HUMAN Interferon regulatory factor 3
5jek[1] C MAVS peptide[14 aa] A 100.0
/100.0		 13
/13		 IRF3_HUMAN Interferon regulatory factor 3
5jek[1] D MAVS peptide[16 aa] B 100.0
/100.0		 12
/12		 IRF3_HUMAN Interferon regulatory factor 3
5jel[2] B Phosphorylated TRIF peptide[14 aa] A 100.0
/100.0		 16
/16		 IRF3_HUMAN Interferon regulatory factor 3
5jeo[2] A Rotavirus NSP1 peptide[10 aa] B 100.0
/100.0		 17
/17		 IRF3_HUMAN Interferon regulatory factor 3
5jer[4] A Rotavirus NSP1 peptide[10 aa] E 100.0
/100.0		 14
/14		 IRF3_HUMAN Interferon regulatory factor 3
5jer[1] D Rotavirus NSP1 peptide[10 aa] F 100.0
/100.0		 1
/1		 IRF3_HUMAN Interferon regulatory factor 3
1zoq[2] B CBP_HUMAN CREB-binding protein[47 aa] A 100.0
/100.0		 18
/18		 IRF3_HUMAN Interferon regulatory factor 3
5jem[7] B CBP_HUMAN CREB-binding protein[42 aa] A 100.0
/99.0		 18
/18		 IRF3_HUMAN Interferon regulatory factor 3
5jem[4] D CBP_HUMAN CREB-binding protein[42 aa] A 100.0
/99.0		 3
/3		 IRF3_HUMAN Interferon regulatory factor 3
7jfm[1] D CBP_HUMAN CREB-binding protein[37 aa] A 100.0
/75.3		 1
/1		 IRF3_MOUSE Interferon regulatory factor 3
7jfm[1] D CBP_HUMAN CREB-binding protein[37 aa] C 70.6
/75.6		 17
/17		 IRF3_MOUSE Interferon regulatory factor 3
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
NUCLEOTIDE
427 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
1t2k[2] A 31-MER C 100.0
/100.0		 9
/9		 IRF3_HUMAN Interferon regulatory factor 3
1t2k[2] B 31-MER C 100.0
/100.0		 17
/17		 IRF3_HUMAN Interferon regulatory factor 3
2o61[1] A 36-MER C 100.0
/100.0		 11
/34		 TF65_HUMAN IRF7_HUMAN IRF3_HUMAN Transcription factor p65/Interferon regulatory fac..
2o61[1] B 34-MER C 100.0
/100.0		 13
/36		 TF65_HUMAN IRF7_HUMAN IRF3_HUMAN Transcription factor p65/Interferon regulatory fac..
2o6g[4] A interferon-b enhancer C 100.0
/100.0		 12
/12		 IRF3_HUMAN Interferon regulatory factor 3
2o6g[4] B interferon-b enhancer C 100.0
/100.0		 16
/16		 IRF3_HUMAN Interferon regulatory factor 3
2pi0[4] A PRDIII-I region of human interferon-B promoter str.. C 100.0
/100.0		 12
/12		 IRF3_HUMAN Interferon regulatory factor 3
2pi0[4] B PRDIII-I region of human interferon-B promoter str.. C 100.0
/100.0		 13
/13		 IRF3_HUMAN Interferon regulatory factor 3
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
METAL
427 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
3qu6[1] K NA
SODIUM ION[1 atoms] 		A 100.0
/99.0		 2
/2		 Q7Z5G6_HUMAN IRF3 protein
3qu6[2] L NA
SODIUM ION[1 atoms] 		A 100.0
/99.0		 5
/5		 Q7Z5G6_HUMAN IRF3 protein
3qu6[2] D ZN
ZINC ION[1 atoms] 		A 100.0
/99.0		 2
/2		 Q7Z5G6_HUMAN IRF3 protein
3qu6[1] E ZN
ZINC ION[1 atoms] 		A 100.0
/99.0		 2
/2		 Q7Z5G6_HUMAN IRF3 protein
3qu6[2] F ZN
ZINC ION[1 atoms] 		A 100.0
/99.0		 2
/2		 Q7Z5G6_HUMAN IRF3 protein
3qu6[4] G ZN
ZINC ION[1 atoms] 		A 100.0
/99.0		 4
/4		 Q7Z5G6_HUMAN IRF3 protein
3qu6[4] H CL
CHLORIDE ION[1 atoms] 		A 100.0
/99.0		 4
/4		 Q7Z5G6_HUMAN IRF3 protein
3qu6[1] I CL
CHLORIDE ION[1 atoms] 		A 100.0
/99.0		 1
/1		 Q7Z5G6_HUMAN IRF3 protein
3qu6[2] M CL
CHLORIDE ION[1 atoms] 		A 100.0
/99.0		 4
/4		 Q7Z5G6_HUMAN IRF3 protein
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
HOMO
427 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
1qwt[5] B IRF3_HUMAN Interferon regulatory factor 3[239 aa] A 100.0
/100.0		 9
/9		 IRF3_HUMAN Interferon regulatory factor 3
1qwt[1] A IRF3_HUMAN Interferon regulatory factor 3[239 aa] B 100.0
/100.0		 10
/10		 IRF3_HUMAN Interferon regulatory factor 3
5jej[16] E IRF3_HUMAN Interferon regulatory factor 3[233 aa] D 100.0
/100.0		 20
/20		 IRF3_HUMAN Interferon regulatory factor 3
2o6g[3] E IRF3_HUMAN Interferon regulatory factor 3[110 aa] C 100.0
/100.0		 3
/3		 IRF3_HUMAN Interferon regulatory factor 3
2o6g[2] C IRF3_HUMAN Interferon regulatory factor 3[110 aa] E 100.0
/100.0		 3
/3		 IRF3_HUMAN Interferon regulatory factor 3
2pi0[1] C IRF3_HUMAN Interferon regulatory factor 3[98 aa] E 100.0
/100.0		 1
/1		 IRF3_HUMAN Interferon regulatory factor 3
7jfm[2] C IRF3_MOUSE Interferon regulatory factor 3[194 aa] A 78.9
/75.3		 38
/38		 IRF3_MOUSE Interferon regulatory factor 3
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
427 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
1qwt[2] C PO4
PHOSPHATE ION[5 atoms] 		A 100.0
/100.0		 4
/4		 IRF3_HUMAN Interferon regulatory factor 3
1qwt[2] D PO4
PHOSPHATE ION[5 atoms] 		A 100.0
/100.0		 6
/6		 IRF3_HUMAN Interferon regulatory factor 3
1qwt[2] E PO4
PHOSPHATE ION[5 atoms] 		A 100.0
/100.0		 3
/3		 IRF3_HUMAN Interferon regulatory factor 3
1qwt[1] I PO4
PHOSPHATE ION[5 atoms] 		B 100.0
/100.0		 4
/4		 IRF3_HUMAN Interferon regulatory factor 3
1qwt[1] J PO4
PHOSPHATE ION[5 atoms] 		B 100.0
/100.0		 4
/4		 IRF3_HUMAN Interferon regulatory factor 3
5jeo[4] C PO4
PHOSPHATE ION[5 atoms] 		B 100.0
/100.0		 4
/4		 IRF3_HUMAN Interferon regulatory factor 3
5jeo[4] D PO4
PHOSPHATE ION[5 atoms] 		B 100.0
/100.0		 3
/3		 IRF3_HUMAN Interferon regulatory factor 3
5jeo[2] E PO4
PHOSPHATE ION[5 atoms] 		B 100.0
/100.0		 2
/2		 IRF3_HUMAN Interferon regulatory factor 3
3a77[2] E ACY
ACETIC ACID[4 atoms] 		A 100.0
/100.0		 5
/5		 IRF3_HUMAN Interferon regulatory factor 3
3a77[4] F MPD
(4S)-2-METHYL-2,4-PENTANEDIOL[8 atoms] 		A 100.0
/100.0		 5
/5		 IRF3_HUMAN Interferon regulatory factor 3
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.