Contact Molecules for Homologous Proteins


[Full Bars]

[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]

[Back to HOMCOS]

[SupCon3D]

[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
4021742 631 35 P17405(ASM_HUMAN) RecName: Full=Sphingomyelin phosphodiesterase ; EC=3.1.4.12 ; EC=3.1.4.3 ;AltName: Full=Acid sphingomyelinase ; Short=aSMase;Contains: RecName: Full=Sphingomyelin phosphodiesterase, processed form ;Flags: Precursor;
QUERYSEQ
MPRYGASLRQSCPRSGREQGQDGTAGAPGLLWMGLVLALALALALALALSDSRVLWAPAEAHPLSPQGHPARLHRIVPRLRDVFGWGNLTCPICKGLFTAINLGLKKEPNVARVGSVAIKLCNLLKIAPPAVCQSIVHLFEDDMVEVWRR
SVLSPSEACGLLLGSTCGHWDIFSSWNISLPTVPKPPPKPPSPPAPGAPVSRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGEYSKCDLPLRTLESLLSGLGPAGPFDMVYWTGDIPAHDVWHQTRQDQLRALTT
VTALVRKFLGPVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGGFYALSPYPGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGDKVHIIGHIPPGHCLKSWSWNYYRIVARYEN
TLAAQFFGHTHVDEFEVFYDEETLSRPLAVAFLAPSATTYIGLNPGYRVYQIDGNYSGSSHVVLDHETYILNLTQANIPGAIPHWQLLYRARETYGLPNTLPTAWHNLVYRMRGDMQLFQTFWFLYHKGHPPSEPCGTPCRLATLCAQLS
ARADSPALCRHLMPDGSLPEAQSLWPRPLFC
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [P17405(ASM_HUMAN)]

631
region name description
1-46 SIGNAL
47-631 CHAIN /note="Sphingomyelin phosphodiesterase" /id="PRO_0000002323"
254-631 CHAIN /note="Sphingomyelin phosphodiesterase, processed form" /id="PRO_0000456684"
87-171 DOMAIN /note="Saposin B-type"
1-23 REGION /note="Disordered"
208-208 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="1" ECO:0007744|PDB:5I81, ECO:0007744|PDB:5I85, ECO:0007744|PDB:5I8R, ECO:0007744|PDB:5JG8"
210-210 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="1" ECO:0007744|PDB:5I81, ECO:0007744|PDB:5I85, ECO:0007744|PDB:5I8R, ECO:0007744|PDB:5JG8"
280-280 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="1" ECO:0007744|PDB:5I81, ECO:0007744|PDB:5I85, ECO:0007744|PDB:5I8R, ECO:0007744|PDB:5JG8"
280-280 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="2" ECO:0007744|PDB:5I81, ECO:0007744|PDB:5I85, ECO:0007744|PDB:5I8R, ECO:0007744|PDB:5JG8"
320-320 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="2" ECO:0007744|PDB:5I81, ECO:0007744|PDB:5I85, ECO:0007744|PDB:5I8R, ECO:0007744|PDB:5JG8"
427-427 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="2" ECO:0007744|PDB:5I81, ECO:0007744|PDB:5I85, ECO:0007744|PDB:5I8R, ECO:0007744|PDB:5JG8"
459-459 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="2" ECO:0007744|PDB:5I81, ECO:0007744|PDB:5I85, ECO:0007744|PDB:5I8R, ECO:0007744|PDB:5JG8"
461-461 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="1" ECO:0007744|PDB:5I81, ECO:0007744|PDB:5I85, ECO:0007744|PDB:5I8R, ECO:0007744|PDB:5JG8"
1-196 DISORDER predicted by DISOPRED

MONOMER
631
pdb_id a1 identity[%]2 description
5jg8 B 100.0 ASM_HUMAN Sphingomyelin phosphodiesterase
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
COMPOUND
631 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
5fi9[2] N NT8
(1-azanyl-1-phosphono-decyl)phosphonic acid[19 ato..
A 100.0
/88.3
12
/12
ASM_MOUSE Sphingomyelin phosphodiesterase
5fic[2] R 6E0
octadecylphosphonic acid[22 atoms]
A 83.3
/88.4
6
/6
ASM_MOUSE Sphingomyelin phosphodiesterase
5fc6[1] L AP2
PHOSPHOMETHYLPHOSPHONIC ACID ADENOSYL ESTER[27 ato..
A 81.8
/35.1
11
/13
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fcb[1] H AMP
ADENOSINE MONOPHOSPHATE[23 atoms]
A 87.5
/35.1
8
/10
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5ebe[2] K C5P
CYTIDINE-5'-MONOPHOSPHATE[21 atoms]
A 69.2
/34.6
13
/14
ASM3A_HUMAN Acid sphingomyelinase-like phosphodiesterase 3a
5ebe[1] T RP5
5-O-phosphono-beta-D-ribofuranose[14 atoms]
B 88.9
/34.6
9
/9
ASM3A_HUMAN Acid sphingomyelinase-like phosphodiesterase 3a
8w6p[1] G YA4
[(2~{R},3~{S},4~{S})-3,4-bis(oxidanyl)oxolan-2-yl]..
A 100.0
/34.6
8
/8
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
8w6p[1] M FUC
alpha-L-fucopyranose[10 atoms]
B 0.0
/34.6
2
/2
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5ebb[5] F NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 33.3
/34.6
3
/3
ASM3A_HUMAN Acid sphingomyelinase-like phosphodiesterase 3a
5ebb[3] G NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 0.0
/34.6
5
/5
ASM3A_HUMAN Acid sphingomyelinase-like phosphodiesterase 3a
5ebb[17] H NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 20.0
/34.6
5
/5
ASM3A_HUMAN Acid sphingomyelinase-like phosphodiesterase 3a
5ebe[3] E NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 0.0
/34.6
2
/2
ASM3A_HUMAN Acid sphingomyelinase-like phosphodiesterase 3a
5ebe[4] F NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 0.0
/34.6
3
/3
ASM3A_HUMAN Acid sphingomyelinase-like phosphodiesterase 3a
5ebe[3] G NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 0.0
/34.6
1
/1
ASM3A_HUMAN Acid sphingomyelinase-like phosphodiesterase 3a
5fc1[2] H NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 0.0
/35.1
2
/2
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fc7[1] G NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 0.0
/35.1
1
/1
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fc7[2] H NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 33.3
/35.1
3
/3
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fib[1] AA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 100.0
/88.4
1
/1
ASM_MOUSE Sphingomyelin phosphodiesterase
5hqn[1] N NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 100.0
/89.4
1
/1
ASM_MOUSE Sphingomyelin phosphodiesterase
5i81[11] E NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/100.0
1
/1
ASM_HUMAN Sphingomyelin phosphodiesterase
5i81[2] E NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/100.0
2
/2
ASM_HUMAN Sphingomyelin phosphodiesterase
5i81[9] F NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/100.0
3
/3
ASM_HUMAN Sphingomyelin phosphodiesterase
5i81[3] J NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/100.0
6
/6
ASM_HUMAN Sphingomyelin phosphodiesterase
5i8r[1] BA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 100.0
/100.0
1
/1
ASM_HUMAN Sphingomyelin phosphodiesterase
5jg8[2] N NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/100.0
5
/5
ASM_HUMAN Sphingomyelin phosphodiesterase
5jg8[2] S NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/100.0
1
/1
ASM_HUMAN Sphingomyelin phosphodiesterase
8w6r[1] C NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 50.0
/34.4
2
/2
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
8w6r[1] D NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 0.0
/34.4
2
/2
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
8w6r[1] E NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 0.0
/34.4
3
/3
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fc5[1] H PC
PHOSPHOCHOLINE[11 atoms]
A 100.0
/35.1
7
/8
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5i85[4] U PC
PHOSPHOCHOLINE[11 atoms]
A 100.0
/100.0
9
/9
ASM_HUMAN Sphingomyelin phosphodiesterase
5kas[1] L PC
PHOSPHOCHOLINE[11 atoms]
A 80.0
/33.2
10
/11
ASM3B_MOUSE Acid sphingomyelinase-like phosphodiesterase 3b
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
METAL
631 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
5fic[1] P CL
CHLORIDE ION[1 atoms]
A 100.0
/88.4
1
/1
ASM_MOUSE Sphingomyelin phosphodiesterase
5fic[3] Q CL
CHLORIDE ION[1 atoms]
A 100.0
/88.4
4
/4
ASM_MOUSE Sphingomyelin phosphodiesterase
5fic[1] X CL
CHLORIDE ION[1 atoms]
B 100.0
/88.4
5
/5
ASM_MOUSE Sphingomyelin phosphodiesterase
5ebb[11] D ZN
ZINC ION[1 atoms]
A 100.0
/34.6
5
/5
ASM3A_HUMAN Acid sphingomyelinase-like phosphodiesterase 3a
5ebe[6] I ZN
ZINC ION[1 atoms]
A 100.0
/34.6
5
/5
ASM3A_HUMAN Acid sphingomyelinase-like phosphodiesterase 3a
5fc1[14] F ZN
ZINC ION[1 atoms]
A 100.0
/35.1
4
/4
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fca[2] M ZN
ZINC ION[1 atoms]
A 100.0
/35.1
2
/2
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fca[1] N ZN
ZINC ION[1 atoms]
A 0.0
/35.1
1
/2
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fca[1] U ZN
ZINC ION[1 atoms]
A 0.0
/35.1
1
/1
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fi9[16] L ZN
ZINC ION[1 atoms]
A 100.0
/88.3
4
/4
ASM_MOUSE Sphingomyelin phosphodiesterase
5hqn[4] I ZN
ZINC ION[1 atoms]
A 100.0
/89.4
4
/4
ASM_MOUSE Sphingomyelin phosphodiesterase
5i81[18] L ZN
ZINC ION[1 atoms]
A 100.0
/100.0
5
/5
ASM_HUMAN Sphingomyelin phosphodiesterase
5jg8[4] J ZN
ZINC ION[1 atoms]
A 100.0
/100.0
4
/4
ASM_HUMAN Sphingomyelin phosphodiesterase
5kar[6] E ZN
ZINC ION[1 atoms]
A 100.0
/33.2
5
/5
ASM3B_MOUSE Acid sphingomyelinase-like phosphodiesterase 3b
5kas[1] G ZN
ZINC ION[1 atoms]
A 100.0
/33.2
3
/3
ASM3B_MOUSE Acid sphingomyelinase-like phosphodiesterase 3b
5kas[1] H ZN
ZINC ION[1 atoms]
A 0.0
/33.2
1
/1
ASM3B_MOUSE Acid sphingomyelinase-like phosphodiesterase 3b
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
OTHERPOLY
631 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
5i81[2] D beta-D-mannopyranose-(1-3)-alpha-D-mannopyranose A 100.0
/100.0
3
/3
ASM_HUMAN Sphingomyelin phosphodiesterase
5i85[4] C alpha-D-mannopyranose-(1-3)-alpha-D-mannopyranose-.. A 100.0
/100.0
7
/7
ASM_HUMAN Sphingomyelin phosphodiesterase
5jg8[1] E 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-3)-2-a.. A 100.0
/100.0
4
/4
ASM_HUMAN Sphingomyelin phosphodiesterase
5jg8[1] F alpha-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-be.. B 100.0
/100.0
6
/6
ASM_HUMAN Sphingomyelin phosphodiesterase
5jg8[1] G alpha-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-be.. B 100.0
/100.0
5
/5
ASM_HUMAN Sphingomyelin phosphodiesterase
5fi9[1] K alpha-D-mannopyranose-(1-6)-beta-D-mannopyranose-(.. B 75.0
/88.4
4
/4
ASM_MOUSE Sphingomyelin phosphodiesterase
5fi9[1] F alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose.. A 75.0
/88.3
4
/4
ASM_MOUSE Sphingomyelin phosphodiesterase
5fib[2] E alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose.. A 87.5
/88.4
8
/8
ASM_MOUSE Sphingomyelin phosphodiesterase
5fi9[1] H beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. B 66.7
/88.4
6
/6
ASM_MOUSE Sphingomyelin phosphodiesterase
5fib[1] G beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 100.0
/88.4
3
/3
ASM_MOUSE Sphingomyelin phosphodiesterase
5fib[1] J alpha-D-mannopyranose-(1-3)-beta-D-mannopyranose-(.. B 100.0
/88.4
3
/3
ASM_MOUSE Sphingomyelin phosphodiesterase
5fcb[1] E alpha-L-fucopyranose-(1-6)-2-acetamido-2-deoxy-bet.. A 0.0
/35.1
3
/3
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
8w6p[1] D alpha-L-fucopyranose-(1-6)-2-acetamido-2-deoxy-bet.. A 0.0
/34.6
5
/5
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fic[2] E beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 85.7
/88.4
7
/7
ASM_MOUSE Sphingomyelin phosphodiesterase
5i81[2] C beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 100.0
/100.0
3
/3
ASM_HUMAN Sphingomyelin phosphodiesterase
5i85[4] B beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 100.0
/100.0
3
/3
ASM_HUMAN Sphingomyelin phosphodiesterase
5i8r[1] H beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. B 100.0
/100.0
4
/4
ASM_HUMAN Sphingomyelin phosphodiesterase
8w6p[1] F beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. B 40.0
/34.6
5
/5
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5ebe[1] D 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 0.0
/34.6
3
/3
ASM3A_HUMAN Acid sphingomyelinase-like phosphodiesterase 3a
5fc1[6] C 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 0.0
/35.1
3
/3
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fc7[1] D 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 33.3
/35.1
6
/6
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fi9[1] C 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 66.7
/88.3
3
/3
ASM_MOUSE Sphingomyelin phosphodiesterase
5fi9[5] E 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 83.3
/88.3
6
/6
ASM_MOUSE Sphingomyelin phosphodiesterase
5fi9[2] G 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/88.3
3
/3
ASM_MOUSE Sphingomyelin phosphodiesterase
5hqn[1] C 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 66.7
/89.4
3
/3
ASM_MOUSE Sphingomyelin phosphodiesterase
5hqn[2] E 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/89.4
4
/4
ASM_MOUSE Sphingomyelin phosphodiesterase
5i81[4] B 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/100.0
5
/5
ASM_HUMAN Sphingomyelin phosphodiesterase
5i85[5] D 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/100.0
7
/7
ASM_HUMAN Sphingomyelin phosphodiesterase
5i8r[2] E 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/100.0
2
/2
ASM_HUMAN Sphingomyelin phosphodiesterase
5jg8[1] C 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/100.0
5
/5
ASM_HUMAN Sphingomyelin phosphodiesterase
5jg8[2] D 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/100.0
3
/3
ASM_HUMAN Sphingomyelin phosphodiesterase
5jg8[1] H 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 100.0
/100.0
2
/2
ASM_HUMAN Sphingomyelin phosphodiesterase
5kar[2] B 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 0.0
/33.2
3
/3
ASM3B_MOUSE Acid sphingomyelinase-like phosphodiesterase 3b
8w6p[1] C 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 0.0
/34.6
4
/4
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
8w6p[1] E 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 40.0
/34.6
5
/5
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
8w6p[1] C 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 20.0
/34.6
5
/5
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
8w6r[1] B 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 40.0
/34.4
5
/5
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fc1[6] B 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[al.. A 50.0
/35.1
2
/2
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fc1[6] E 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[al.. A 0.0
/35.1
2
/2
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fcb[1] C 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[al.. A 0.0
/35.1
6
/6
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fi9[4] D 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[al.. A 100.0
/88.3
8
/8
ASM_MOUSE Sphingomyelin phosphodiesterase
5fib[1] C 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[al.. A 33.3
/88.4
3
/3
ASM_MOUSE Sphingomyelin phosphodiesterase
5fib[1] D 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[al.. A 85.7
/88.4
7
/7
ASM_MOUSE Sphingomyelin phosphodiesterase
5hqn[2] D 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[al.. A 100.0
/89.4
5
/5
ASM_MOUSE Sphingomyelin phosphodiesterase
5hqn[1] F 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[al.. B 66.7
/89.4
3
/3
ASM_MOUSE Sphingomyelin phosphodiesterase
5kar[2] D 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[al.. A 16.7
/33.2
6
/6
ASM3B_MOUSE Acid sphingomyelinase-like phosphodiesterase 3b
5fc1[6] D alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose.. A 40.0
/35.1
5
/5
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fib[1] I alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose.. B 83.3
/88.4
6
/6
ASM_MOUSE Sphingomyelin phosphodiesterase
5kar[1] C alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose.. A 28.6
/33.2
7
/7
ASM3B_MOUSE Acid sphingomyelinase-like phosphodiesterase 3b
5kas[1] C alpha-D-mannopyranose-(1-3)-beta-D-mannopyranose-(.. A 33.3
/33.2
6
/6
ASM3B_MOUSE Acid sphingomyelinase-like phosphodiesterase 3b
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
HOMO
631 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
5i81[4] A ASM_HUMAN Sphingomyelin phosphodiesterase[528 aa] A 100.0
/100.0
28
/28
ASM_HUMAN Sphingomyelin phosphodiesterase
5i85[4] A ASM_HUMAN Sphingomyelin phosphodiesterase[528 aa] A 100.0
/100.0
9
/9
ASM_HUMAN Sphingomyelin phosphodiesterase
5i85[4] A ASM_HUMAN Sphingomyelin phosphodiesterase[528 aa] A 100.0
/100.0
11
/11
ASM_HUMAN Sphingomyelin phosphodiesterase
8w6p[1] B ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a[41.. A 33.3
/34.6
9
/9
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
8w6p[1] A ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a[41.. B 27.3
/34.6
11
/14
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
631 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
5jg8[2] L ACT
ACETATE ION[4 atoms]
A 100.0
/100.0
7
/7
ASM_HUMAN Sphingomyelin phosphodiesterase
5ebb[3] I MLI
MALONATE ION[7 atoms]
A 90.0
/34.6
10
/10
ASM3A_HUMAN Acid sphingomyelinase-like phosphodiesterase 3a
5ebe[1] S MLI
MALONATE ION[7 atoms]
B 0.0
/34.6
3
/3
ASM3A_HUMAN Acid sphingomyelinase-like phosphodiesterase 3a
5ebe[1] BA SCN
THIOCYANATE ION[3 atoms]
C 0.0
/34.6
1
/1
ASM3A_HUMAN Acid sphingomyelinase-like phosphodiesterase 3a
5ebe[1] CA SCN
THIOCYANATE ION[3 atoms]
C 0.0
/34.6
2
/2
ASM3A_HUMAN Acid sphingomyelinase-like phosphodiesterase 3a
5fic[4] M PO4
PHOSPHATE ION[5 atoms]
A 100.0
/88.4
8
/8
ASM_MOUSE Sphingomyelin phosphodiesterase
5fic[1] N PO4
PHOSPHATE ION[5 atoms]
A 100.0
/88.4
4
/4
ASM_MOUSE Sphingomyelin phosphodiesterase
5fic[1] O PO4
PHOSPHATE ION[5 atoms]
A 100.0
/88.4
6
/6
ASM_MOUSE Sphingomyelin phosphodiesterase
5fic[1] W PO4
PHOSPHATE ION[5 atoms]
B 100.0
/88.4
2
/2
ASM_MOUSE Sphingomyelin phosphodiesterase
5hqn[2] K PO4
PHOSPHATE ION[5 atoms]
A 100.0
/89.4
9
/9
ASM_MOUSE Sphingomyelin phosphodiesterase
8w6p[1] Q PO4
PHOSPHATE ION[5 atoms]
B 100.0
/34.6
7
/7
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fc1[2] I SO4
SULFATE ION[5 atoms]
A 100.0
/35.1
7
/7
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fc7[1] J SO4
SULFATE ION[5 atoms]
A 0.0
/35.1
2
/2
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fc7[1] K SO4
SULFATE ION[5 atoms]
A 25.0
/35.1
4
/4
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fc7[5] L SO4
SULFATE ION[5 atoms]
A 100.0
/35.1
2
/3
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fc7[1] M SO4
SULFATE ION[5 atoms]
A 66.7
/35.1
3
/3
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fc7[3] N SO4
SULFATE ION[5 atoms]
A 0.0
/35.1
3
/3
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fib[2] N SO4
SULFATE ION[5 atoms]
A 100.0
/88.4
2
/2
ASM_MOUSE Sphingomyelin phosphodiesterase
5fib[1] O SO4
SULFATE ION[5 atoms]
A 100.0
/88.4
1
/1
ASM_MOUSE Sphingomyelin phosphodiesterase
5fib[1] P SO4
SULFATE ION[5 atoms]
A 100.0
/88.4
3
/3
ASM_MOUSE Sphingomyelin phosphodiesterase
5fib[2] Q SO4
SULFATE ION[5 atoms]
A 100.0
/88.4
5
/5
ASM_MOUSE Sphingomyelin phosphodiesterase
5fib[2] R SO4
SULFATE ION[5 atoms]
A 100.0
/88.4
6
/6
ASM_MOUSE Sphingomyelin phosphodiesterase
5fib[1] S SO4
SULFATE ION[5 atoms]
A 100.0
/88.4
2
/2
ASM_MOUSE Sphingomyelin phosphodiesterase
5fib[2] T SO4
SULFATE ION[5 atoms]
A 66.7
/88.4
3
/3
ASM_MOUSE Sphingomyelin phosphodiesterase
5fib[1] U SO4
SULFATE ION[5 atoms]
A 83.3
/88.4
6
/6
ASM_MOUSE Sphingomyelin phosphodiesterase
5fib[8] W SO4
SULFATE ION[5 atoms]
A 100.0
/88.4
3
/3
ASM_MOUSE Sphingomyelin phosphodiesterase
5fib[1] CA SO4
SULFATE ION[5 atoms]
B 100.0
/88.4
4
/4
ASM_MOUSE Sphingomyelin phosphodiesterase
5i81[6] N SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
2
/2
ASM_HUMAN Sphingomyelin phosphodiesterase
5i81[8] O SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
2
/2
ASM_HUMAN Sphingomyelin phosphodiesterase
5i81[6] Q SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
2
/2
ASM_HUMAN Sphingomyelin phosphodiesterase
5i81[6] R SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
5
/5
ASM_HUMAN Sphingomyelin phosphodiesterase
5i81[3] S SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
2
/2
ASM_HUMAN Sphingomyelin phosphodiesterase
5i81[6] T SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
6
/6
ASM_HUMAN Sphingomyelin phosphodiesterase
5i81[6] U SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
3
/3
ASM_HUMAN Sphingomyelin phosphodiesterase
5i81[2] V SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
3
/3
ASM_HUMAN Sphingomyelin phosphodiesterase
5i81[12] W SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
4
/4
ASM_HUMAN Sphingomyelin phosphodiesterase
5i85[4] S SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
1
/1
ASM_HUMAN Sphingomyelin phosphodiesterase
5i85[4] T SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
3
/3
ASM_HUMAN Sphingomyelin phosphodiesterase
5ebb[1] W GOL
GLYCEROL[6 atoms]
C 0.0
/34.6
1
/1
ASM3A_HUMAN Acid sphingomyelinase-like phosphodiesterase 3a
5ebe[1] R GOL
GLYCEROL[6 atoms]
B 100.0
/34.6
1
/1
ASM3A_HUMAN Acid sphingomyelinase-like phosphodiesterase 3a
5fc1[5] J GOL
GLYCEROL[6 atoms]
A 0.0
/35.1
5
/6
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fc1[9] L GOL
GLYCEROL[6 atoms]
A 33.3
/35.1
6
/7
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fc1[2] M GOL
GLYCEROL[6 atoms]
A 0.0
/35.1
3
/3
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fc1[2] O GOL
GLYCEROL[6 atoms]
A 16.7
/35.1
6
/6
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fc1[3] P GOL
GLYCEROL[6 atoms]
A 0.0
/35.1
1
/1
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fc1[6] Q GOL
GLYCEROL[6 atoms]
A 33.3
/35.1
3
/4
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fc1[5] R GOL
GLYCEROL[6 atoms]
A 50.0
/35.1
4
/4
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fc1[2] S GOL
GLYCEROL[6 atoms]
A 33.3
/35.1
6
/7
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fc1[1] T GOL
GLYCEROL[6 atoms]
A 0.0
/35.1
2
/2
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fc1[1] U GOL
GLYCEROL[6 atoms]
A 0.0
/35.1
4
/4
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fc5[1] M GOL
GLYCEROL[6 atoms]
A 0.0
/35.1
2
/2
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fc6[3] J GOL
GLYCEROL[6 atoms]
A 25.0
/35.1
4
/4
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fc7[1] O GOL
GLYCEROL[6 atoms]
A 0.0
/35.1
2
/2
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fc7[1] Q GOL
GLYCEROL[6 atoms]
A 16.7
/35.1
6
/7
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fcb[1] N GOL
GLYCEROL[6 atoms]
A 50.0
/35.1
2
/2
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fcb[1] O GOL
GLYCEROL[6 atoms]
A 16.7
/35.1
6
/6
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fcb[1] P GOL
GLYCEROL[6 atoms]
A 0.0
/35.1
2
/2
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5fcb[1] Q GOL
GLYCEROL[6 atoms]
A 25.0
/35.1
4
/4
ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a
5kar[1] I GOL
GLYCEROL[6 atoms]
A 50.0
/33.2
6
/7
ASM3B_MOUSE Acid sphingomyelinase-like phosphodiesterase 3b
5kar[2] G NO3
NITRATE ION[4 atoms]
A 50.0
/33.2
4
/4
ASM3B_MOUSE Acid sphingomyelinase-like phosphodiesterase 3b
5kar[2] H NO3
NITRATE ION[4 atoms]
A 0.0
/33.2
6
/6
ASM3B_MOUSE Acid sphingomyelinase-like phosphodiesterase 3b
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.