[Full Bars]

[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]

[Back to HOMCOS]


[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
23073 492 1000 O15393(TMPS2_HUMAN) RecName: Full=Transmembrane protease serine 2 ; EC=3.4.21.-;AltName: Full=Serine protease 10 ;Contains: RecName: Full=Transmembrane protease serine 2 non-catalytic chain;Contains: RecName: Full=Transmembrane protease serine 2 catalytic chain;Flags: Precursor;
QUERYSEQ
MALNSGSPPAIGPYYENHGYQPENPYPAQPTVVPTVYEVHPAQYYPSPVPQYAPRVLTQASNPVVCTQPKSPSGTVCTSKTKKALCITLTLGTFLVGAALAAGLLWKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVR
LYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEK
PLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITPAMICAGFLQGNVDSCQGDSGGPLVTSKN
NIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWIYRQMRADG
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [O15393(TMPS2_HUMAN)]

492
region name description
1-255 CHAIN /note="Transmembrane protease serine 2 non-catalytic chain" /id="PRO_0000027855"
256-492 CHAIN /note="Transmembrane protease serine 2 catalytic chain" /id="PRO_0000027856"
1-84 TOPO_DOM /note="Cytoplasmic"
85-105 TRANSMEM /note="Helical; Signal-anchor for type II membrane protein"
106-492 TOPO_DOM /note="Extracellular"
112-149 DOMAIN /note="LDL-receptor class A"
150-242 DOMAIN /note="SRCR"
256-489 DOMAIN /note="Peptidase S1"
296-296 ACT_SITE /note="Charge relay system"
345-345 ACT_SITE /note="Charge relay system"
441-441 ACT_SITE /note="Charge relay system"
1-492 DISORDER predicted by DISOPRED (1-35,48-48,50-70,210-210,492-492)

MONOMER
492
pdb_id a1 identity[%]2 description
6kd5 B 47.0 TMPSD_HUMAN Transmembrane protease serine 13
1z8g A 35.2 HEPS_HUMAN Serine protease hepsin
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HETERO
492 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6kd5[1] A TMPSD_HUMAN Transmembrane protease serine 13[131 aa] B 42.9
/47.0
42
/45
TMPSD_HUMAN Transmembrane protease serine 13
6kd5[1] C DECANOYL-ARG-VAL-LYS-ARG-CHLOROMETHYLKETONE INHIBI.. B 75.0
/47.0
20
/20
TMPSD_HUMAN Transmembrane protease serine 13
6hhc[1] B FXIA ANTIBODY FAB HEAVY CHAIN[214 aa] C 50.0
/44.8
10
/13
FA11_HUMAN Coagulation factor XI
6hhc[1] A FXIA ANTIBODY FAB LIGHT CHAIN[213 aa] C 16.7
/44.8
6
/7
FA11_HUMAN Coagulation factor XI
5qqo[4] B MET-ASP-ASP-ASP-ASP-LYS-MET-ASP-ASN-GLU-CYS-THR-TH.. A 45.5
/44.5
11
/11
FA11_HUMAN Coagulation factor XI
6twb[1] C Double Bridged Peptide F19[11 aa] A 61.9
/44.5
21
/21
FA11_HUMAN Coagulation factor XI
6twc[1] B FA11_HUMAN Coagulation factor XI[8 aa] A 40.0
/44.5
10
/10
FA11_HUMAN Coagulation factor XI
6twc[1] C Double Bridged Peptide F21[12 aa] A 63.6
/44.5
22
/22
FA11_HUMAN Coagulation factor XI
5qtx[1] B FA11_HUMAN Coagulation factor XI[6 aa] A 45.5
/44.5
11
/11
FA11_HUMAN Coagulation factor XI
5q0f[1] B MET-ASP-ASP-ASP-ASP-LYS-MET-ASP-ASN-GLU-CYS-THR-TH.. A 45.5
/44.5
11
/11
FA11_HUMAN Coagulation factor XI
1fiw[1] B BETA-ACROSIN LIGHT CHAIN[14 aa] A 38.1
/44.2
21
/24
ACRO_SHEEP BETA-ACROSIN HEAVY CHAIN
4ogy[2] C DX-2930 HEAVY CHAIN[219 aa] A 53.6
/44.0
28
/30
KLKB1_HUMAN Plasma kallikrein
1xx9[6] C ECOT_ECOLI Ecotin[140 aa] A 55.6
/44.5
27
/27
FA11_HUMAN Coagulation factor XI
1xx9[6] D ECOT_ECOLI Ecotin[139 aa] A 23.1
/44.5
13
/13
FA11_HUMAN Coagulation factor XI
4o97[3] B ST14_HUMAN Peptide CGLR[4 aa] A 54.5
/44.0
11
/11
ST14_HUMAN Suppressor of tumorigenicity 14 protein
5f8z[1] B CYS-PRO-ALA-ARG-PHE-M70-ALA-LEU-PHE-CYS[10 aa] A 56.2
/44.0
16
/16
KLKB1_HUMAN Plasma kallikrein LIGHT CHAIN
5f8x[1] B CYS-PRO-ALA-ARG-PHE-M70-ALA-LEU-TRP-CYS[10 aa] A 47.4
/44.0
19
/19
KLKB1_HUMAN Plasma kallikrein
5f8t[1] B CYS-PRO-LYS-ARG-PHE-M70-ALA-LEU-PHE-CYS[10 aa] A 50.0
/44.0
18
/18
KLKB1_HUMAN Plasma kallikrein light chain
4ogy[1] E DX-2930 HEAVY CHAIN[200 aa] B 63.2
/44.0
19
/19
KLKB1_HUMAN Plasma kallikrein
3nps[1] C S4 FAB LIGHT CHAIN[211 aa] A 20.0
/43.6
5
/7
ST14_HUMAN Suppressor of tumorigenicity 14 protein
3bn9[1] C E2 Fab Heavy Chain[211 aa] A 43.5
/43.6
23
/24
ST14_HUMAN Membrane-type serine protease 1
3nps[1] B S4 FAB HEAVY CHAIN[226 aa] A 68.4
/43.6
19
/20
ST14_HUMAN Suppressor of tumorigenicity 14 protein
3bn9[1] F E2 Fab Heavy Chain[224 aa] D 42.9
/43.6
21
/22
ST14_HUMAN Membrane-type serine protease 1
6a8o[1] C peptide inhibitor,[10 aa] A 25.0
/43.5
4
/4
KLKB1_MOUSE Plasma kallikrein
6a8o[1] C peptide inhibitor,[10 aa] B 57.1
/43.5
14
/14
KLKB1_MOUSE Plasma kallikrein
6aod[1] B FXIa Antibody FAB Heavy Chain[211 aa] C 16.7
/43.4
6
/7
FA11_HUMAN Coagulation factor XI
1p57[3] A HEPS_HUMAN Serine protease hepsin[110 aa] B 32.3
/43.2
31
/31
HEPS_HUMAN Serine protease hepsin
2f91[1] B SGP1_SCHGR Serine protease inhibitor I/II[33 aa] A 59.3
/43.0
27
/28
Q52V24_PONLE hepatopancreas trypsin
6r8x[1] B anti-Factor-XI Fab fragment light chain MAA868[211.. A 0.0
/42.9
7
/7
FA11_HUMAN Coagulation factor XI
6r8x[1] C anti-Factor-XI Fab fragment heavy chain MAA868[219.. A 40.0
/42.9
15
/15
FA11_HUMAN Coagulation factor XI
1fiz[2] B ACRO_PIG BETA-ACROSIN LIGHT CHAIN[13 aa] A 38.1
/42.9
21
/24
ACRO_PIG BETA-ACROSIN HEAVY CHAIN
1ekb[1] C VAL-ASP-ASP-ASP-ASP-LYK PEPTIDE[5 aa] B 84.6
/42.5
13
/13
ENTK_BOVIN ENTEROPEPTIDASE
1ekb[1] A ENTK_BOVIN ENTEROPEPTIDASE[7 aa] B 69.2
/42.5
13
/13
ENTK_BOVIN ENTEROPEPTIDASE
3so3[1] B A11 FAB light chain[216 aa] A 40.0
/42.5
10
/10
ST14_HUMAN Suppressor of tumorigenicity 14 protein
3so3[1] C A11 FAB heavy chain[220 aa] A 52.9
/42.5
17
/18
ST14_HUMAN Suppressor of tumorigenicity 14 protein
1mct[1] B ITRA_MOMCH TRYPSIN INHIBITOR A[28 aa] A 76.2
/42.3
21
/22
TRYP_PIG BETA-TRYPSIN
4doq[1] B SLPI_HUMAN Antileukoproteinase[47 aa] A 59.1
/42.3
22
/23
TRYP_PIG Trypsin
1ppe[2] B ITR1_CUCMA TRYPSIN INHIBITOR CMTI-I[29 aa] A 76.2
/41.0
21
/22
TRY1_BOVIN TRYPSIN
1tfx[2] D TFPI1_HUMAN TISSUE FACTOR PATHWAY INHIBITOR[58 aa] B 73.7
/41.9
19
/20
TRYP_PIG TRYPSIN
1an1[2] B LDTI_HIRME TRYPTASE INHIBITOR[40 aa] A 78.9
/41.6
19
/20
TRYP_PIG TRYPSIN
1yf4[1] B Vasopressin[10 aa] A 69.6
/41.9
23
/23
TRYP_PIG Trypsin
5xwj[4] D Acetylated-THR-ARG-GLU Inhibitor[3 aa] C 93.3
/42.1
15
/15
TRYP_PIG Trypsin
1v6d[1] B PD(AIB)L(AIB)LA[7 aa] A 25.0
/41.9
4
/4
TRYP_PIG Trypsin
4an7[1] B F4ZZG4_TAMIN TRYPSIN INHIBITOR[156 aa] A 73.9
/41.9
23
/24
TRYP_PIG TRYPSIN
3myw[2] B IBB_PHAAU Bowman-Birk type trypsin inhibitor[55 aa] A 72.7
/41.9
22
/23
TRYP_PIG Trypsin
1avx[2] B ITRA_SOYBN TRYPSIN INHIBITOR[172 aa] A 70.8
/41.9
24
/25
TRYP_PIG TRYPSIN
6o1f[1] C ITRA_SOYBN Trypsin inhibitor A[177 aa] A 51.6
/40.3
31
/34
TRYB1_HUMAN Tryptase alpha/beta-1
1h9i[1] B ITR2_ECBEL TRYPSIN INHIBITOR II[30 aa] A 76.2
/41.9
21
/22
TRYP_PIG TRYPSIN
1z7k[1] B IOVO_MELGA Ovomucoid[62 aa] A 65.2
/41.9
23
/24
TRYP_PIG Trypsin
1tx6[4] F IBB_HORVU Bowman-Birk type trypsin inhibitor[114 aa] D 75.0
/41.9
20
/21
TRYP_PIG Trypsin
1p2n[105] D BPT1_BOVIN Pancreatic trypsin inhibitor[58 aa] A 0.0
/41.6
7
/7
CTRA_BOVIN Chymotrypsinogen A
1p2n[12] D BPT1_BOVIN Pancreatic trypsin inhibitor[58 aa] A 0.0
/41.6
5
/5
CTRA_BOVIN Chymotrypsinogen A
2ptc[44] B BPT1_BOVIN TRYPSIN INHIBITOR[58 aa] A 11.1
/41.0
9
/9
TRY1_BOVIN BETA-TRYPSIN
2ptc[44] B BPT1_BOVIN TRYPSIN INHIBITOR[58 aa] A 0.0
/41.0
2
/3
TRY1_BOVIN BETA-TRYPSIN
4bnr[2] D BPT1_BOVIN PANCREATIC TRYPSIN INHIBITOR[59 aa] B 68.2
/43.0
22
/23
Q52V24_PONLE HEPATOPANCREAS TRYPSIN
1gl1[3] D LCM_LOCMI PROTEASE INHIBITOR LCMI II[34 aa] A 57.1
/41.5
21
/21
CTRA_BOVIN ALPHA-CHYMOTRYPSIN
1cgi[2] B IPK1_HUMAN PANCREATIC SECRETORY TRYPSIN INHIBITOR (KAZAL TYPE.. A 50.0
/41.5
28
/29
CTRA_BOVIN ALPHA-CHYMOTRYPSINOGEN
1zjd[1] B A4_HUMAN Kunitz Protease Inhibitory Domain of Protease Nexi.. A 59.1
/43.7
22
/22
FA11_HUMAN Catalytic Domain of Coagulation Factor XI
1taw[2] B A4_HUMAN PROTEASE INHIBITOR DOMAIN OF ALZHEIMER'S AMYLOID B.. A 80.0
/41.4
20
/21
TRY1_BOVIN TRYPSIN
1zr0[2] B TFPI2_HUMAN Tissue factor pathway inhibitor 2[63 aa] A 78.9
/41.4
19
/20
TRY1_BOVIN Cationic trypsin
2y6t[4] H ECOT_YERPY ECOTIN[138 aa] D 57.7
/41.4
26
/26
CTRA_BOVIN CHYMOTRYPSINOGEN A
2y6t[4] H ECOT_YERPY ECOTIN[138 aa] C 25.0
/41.4
12
/12
CTRA_BOVIN CHYMOTRYPSINOGEN A
1acb[1] B ICIC_HIRME Eglin C[63 aa] A 66.7
/41.3
18
/19
CTRA_BOVIN ALPHA-CHYMOTRYPSIN
3t62[3] D ISH1_STOHE Kunitz-type proteinase inhibitor SHPI-1[54 aa] C 54.5
/41.3
22
/23
CTRA_BOVIN Chymotrypsinogen A
3m7q[1] B ISH1_STOHE Kunitz-type proteinase inhibitor SHPI-1[61 aa] A 73.7
/41.0
19
/20
TRY1_BOVIN Cationic trypsin
1oxg[1] B CTRA_BOVIN Chymotrypsinogen A[14 aa] A 68.8
/41.3
16
/16
CTRA_BOVIN Chymotrypsinogen A
5j4s[1] B IBB1_SOYBN Bowman-Birk type proteinase inhibitor[67 aa] A 60.9
/41.2
23
/23
CTRA_BOVIN Chymotrypsinogen A
1gl0[1] B LCM_LOCMI PROTEASE INHIBITOR LCMI I[32 aa] A 48.0
/41.2
25
/26
CTRA_BOVIN CHYMOTRYPSINOGEN A
5j4q[1] B IBB1_SOYBN Bowman-Birk type proteinase inhibitor[64 aa] A 54.2
/41.2
24
/24
CTRA_BOVIN Chymotrypsinogen A
1f2s[1] B ITR2_MOMCH TRYPSIN INHIBITOR A[28 aa] A 72.7
/41.0
22
/23
TRY1_BOVIN TRYPSIN
1tab[2] B IBB1_PHAAN BOWMAN-BIRK TYPE PROTEINASE INHIBITOR[36 aa] A 65.0
/41.0
20
/20
TRY1_BOVIN TRYPSIN
1tab[2] B IBB1_PHAAN BOWMAN-BIRK TYPE PROTEINASE INHIBITOR[36 aa] A 100.0
/41.0
1
/1
TRY1_BOVIN TRYPSIN
2j9n[1] B UNKNOWN PEPTIDE[15 aa] A 50.0
/41.0
6
/6
TRY1_BOVIN CATIONIC TRYPSIN
2j9n[1] C UNKNOWN PEPTIDE[3 aa] A 57.1
/41.0
7
/7
TRY1_BOVIN CATIONIC TRYPSIN
4abj[1] B SFTI1_HELAN TRYPSIN INHIBITOR 1[10 aa] A 80.0
/41.0
20
/21
TRY1_BOVIN CATIONIC TRYPSIN
4ktu[1] B B2G3C8_MICAE microviridin j[13 aa] A 75.0
/41.0
24
/25
TRY1_BOVIN Cationic trypsin
3p8f[1] B SFTI1_HELAN Trypsin inhibitor 1[14 aa] A 65.2
/44.0
23
/23
Q8WVC1_HUMAN ST14 protein
1sfi[1] B SFTI1_HELAN Trypsin inhibitor 1[14 aa] A 81.0
/41.0
21
/22
TRY1_BOVIN TRYPSIN
1tps[1] B INHIBITOR A90720A[8 aa] A 89.5
/41.0
19
/20
TRY1_BOVIN TRYPSIN
4kts[1] B B2G3C8_MICAE Microviridin[14 aa] A 84.2
/41.0
19
/20
TRY1_BOVIN Cationic trypsin
2plx[1] B Peptide Inhibitor[26 aa] A 72.7
/41.0
22
/23
TRY1_BOVIN Cationic trypsin
1aq7[1] B AERUGINOSIN 98-B[4 aa] A 76.5
/41.0
17
/17
TRY1_BOVIN TRYPSIN
4aoq[6] E ITR3_SPIOL TRYPSIN INHIBITOR 3[35 aa] B 73.9
/41.0
23
/24
TRY1_BOVIN CATIONIC TRYPSIN
6bvh[1] B Trypsin inhibitor 1[14 aa] A 85.0
/41.0
20
/21
TRY1_BOVIN Cationic trypsin
2cmy[1] B VERONICA HEDERIFOLIA TRYPSIN INHIBITOR[21 aa] A 66.7
/41.0
21
/21
TRY1_BOVIN CATIONIC TRYPSIN
3ru4[1] E CTRA_BOVIN Chymotrypsinogen A[96 aa] A 21.4
/41.0
14
/14
TRY1_BOVIN Cationic trypsin
3ru4[1] D CTRA_BOVIN Chymotrypsinogen A[131 aa] A 33.3
/41.0
3
/3
TRY1_BOVIN Cationic trypsin
4abi[1] B SFTI1_HELAN PTA-SFTI INHIBITOR[11 aa] A 77.3
/41.0
22
/23
TRY1_BOVIN CATIONIC TRYPSIN
1ox1[1] B 11-mer peptide[10 aa] A 84.2
/41.0
19
/20
TRY1_BOVIN Trypsinogen, cationic
6u22[1] B GLY-ARG-ALA-THR-LYS-SER-ILE-PRO-PRO-ILE-ALA-PHE-PR.. A 76.2
/41.0
21
/22
TRY1_BOVIN Cationic trypsin
1sbw[1] B IBB_PHAAU PROTEIN (MUNG BEAN INHIBITOR LYSIN ACTIVE FRAGMENT.. A 77.3
/41.0
22
/23
TRY1_BOVIN PROTEIN (BETA-TRYPSIN)
6eau[1] B CYS-THR-LYS-SER-ILE-PRO-PRO-CYS[8 aa] A 83.3
/41.0
18
/19
TRY1_BOVIN Cationic trypsin
6dwh[6] L Q6VEQ7_BAUBA Kunitz-type inihibitor[163 aa] F 28.6
/41.0
7
/7
TRY1_BOVIN Cationic trypsin
6dwh[56] K Q6VEQ7_BAUBA Kunitz-type inihibitor[163 aa] F 64.0
/41.0
25
/26
TRY1_BOVIN Cationic trypsin
2age[1] B succinyl-Ala-Ala-Pro-Arg[5 aa] A 93.8
/41.0
16
/16
TRY1_BOVIN beta-trypsin
1g9i[1] B IBB_PHAAU BOWMAN-BIRK TYPE TRYPSIN INHIBITOR[22 aa] A 81.0
/41.0
21
/22
TRY1_BOVIN TRYPSINOGEN, CATIONIC
2xtt[1] A SGP1_SCHGR PROTEASE INHIBITOR SGPI-1[35 aa] B 72.7
/41.0
22
/22
TRY1_BOVIN CATIONIC TRYPSIN
1smf[1] B IBB_VIGRR BOWMAN-BIRK TYPE TRYPSIN INHIBITOR[9 aa] A 83.3
/41.0
18
/19
TRY1_BOVIN TRYPSIN
3e8l[1] A Q7M1P4_SAGSA Serine proteinase inhibitor A[176 aa] B 71.4
/41.0
21
/22
TRY1_BOVIN Cationic trypsin
1c9t[8] K BDELLASTASIN[53 aa] E 76.5
/41.0
17
/18
TRY1_BOVIN TRYPSIN
4hgc[1] B SFTI1_HELAN Trypsin inhibitor 1[12 aa] A 73.9
/41.0
23
/23
TRY1_BOVIN Cationic trypsin
2qyi[2] B ICW3_PSOTE Chymotrypsin inhibitor 3[175 aa] A 72.4
/41.0
29
/30
TRY1_BOVIN Cationic trypsin
2qyi[1] D ICW3_PSOTE Chymotrypsin inhibitor 3[175 aa] A 0.0
/41.0
3
/3
TRY1_BOVIN Cationic trypsin
2stb[2] B ITR3_CUCPE PROTEIN (TRYPSIN INHIBITOR)[29 aa] A 75.0
/42.1
20
/20
TRY1_SALSA PROTEIN (TRYPSIN)
2o9q[1] B ORB2K[14 aa] A 73.9
/41.0
23
/24
TRY1_BOVIN Cationic trypsin
6e5m[1] B 9MER-PEPTIDE[9 aa] A 82.4
/41.0
17
/18
TRY1_BOVIN Cationic trypsin
2g81[1] B IBB_VIGUN Bowman-Birk type seed trypsin and chymotrypsin inh.. A 70.8
/41.0
24
/25
TRY1_BOVIN Cationic trypsin
2iln[1] C IBB_MEDSC Bowman-Birk type proteinase inhibitor[53 aa] B 81.0
/41.0
21
/22
TRY1_BOVIN Cationic trypsin
2qn5[1] A IBBR_ORYSJ Bowman-Birk type bran trypsin inhibitor[110 aa] B 72.7
/41.0
22
/23
TRY1_BOVIN Cationic trypsin
2uuy[1] B Q1EG59_RHIAP TRYPTASE INHIBITOR[52 aa] A 83.3
/41.0
18
/19
TRY1_BOVIN CATIONIC TRYPSIN
1dlk[2] E peptidic inhibitor[5 aa] D 0.0
/41.0
2
/2
CTRA_BOVIN Thrombin heavy chain
1dlk[3] F peptidic inhibitor[5 aa] D 71.4
/41.0
14
/14
CTRA_BOVIN Thrombin heavy chain
1dlk[3] A CTRA_BOVIN Thrombin light chain[13 aa] B 42.1
/41.0
19
/19
CTRA_BOVIN Thrombin heavy chain
1tgs[1] B IPK1_PIG PANCREATIC SECRETORY TRYPSIN INHIBITOR (KAZAL TYPE.. A 66.7
/40.8
24
/25
TRY1_BOVIN TRYPSINOGEN
2agi[3] B leupeptin[4 aa] A 86.7
/41.0
15
/15
TRY1_BOVIN beta-trypsin
2f9p[8] B Leupeptin[4 aa] A 78.6
/40.3
14
/14
Tryptase alpha-1
2f9p[8] H Leupeptin[4 aa] A 0.0
/40.3
1
/1
Tryptase alpha-1
3th3[39] A FA7_HUMAN Coagulation factor VII light chain[96 aa] B 39.1
/40.1
23
/23
FA7_HUMAN Coagulation factor VII heavy chain
6o1f[1] D Light Chain hu31A.v11[213 aa] A 12.5
/40.3
8
/8
TRYB1_HUMAN Tryptase alpha/beta-1
6o1f[1] B Heavy Chain hu31A.v11[217 aa] A 18.2
/40.3
11
/11
TRYB1_HUMAN Tryptase alpha/beta-1
6vvu[4] K Fab E104.v1 light chain[216 aa] B 16.7
/40.3
6
/6
TRYB1_HUMAN Tryptase alpha/beta-1
6vvu[4] H Fab E104.v1 heavy chain[216 aa] A 8.3
/40.3
12
/13
TRYB1_HUMAN Tryptase alpha/beta-1
6vvu[2] G Fab E104.v1 heavy chain[217 aa] D 0.0
/40.3
2
/2
TRYB1_HUMAN Tryptase alpha/beta-1
6x5j[3] B FA9_HUMAN Coagulation factor IX[50 aa] A 30.4
/40.0
23
/23
FA9_HUMAN Coagulation factor IX
1bui[1] C SAK_BPP42 Staphylokinase[122 aa] B 22.2
/40.1
9
/14
PLMN_HUMAN Plasminogen
1bui[1] C SAK_BPP42 Staphylokinase[122 aa] A 14.3
/40.1
14
/14
PLMN_HUMAN Plasminogen
6q1u[2] C GLY-ARG-ALA-TYR-LYS-SER-LYS-PRO-PRO-ILE-ALA-PHE-PR.. A 82.4
/40.1
17
/17
PLMN_HUMAN Plasminogen
6d3y[1] B SFTI1_HELAN Trypsin inhibitor 1[14 aa] A 78.9
/40.1
19
/19
PLMN_HUMAN Plasminogen
3uir[2] C IVBI1_PSETT Textilinin-1[56 aa] A 89.5
/40.1
19
/19
PLMN_HUMAN Plasmin light chain B
6d3x[2] D SFTI1_HELAN Trypsin inhibitor 1[14 aa] B 77.8
/40.1
18
/18
PLMN_HUMAN Plasminogen
6d40[1] B SFTI1_HELAN Trypsin inhibitor 1[14 aa] A 83.3
/40.1
18
/18
PLMN_HUMAN Plasminogen
1dan[3] D TF_HUMAN SOLUBLE TISSUE FACTOR[116 aa] B 40.0
/40.1
5
/5
FA7_HUMAN BLOOD COAGULATION FACTOR VIIA heavy chain
2c4f[3] C TF_HUMAN TISSUE FACTOR PRECURSOR[75 aa] A 0.0
/40.1
5
/5
FA7_HUMAN COAGULATION FACTOR VII PRECURSOR
3ela[2] C TF_HUMAN Tissue factor[191 aa] B 27.3
/40.5
11
/11
FA7_HUMAN Coagulation factor VIIA heavy chain
2puq[1] D TRP-TYR-THR-ARG CHLOROMETHYLKETONE INHIBITOR[4 aa].. B 82.4
/40.1
17
/17
FA7_HUMAN Coagulation factor VII
3th3[1] C TF_HUMAN Tissue factor[154 aa] B 22.2
/40.1
9
/9
FA7_HUMAN Coagulation factor VII heavy chain
4ibl[24] C TF_HUMAN Tissue factor[198 aa] B 22.2
/40.1
9
/9
FA7_HUMAN Coagulation factor VII
2b7d[5] C TF_HUMAN Tissue factor[149 aa] B 20.0
/40.1
10
/10
FA7_HUMAN Coagulation factor VII
1dva[2] C PEPTIDE E-76[19 aa] A 0.0
/40.1
18
/20
FA7_HUMAN DES-GLA FACTOR VIIA (HEAVY CHAIN)
2wph[26] A FA9_HUMAN COAGULATION FACTOR IXA LIGHT CHAIN[59 aa] C 35.0
/39.5
20
/20
FA9_HUMAN COAGULATION FACTOR IXA HEAVY CHAIN
6mv4[4] B FA9_HUMAN Coagulation factor IX[54 aa] A 0.0
/40.0
3
/4
FA9_HUMAN Coagulation factor IX
1l4z[4] B STRP_STREQ Streptokinase[125 aa] A 33.3
/39.9
12
/13
PLMN_HUMAN Plasminogen
1l4d[2] B STRP_STREQ STREPTOKINASE[112 aa] A 50.0
/39.9
16
/17
PLMN_HUMAN PLASMINOGEN
1l4z[2] B STRP_STREQ Streptokinase[125 aa] A 33.3
/39.9
6
/6
PLMN_HUMAN Plasminogen
1bml[2] D STRP_STREQ STREPTOKINASE[318 aa] B 6.1
/39.9
33
/35
PLMN_HUMAN PLASMIN
1bml[2] C STRP_STREQ STREPTOKINASE[318 aa] B 0.0
/39.9
4
/4
PLMN_HUMAN PLASMIN
6d3z[1] B SFTI1_HELAN Trypsin inhibitor 1[14 aa] A 70.0
/39.6
20
/20
PLMN_HUMAN Plasminogen
6rfk[1] C GLU-GLY-AR7-0QE[4 aa] B 81.2
/39.6
16
/17
FA9_HUMAN Coagulation factor IX
3kcg[1] C ANT3_HUMAN Antithrombin-III[419 aa] B 50.0
/39.6
32
/33
FA9_HUMAN Coagulation factor IXa heavy chain
2wpi[5] B D-PHE-PRO-ARG-CHLOROMETHYL KETONE[3 aa] C 81.2
/39.9
16
/16
FA9_HUMAN COAGULATION FACTOR IXA HEAVY CHAIN
2wpm[1] B GLU-GLY-ARG-CHLOROMETHYL KETONE[3 aa] C 81.2
/39.5
16
/16
FA9_HUMAN COAGULATION FACTOR IXA HEAVY CHAIN
2wub[1] D HGFA_HUMAN HEPATOCYTE GROWTH FACTOR ACTIVATOR SHORT CHAIN[6 a.. C 45.5
/39.2
11
/11
HGFA_HUMAN HEPATOCYTE GROWTH FACTOR ACTIVATOR LONG CHAIN
2wuc[2] C FAB FRAGMENT FAB40.DELTATRP HEAVY CHAIN[219 aa] A 23.1
/38.2
13
/14
HGFA_HUMAN HEPATOCYTE GROWTH FACTOR ACTIVATOR LONG CHAIN
5tqg[65] B FA7_HUMAN Factor VIIa (Light Chain)[55 aa] A 38.1
/39.9
21
/22
FA7_HUMAN Factor VIIa (Heavy Chain)
1ygc[4] B FA7_HUMAN Coagulation factor VII[53 aa] A 0.0
/40.1
2
/3
FA7_HUMAN Coagulation factor VII
1fak[1] C TF_HUMAN PROTEIN (SOLUBLE TISSUE FACTOR)[183 aa] B 20.0
/38.9
10
/10
FA7_HUMAN PROTEIN (BLOOD COAGULATION FACTOR VIIA)
1fak[1] D BPT1_BOVIN PROTEIN (5L15)[55 aa] B 64.0
/38.9
25
/25
FA7_HUMAN PROTEIN (BLOOD COAGULATION FACTOR VIIA)
2r0l[1] B antibody heavy chain, Fab portion only[220 aa] C 20.0
/38.2
15
/16
HGFA_HUMAN Hepatocyte growth factor activator
4ogx[3] C DX-2930 LIGHT CHAIN[212 aa] A 50.0
/44.2
6
/6
KLKB1_HUMAN Plasma kallikrein
2wuc[3] E FAB FRAGMENT FAB40.DELTATRP LIGHT CHAIN[214 aa] A 28.6
/38.2
7
/7
HGFA_HUMAN HEPATOCYTE GROWTH FACTOR ACTIVATOR LONG CHAIN
6aod[1] A FXIa Antibody FAB Light Chain[207 aa] C 46.2
/43.4
26
/26
FA11_HUMAN Coagulation factor XI
3bn9[2] E E2 Fab Light Chain[211 aa] D 0.0
/43.6
3
/3
ST14_HUMAN Membrane-type serine protease 1
2r0l[1] D HGFA_HUMAN Hepatocyte growth factor activator[10 aa] C 25.0
/38.2
12
/12
HGFA_HUMAN Hepatocyte growth factor activator
2wuc[1] B HGFA_HUMAN HEPATOCYTE GROWTH FACTOR ACTIVATOR SHORT CHAIN[7 a.. A 27.3
/38.2
11
/11
HGFA_HUMAN HEPATOCYTE GROWTH FACTOR ACTIVATOR LONG CHAIN
2r0k[1] C antibody heavy chain of Fab58, Fab portion only[21.. A 33.3
/38.2
12
/14
HGFA_HUMAN Hepatocyte growth factor activator
4isl[3] A SPIT1_HUMAN Kunitz-type protease inhibitor 1[60 aa] B 57.1
/43.6
28
/29
ST14_HUMAN Suppressor of tumorigenicity 14 protein
1yc0[1] B SPIT1_HUMAN Kunitz-type protease inhibitor 1[66 aa] A 56.0
/38.2
25
/25
HGFA_HUMAN Hepatocyte growth factor activator
1z8g[1] B ACE-LYS-GLN-LEU-ARG-Chloromethylketone[6 aa] A 66.7
/35.2
21
/21
HEPS_HUMAN Serine protease hepsin
2wuc[1] D ACE-KQLR-CHLOROMETHYLKETONE INHIBITOR[6 aa] A 64.7
/38.2
17
/17
HGFA_HUMAN HEPATOCYTE GROWTH FACTOR ACTIVATOR LONG CHAIN
6m3c[3] F PROC_HUMAN Vitamin K-dependent protein C light chain[53 aa] E 36.8
/36.2
19
/21
PROC_HUMAN Vitamin K-dependent protein C heavy chain
1aut[2] B PRTC_HUMAN ACTIVATED PROTEIN C[98 aa] A 38.1
/36.2
21
/23
PRTC_HUMAN ACTIVATED PROTEIN C
6m3c[3] H h1573 Fab L chain[221 aa] E 20.0
/36.2
5
/6
PROC_HUMAN Vitamin K-dependent protein C heavy chain
6m3c[3] C h1573 Fab H chain[218 aa] A 40.0
/36.2
10
/14
PROC_HUMAN Vitamin K-dependent protein C heavy chain
3t2n[2] D Antibody, Fab fragment, Heavy Chain[205 aa] B 27.3
/34.8
11
/11
HEPS_HUMAN Serine protease hepsin
3t2n[2] F Antibody, Fab fragment, Light Chain[212 aa] B 36.4
/34.8
11
/11
HEPS_HUMAN Serine protease hepsin
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
COMPOUND
492 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
5i25[3] E NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 33.3
/45.5
3
/3
FA11_HUMAN Coagulation factor XI
2f9p[3] K NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 0.0
/40.3
1
/1
Tryptase alpha-1
6o1g[1] B NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 0.0
/44.7
1
/1
KLKB1_HUMAN Plasma kallikrein
5eok[2] E NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 40.0
/45.8
5
/5
FA11_HUMAN Coagulation factor XI
2f9n[2] O NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
D 33.3
/40.7
3
/3
TRYA1_HUMAN alpha I tryptase
5eok[1] F NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 0.0
/45.8
1
/1
FA11_HUMAN Coagulation factor XI
2f83[2] D NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 0.0
/46.4
3
/3
FA11_HUMAN Coagulation factor XI
1ybw[2] C NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 0.0
/38.6
3
/3
HGFA_HUMAN Hepatocyte growth factor activator precursor
4x6p[2] C NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 25.0
/43.9
4
/4
FA11_HUMAN Coagulation factor XI, light chain
1zpz[1] C BUK
N~2~-({[(1R)-1-(4-BROMOPHENYL)ETHYL]AMINO}CARBONYL..
A 68.4
/44.9
19
/19
FA11_HUMAN Coagulation factor XI
5tjx[1] B GBT
(8E)-3-amino-1-methyl-15-[(1H-pyrazol-1-yl)methyl]..
A 65.0
/44.7
20
/20
KLKB1_HUMAN Plasma kallikrein
5q0e[1] B 9FD
methyl [(4S,8S)-8-({(2E)-3-[5-chloro-2-(1H-tetrazo..
A 70.8
/44.5
24
/24
FA11_HUMAN Coagulation factor XI
5q0f[1] C 9FA
methyl [(4R,5E,8S)-8-({(2E)-3-[5-chloro-2-(1H-tetr..
A 70.8
/44.5
24
/24
FA11_HUMAN Coagulation factor XI
4na8[1] B 1T6
5-aminocarbonyl-2-[3-[(2S,4R)-6-carbamimidoyl-4-me..
A 73.7
/44.5
19
/19
FA11_HUMAN Coagulation factor XI
4na7[1] B 1T5
3'-[(2S,4R)-6-carbamimidoyl-4-methyl-4-phenyl-1,2,..
A 73.7
/44.5
19
/19
FA11_HUMAN Coagulation factor XI
5q0g[1] B 9F7
methyl [(3R,7S)-7-({(2E)-3-[5-chloro-2-(1H-tetrazo..
A 70.8
/44.5
24
/24
FA11_HUMAN Coagulation factor XI
5q0h[1] B 9F1
methyl [(4R,5E,8S)-11-chloro-8-[(2,6-difluoro-4-me..
A 73.7
/44.5
19
/19
FA11_HUMAN Coagulation factor XI
5e2o[1] B 5JM
4-[(N-{(2E)-3-[5-chloro-2-(1H-tetrazol-1-yl)phenyl..
A 73.9
/44.5
23
/23
FA11_HUMAN Coagulation factor XIa light chain
5tkt[1] B 7DS
METHYL ((12E,15S)-15-(((2E)-3-(5-CHLORO-2-(1H-TETR..
A 69.6
/44.5
23
/23
FA11_HUMAN Factor XIa (Light Chain)
5wb6[1] B 9ZM
methyl [(11S)-11-({(2E)-3-[5-chloro-2-(1H-tetrazol..
A 69.2
/44.5
26
/26
FA11_HUMAN Coagulation factor XI
4x6m[1] B 3Y3
1-{(1S)-1-[4-(3-amino-1H-indazol-6-yl)-5-chloro-1H..
A 75.0
/44.5
24
/24
FA11_HUMAN Coagulation factor XI, light chain
4x6n[1] C 3Y5
1-{(1S)-1-[4-(3-amino-1H-indazol-6-yl)-5-chloro-1H..
A 72.0
/44.5
25
/25
FA11_HUMAN Coagulation factor XI, light chain
4x6o[1] B 3Y4
methyl (4-{4-chloro-2-[(1S)-1-({3-[5-chloro-2-(1H-..
A 72.0
/44.5
25
/25
FA11_HUMAN Coagulation factor XI, light chain
5qtw[1] B QLM
methyl (2R,7S)-7-({(2E)-3-[5-chloro-2-(1H-tetrazol..
A 69.6
/44.5
23
/23
FA11_HUMAN Coagulation factor XI
5qty[1] B QLJ
ethyl (2R,7S)-7-({(2E)-3-[5-chloro-2-(1H-tetrazol-..
A 66.7
/44.5
24
/24
FA11_HUMAN Coagulation factor XI
5qtx[1] C QLD
ethyl (2R,7S)-7-({(2E)-3-[5-chloro-2-(1H-tetrazol-..
A 66.7
/44.5
24
/24
FA11_HUMAN Coagulation factor XI
4ty7[1] B 39F
trans-N-{(1S)-1-[4-(3-amino-2H-indazol-6-yl)-5-chl..
A 70.0
/44.5
20
/20
FA11_HUMAN Coagulation factor XI
4ty6[1] C 39D
4-{2-[(1S)-1-({[trans-4-(aminomethyl)cyclohexyl]ca..
A 68.4
/44.5
19
/19
FA11_HUMAN Coagulation factor XI
5q0d[1] B 9EY
methyl [(7S)-7-({(2E)-3-[5-chloro-2-(1H-tetrazol-1..
A 72.7
/44.5
22
/22
FA11_HUMAN Coagulation factor XI
5qtv[1] B QLS
methyl [(2R,7S)-7-({(2E)-3-[5-chloro-2-(1H-tetrazo..
A 72.7
/44.5
22
/22
FA11_HUMAN Coagulation factor XI
6w50[1] B SWP
methyl ((10R,14S)-14-(4-(3-chloro-2,6-difluorophen..
A 75.0
/44.5
24
/24
FA11_HUMAN Coagulation factor XI
5qqp[1] B NR7
methyl [(5E,8S)-8-[(4S)-4-(3-chlorophenyl)-2-oxopi..
A 75.0
/44.5
20
/20
FA11_HUMAN Coagulation factor XI
5qqo[1] C NRJ
methyl [(5E,8S)-8-[(6R)-6-(3-chlorophenyl)-2-oxo-1..
A 70.0
/44.5
20
/20
FA11_HUMAN Coagulation factor XI
4y8x[1] B 4GR
methyl (4-{4-chloro-2-[(1S)-1-({(2E)-3-[5-chloro-2..
A 72.0
/44.5
25
/25
FA11_HUMAN Coagulation factor XIa
5qcl[1] B BUY
4-[[(1~{S})-2-[(~{E})-3-[5-chloranyl-2-(1,2,3,4-te..
A 72.0
/44.5
25
/25
FA11_HUMAN Coagulation factor XI
5qck[1] B BUV
4-[[(2~{S},3~{R})-1-[(~{E})-3-[5-chloranyl-2-(1,2,..
A 72.0
/44.5
25
/25
FA11_HUMAN Coagulation factor XI
4y8z[1] B 4CE
(2E)-N-[(1S)-1-[5-chloro-4-(4-hydroxy-2-oxo-1,2-di..
A 70.8
/44.5
24
/24
FA11_HUMAN Coagulation factor XIa
5qtu[1] C QEV
methyl [(3R,7S)-7-{[1-(3-chloro-2-fluorophenyl)-5-..
A 73.9
/44.5
23
/23
FA11_HUMAN Coagulation factor XI
5qtt[1] B QEY
methyl [(3R,7S)-7-{[5-amino-1-(3-chloro-2-fluoroph..
A 72.7
/44.5
22
/22
FA11_HUMAN Coagulation factor XI
5tku[1] B 7DK
METHYL ((15S)-15-(((2E)-3-(5-CHLORO-2-(1H-TETRAZOL..
A 72.7
/44.5
22
/22
FA11_HUMAN Factor XIa (Light Chain)
5tks[1] B 7DL
((15S)-18-CHLORO- 15-(((2E)-3-(5-CHLORO-2-(1H-TETR..
A 72.7
/44.5
22
/22
FA11_HUMAN Coagulation factor XI
5exm[1] B 5ST
methyl ~{N}-[4-[2-[(1~{S})-1-[[4-(aminomethyl)cycl..
A 70.0
/44.5
20
/20
FA11_HUMAN Coagulation factor XIa light chain
5exl[1] B 5SS
4-(aminomethyl)-~{N}-[(1~{S})-1-[4-(3-oxidanyl-1~{..
A 70.0
/44.5
20
/20
FA11_HUMAN Coagulation factor XIa light chain
4y8y[1] B 4D5
methyl (4-{4-chloro-2-[(1S)-1-({(2E)-3-[5-chloro-2..
A 66.7
/44.5
24
/24
FA11_HUMAN Coagulation factor XIa
4wxi[1] B 3VM
trans-N-{(1S)-1-[4-(3-amino-2H-indazol-6-yl)pyridi..
A 70.0
/44.5
20
/20
FA11_HUMAN COAGULATION FACTOR XI, LIGHT CHAIN
5qcn[1] B BVM
4-[[(1~{S})-2-[(~{E})-3-[5-chloranyl-2-(1,2,3,4-te..
A 69.6
/44.5
23
/23
FA11_HUMAN Coagulation factor XI
4crb[2] D 7P0
N-[(1S)-1-benzyl-2-[2-[5-chloro-2-(tetrazol-1-yl)p..
A 70.8
/43.7
24
/24
FA11_HUMAN COAGULATION FACTOR XI
6c0s[1] B EEJ
methyl (4-{6-[(1S)-2-[(3R)-1-acetylpiperidin-3-yl]..
A 72.0
/44.5
25
/25
FA11_HUMAN Coagulation factor XI
5qcm[1] B BVJ
methyl ~{N}-[4-[[(1~{S})-2-[(~{E})-3-[3-chloranyl-..
A 70.8
/44.5
24
/24
FA11_HUMAN Coagulation factor XI
6t7p[1] O MU8
(2~{S},4~{R})-1-[[(3~{S})-3-azanyl-2,3-dihydro-1-b..
A 73.7
/44.4
19
/19
KLKB1_HUMAN Plasma kallikrein
4crg[3] F J4X
6-carbamimidoyl-N-phenyl-4-(pyrimidin-2-ylamino)na..
A 68.8
/44.2
16
/16
FA11_HUMAN COAGULATION FACTOR XI
3bg8[3] B INH
N-(R-CARBOXY-ETHYL)-ALPHA-(S)-(2-PHENYLETHYL)GLYCY..
A 85.7
/44.1
14
/14
FA11_HUMAN Coagulation factor XIa light chain
1zsl[1] B 624
2-(2-(3,4-DICHLOROPHENYL)-5-(ISOPROPYLAMINO)-6-OXO..
A 72.2
/44.1
18
/18
FA11_HUMAN Coagulation factor XI
1zrk[1] E 367
3-HYDROXYPROPYL 3-[({7-[AMINO(IMINO)METHYL]-1-NAPH..
A 69.2
/44.1
13
/13
FA11_HUMAN Coagulation factor XI
5exn[1] C 5SU
methyl ~{N}-[4-[2-[(1~{S})-1-[[(~{E})-3-[5-chloran..
A 70.8
/44.1
24
/24
FA11_HUMAN Coagulation factor XIa light chain
4o9v[1] C NT4
N-(trans-4-aminocyclohexyl)-3,5-bis(4-carbamimidoy..
A 72.2
/44.0
18
/18
ST14_HUMAN Suppressor of tumorigenicity 14 protein
4o97[1] C NTX
N-(trans-4-aminocyclohexyl)-3,5-bis[(3-carbamimido..
A 68.8
/44.0
16
/16
ST14_HUMAN Suppressor of tumorigenicity 14 protein
6n4t[1] F 144
TRIS-HYDROXYMETHYL-METHYL-AMMONIUM[8 atoms]
A 33.3
/44.0
3
/3
ST14_HUMAN Suppressor of tumorigenicity 14 protein
4jyt[1] B N4A
4,4'-[{3-[(naphthalen-2-ylsulfonyl)amino]pyridine-..
A 82.4
/44.0
17
/17
ST14_HUMAN Suppressor of tumorigenicity 14 protein
4jzi[1] B N4C
N-(trans-4-aminocyclohexyl)-2,6-bis(4-carbamimidoy..
A 73.3
/44.0
15
/15
ST14_HUMAN Suppressor of tumorigenicity 14 protein
4r0i[1] C 3KM
3-({(2S)-3-[4-(2-aminoethyl)piperidin-1-yl]-2-[(na..
A 73.3
/44.0
15
/15
ST14_HUMAN Suppressor of tumorigenicity 14 protein
4jz1[1] B F4D
4,4'-[(3-{[(4-fluorophenyl)sulfonyl]amino}pyridine..
A 78.9
/44.0
19
/19
ST14_HUMAN Suppressor of tumorigenicity 14 protein
2gv6[1] B 730
(S)-3-(3-(4-(2-GUANIDINOETHYL)PIPERIDIN-1-YL)-2-(N..
A 75.0
/44.0
16
/16
ST14_HUMAN Suppressor of tumorigenicity 14
6n4t[1] E KD7
N-(3-phenylpropanoyl)-3-(1,3-thiazol-4-yl)-L-alany..
A 70.0
/44.0
20
/20
ST14_HUMAN Suppressor of tumorigenicity 14 protein
4isn[8] D GSH
GLUTATHIONE[20 atoms]
B 57.1
/44.0
7
/7
ST14_HUMAN Suppressor of tumorigenicity 14 protein
6t7p[3] B GSH
GLUTATHIONE[20 atoms]
A 66.7
/44.4
6
/6
KLKB1_HUMAN Plasma kallikrein
2gv7[1] B 672
(S)-4-(4-(3-(3-CARBAMIMIDOYLPHENYL)-2-(2,4,6-TRIIS..
A 65.0
/44.0
20
/20
ST14_HUMAN Suppressor of tumorigenicity 14
6o1g[1] D 7SD
N-[(6-amino-2,4-dimethylpyridin-3-yl)methyl]-1-({4..
A 70.6
/44.7
17
/17
KLKB1_HUMAN Plasma kallikrein
6o1s[1] D 7SD
N-[(6-amino-2,4-dimethylpyridin-3-yl)methyl]-1-({4..
A 65.0
/44.0
20
/20
KLKB1_HUMAN Plasma kallikrein
3sor[1] C O58
{4-[(N-{3-[5-chloro-2-(1H-tetrazol-1-yl)phenyl]pro..
A 68.2
/43.9
22
/22
FA11_HUMAN Coagulation factor XI
6usy[1] B QGS
1-[(2S)-2-{3-[(3S)-3-amino-2,3-dihydro-1-benzofura..
A 76.5
/43.9
17
/17
FA11_HUMAN Coagulation factor XIa light chain
4crf[1] F R9B
N-[(1S)-1-benzyl-2-[(6-chloro-2-oxo-1H-quinolin-4-..
A 73.9
/43.9
23
/23
FA11_HUMAN COAGULATION FACTOR XI
4x6p[2] D 3YU
(2E)-N-{(1S)-1-[4-(3-amino-1H-indazol-6-yl)-1H-imi..
A 73.9
/43.9
23
/23
FA11_HUMAN Coagulation factor XI, light chain
6vlv[1] D R3A
1-carbamimidamido-4-chloro-N-[(2R)-3-methyl-1-(mor..
A 70.6
/43.9
17
/17
FA11_HUMAN Coagulation factor XIa light chain
6ts7[1] B NWE
2-[2-[[3-(1,2,3,4-tetrahydroisoquinolin-7-yl)pheny..
A 86.7
/43.9
15
/15
FA11_HUMAN Coagulation factor XI
6ts6[1] H NW5
2-[2-[[3-[(3~{S})-3-azanyl-2,3-dihydro-1-benzofura..
A 76.5
/43.9
17
/17
FA11_HUMAN Coagulation factor XI
6ts5[1] B NW2
2-[2-[3-[(3~{S})-3-azanyl-2,3-dihydro-1-benzofuran..
A 72.2
/43.9
18
/18
FA11_HUMAN Coagulation factor XI
3sos[1] D O61
N-[(2S)-1-({2-[5-chloro-2-(1H-tetrazol-1-yl)phenyl..
A 72.7
/43.9
22
/22
FA11_HUMAN Coagulation factor XI
6vlu[1] C R2Y
N-cyclohexyl-D-leucyl-N-[(1-aminoisoquinolin-6-yl)..
A 66.7
/43.9
18
/18
FA11_HUMAN Coagulation factor XIa light chain
1zpc[1] E 716
2-[2-(3-CHLORO-PHENYL)-2-HYDROXY-ACETYLAMINO]-N-[4..
A 66.7
/43.7
18
/18
FA11_HUMAN Coagulation factor XI
1zmn[1] E 427
(R)-1-(4-(4-(HYDROXYMETHYL)-1,3,2-DIOXABOROLAN-2-Y..
A 85.7
/43.7
14
/14
FA11_HUMAN Coagulation factor XI
1zom[1] C 339
(S)-2-(3-((R)-1-(4-BROMOPHENYL)ETHYL)UREIDO)-N-((S..
A 66.7
/43.7
18
/18
FA11_HUMAN Coagulation factor XI
4cre[3] B MVN
6-chloro-4-methyl-1H-quinolin-2-one[13 atoms]
A 80.0
/43.7
15
/15
FA11_HUMAN COAGULATION FACTOR XI
2fda[1] E 682
N~2~-(AMINOCARBONYL)-N~1~-{4-{[AMINO(IMINO)METHYL]..
A 78.6
/43.7
14
/14
FA11_HUMAN Coagulation factor XI
1zsj[1] D 709
N-(7-CARBAMIMIDOYL-NAPHTHALEN-1-YL)-3-HYDROXY-2-ME..
A 69.2
/43.7
13
/13
FA11_HUMAN Coagulation factor XI
1zmj[1] D HDB
(R)-1-(4-(4-(HYDROXYMETHYL)-1,3,2-DIOXABOROLAN-2-Y..
A 80.0
/43.7
15
/15
FA11_HUMAN Coagulation factor XI
1ztk[1] D 62A
2-(5-AMINO-6-OXO-2-M-TOLYL-6H-PYRIMIDIN-1-YL)-N-[4..
A 80.0
/43.7
15
/15
FA11_HUMAN Coagulation factor XI
4crc[1] B OTM
(2S)-2-[[(E)-3-[5-chloranyl-2-(1,2,3,4-tetrazol-1-..
A 77.3
/43.7
22
/22
FA11_HUMAN COAGULATION FACTOR XI
4cr9[2] B OTW
4-methylquinoline-2,6-diamine[13 atoms]
A 75.0
/43.7
12
/12
FA11_HUMAN COAGULATION FACTOR XI
1zpb[1] C 995
4-METHYL-PENTANOIC ACID {1-[4-GUANIDINO-1-(THIAZOL..
A 72.2
/43.7
18
/18
FA11_HUMAN Coagulation factor XI
1zml[1] I 412
(R)-1-(4-(4-(HYDROXYMETHYL)-1,3,2-DIOXABOROLAN-2-Y..
A 80.0
/43.7
15
/15
FA11_HUMAN Coagulation factor XI
1zlr[1] E 368
(1R)-2-{[AMINO(IMINO)METHYL]AMINO}-1-{4-[(4R)-4-(H..
A 75.0
/43.7
16
/16
FA11_HUMAN Coagulation factor XI
1ztl[1] D 737
N-[4-GUANIDINO-1-(THIAZOLE-2-CARBONYL)-BUTYL]-2-{6..
A 85.7
/43.7
14
/14
FA11_HUMAN Coagulation factor XI
1ztj[1] E 632
2-(5-BENZYLAMINO-2-METHYLSULFANYL-6-OXO-6H-PYRIMID..
A 70.6
/43.7
17
/17
FA11_HUMAN Coagulation factor XI
4cra[3] D XJ8
N-[(1S)-2-[(2-amino-5-quinolyl)methylamino]-1-benz..
A 66.7
/43.7
18
/18
FA11_HUMAN COAGULATION FACTOR XI
1zsk[1] E 421
6-CARBAMIMIDOYL-4-(3-HYDROXY-2-METHYL-BENZOYLAMINO..
A 73.3
/43.7
15
/15
FA11_HUMAN Coagulation factor XI
4cr5[2] B 0TU
6-chloroquinolin-2(1H)-one[12 atoms]
A 85.7
/43.7
14
/14
FA11_HUMAN COAGULATION FACTOR XIA
3ncl[1] B CCZ
phenyl (4-carbamimidoylbenzyl)phosphonate[20 atoms..
A 87.5
/43.6
16
/16
ST14_HUMAN Suppressor of tumorigenicity 14 protein
5gvt[2] F MAN
alpha-D-mannopyranose[11 atoms]
B 0.0
/44.3
1
/1
KLKB1_MOUSE Plasma kallikrein
6a8o[2] D MAN
alpha-D-mannopyranose[11 atoms]
A 33.3
/43.5
3
/3
KLKB1_MOUSE Plasma kallikrein
5gvt[1] C BMA
beta-D-mannopyranose[11 atoms]
A 0.0
/43.5
1
/1
KLKB1_MOUSE Plasma kallikrein
5gvt[1] D BMA
beta-D-mannopyranose[11 atoms]
A 0.0
/43.5
1
/1
KLKB1_MOUSE Plasma kallikrein
4d7g[1] H E6U
N-[(1S)-1-benzyl-2-(3-guanidinopropylamino)-2-oxo-..
A 70.0
/43.4
20
/20
FA11_HUMAN COAGULATION FACTOR XIA
4d7f[1] C IXA
N-[(2S)-1-({4-[(diaminomethylidene)amino]butyl}ami..
A 72.7
/43.4
22
/22
FA11_HUMAN COAGULATION FACTOR XI
6ts4[1] K J7B
2-[2-[[3-[3-(aminomethyl)phenyl]phenyl]carbonylami..
A 75.0
/43.4
16
/16
FA11_HUMAN Coagulation factor XI
4crd[3] B OTJ
Methyl N-[4-[5-chloro-2-[[3-[5-chloro-2-(tetrazol-..
A 72.7
/43.4
22
/22
FA11_HUMAN COAGULATION FACTOR XI
4d76[1] E J1J
N-[(2S)-1-({5-[(diaminomethylidene)amino]pentyl}am..
A 72.7
/43.4
22
/22
FA11_HUMAN COAGULATION FACTOR XI
1o2s[1] D CR4
2-{5-[AMINO(IMINIO)METHYL]-1H-BENZIMIDAZOL-2-YL}BE..
A 92.3
/41.0
13
/13
TRY1_BOVIN BETA-TRYPSIN
1p57[1] C CR4
2-{5-[AMINO(IMINIO)METHYL]-1H-BENZIMIDAZOL-2-YL}BE..
B 83.3
/43.2
12
/12
HEPS_HUMAN Serine protease hepsin
1o5d[2] D CR9
2-{5-[AMINO(IMINIO)METHYL]-6-FLUORO-1H-BENZIMIDAZO..
B 82.4
/40.1
17
/17
FA7_HUMAN Coagulation factor VII
1o2r[1] E CR9
2-{5-[AMINO(IMINIO)METHYL]-6-FLUORO-1H-BENZIMIDAZO..
A 85.7
/41.0
14
/14
TRY1_BOVIN BETA-TRYPSIN
6t9t[1] C MXH
1-~{tert}-butyl-3-[1-[(2~{S})-3-(3-carbamimidoylph..
A 65.0
/42.5
20
/20
ST14_HUMAN Suppressor of tumorigenicity 14 protein
4doq[1] F XPE
3,6,9,12,15,18,21,24,27-NONAOXANONACOSANE-1,29-DIO..
A 28.6
/42.3
7
/7
TRYP_PIG Trypsin
1utl[1] B PRA
3-PHENYLPROPYLAMINE[10 atoms]
A 100.0
/42.1
11
/11
TRY1_SALSA TRYPSIN I
1utm[1] B PEA
2-PHENYLETHYLAMINE[9 atoms]
A 100.0
/42.1
6
/6
TRY1_SALSA TRYPSIN I
1s6f[1] E SBP
[3-(1,3,2-DIOXABOROLAN-2-YLOXY)PROPYL]GUANIDINE[13..
A 87.5
/41.9
16
/16
TRYP_PIG Trypsin
1s85[1] D SBZ
[4-(1,3,2-DIOXABOROLAN-2-YLOXY)METHYL]BENZAMIDINE[..
A 86.7
/41.9
15
/15
TRYP_PIG TRYPSIN
1s84[1] L DYB
4-(1,3,2-DIOXABOROLAN-2-YLOXY)BUTAN-1-AMINIUM[11 a..
A 85.7
/41.9
14
/14
TRYP_PIG TRYPSIN
1v6d[1] E TBF
TERT-BUTYL FORMATE[7 atoms]
A 0.0
/41.9
1
/1
TRYP_PIG Trypsin
1s6h[1] F 4BZ
4-(HYDROXYMETHYL)BENZAMIDINE[11 atoms]
A 91.7
/41.9
12
/12
TRYP_PIG Trypsin
2a31[3] I PG3
GUANIDINE-3-PROPANOL[8 atoms]
A 91.7
/41.9
12
/12
TRYP_PIG Trypsin
2a32[1] H CXS
3-CYCLOHEXYL-1-PROPYLSULFONIC ACID[14 atoms]
A 100.0
/41.9
1
/1
TRYP_PIG Trypsin
2a32[1] I CXS
3-CYCLOHEXYL-1-PROPYLSULFONIC ACID[14 atoms]
A 0.0
/41.9
2
/2
TRYP_PIG Trypsin
2a32[1] E PBC
PHENYL BORONIC ACID[8 atoms]
A 100.0
/41.9
4
/4
TRYP_PIG Trypsin
1k2i[2] C SN1
2,4-DIHYDROXY-TRANS CINNAMIC ACID[12 atoms]
A 72.7
/41.7
11
/11
CTRA_BOVIN CHYMOTRYPSINOGEN A
6zov[4] E GBS
4-GUANIDINOBENZOIC ACID[12 atoms]
A 84.6
/41.7
13
/13
ENTK_HUMAN Enteropeptidase
1gbt[3] E GBS
4-GUANIDINOBENZOIC ACID[12 atoms]
A 92.9
/41.0
14
/14
TRY1_BOVIN BETA-TRYPSIN
3dfl[1] B GBS
4-GUANIDINOBENZOIC ACID[12 atoms]
A 78.6
/35.6
14
/14
PRSS8_HUMAN Prostasin
1gcd[2] E DEP
DIETHYL PHOSPHONATE[8 atoms]
A 88.9
/41.5
9
/9
CTRA_BOVIN GAMMA-CHYMOTRYPSIN
4q2k[1] G 5BF
(11S)-4,9-dioxo-N-[(2S)-1-oxo-3-phenylpropan-2-yl]..
C 70.6
/41.2
17
/17
CTRA_BOVIN Chymotrypsinogen A
4q2k[1] F 5BF
(11S)-4,9-dioxo-N-[(2S)-1-oxo-3-phenylpropan-2-yl]..
C 0.0
/41.2
5
/5
CTRA_BOVIN Chymotrypsinogen A
5eg4[1] E 5N7
(13S,16R)-N-(4-carbamimidoylbenzyl)-16-((N-cyclohe..
A 82.4
/41.0
17
/17
TRY1_BOVIN Cationic trypsin
3a80[1] C O15
(E)-2-(4-carbamimidoylbenzylideneaminooxy)-2-methy..
A 85.7
/41.0
14
/14
TRY1_BOVIN Cationic trypsin
6b6p[3] F XYP
beta-D-xylopyranose[10 atoms]
A 25.0
/41.0
4
/4
TRY1_BOVIN Cationic trypsin
6avl[1] E XYP
beta-D-xylopyranose[10 atoms]
A 50.0
/41.0
8
/8
TRY1_BOVIN Cationic trypsin
6b6p[5] G XYS
alpha-D-xylopyranose[10 atoms]
A 33.3
/41.0
3
/3
TRY1_BOVIN Cationic trypsin
1oyq[1] D T87
[(1-{2[(4-CARBAMIMIDOYL-PHENYLAMINO)-METHYL]-1-MET..
A 76.5
/41.0
17
/17
TRY1_BOVIN Trypsin, cationic
3rxe[66] F BEN
BENZAMIDINE[9 atoms]
A 90.9
/41.0
11
/11
TRY1_BOVIN Cationic trypsin
1zhr[11] B BEN
BENZAMIDINE[9 atoms]
A 83.3
/43.7
12
/12
FA11_HUMAN coagulation factor XI
2oq5[1] B BEN
BENZAMIDINE[9 atoms]
A 75.0
/42.9
12
/12
TM11E_HUMAN Transmembrane protease, serine 11E
1bit[1] E BEN
BENZAMIDINE[9 atoms]
A 14.3
/41.2
7
/7
TRYPSIN
1az8[1] B IN4
+/-METHYL 4-(AMINOIMINOMETHYL)-BETA-[3- INH (AMINO..
A 65.0
/41.0
20
/20
TRY1_BOVIN TRYPSIN
6yiw[3] J F05
1H-isoindol-3-amine[10 atoms]
A 91.7
/41.0
12
/12
TRY1_BOVIN Cationic trypsin
3rxi[1] G TSS
2-(1H-INDOL-3-YL)ETHANAMINE[12 atoms]
A 100.0
/41.0
11
/11
TRY1_BOVIN Cationic trypsin
3t27[1] F BET
TRIMETHYL GLYCINE[8 atoms]
A 100.0
/41.0
1
/1
TRY1_BOVIN Cationic trypsin
3t27[1] H BET
TRIMETHYL GLYCINE[8 atoms]
A 33.3
/41.0
6
/6
TRY1_BOVIN Cationic trypsin
3t27[1] E BET
TRIMETHYL GLYCINE[8 atoms]
A 83.3
/41.0
6
/6
TRY1_BOVIN Cationic trypsin
3t27[1] G BET
TRIMETHYL GLYCINE[8 atoms]
A 33.3
/41.0
3
/3
TRY1_BOVIN Cationic trypsin
5mo1[2] C UFZ
(phenylmethyl)azanium[11 atoms]
A 90.9
/41.0
11
/11
TRY1_BOVIN Cationic trypsin
3ljj[2] B 10U
(S)-N-(4-carbamimidoylbenzyl)-1-(2-(cyclopentylami..
A 81.2
/41.0
16
/16
TRY1_BOVIN Cationic trypsin
4abh[1] I 7Z3
1-(3-PYRROLIDIN-1-YLPHENYL)METHANAMINE[13 atoms]
A 90.9
/41.0
11
/11
TRY1_BOVIN CATIONIC TRYPSIN
1k1o[1] C IGN
{[(1R)-2-((2S)-2-{[(3-{[AMINO(IMINO)METHYL]AMINO}P..
A 86.7
/41.0
15
/15
TRY1_BOVIN TRYPSIN
5mos[3] C D86
[azanyl(piperidin-1-yl)methylidene]azanium[13 atom..
A 91.7
/41.0
12
/12
TRY1_BOVIN Cationic trypsin
1qcp[1] C RWJ
CYCLOPENTANECARBOXYLIC ACID [1-(BENZOTHIAZOLE-2-CA..
A 93.3
/41.0
15
/15
TRY1_BOVIN PROTEIN (BETA-TRYPSIN PROTEIN)
4mtb[1] C BZY
(2R)-2-amino-N-{(2S)-1-[(4-carbamimidoylbenzyl)ami..
A 76.5
/41.0
17
/17
TRY1_BOVIN Cationic trypsin
1tyn[1] B CTA
CYCLOTHEONAMIDE A[53 atoms]
A 77.8
/41.0
18
/18
TRY1_BOVIN BETA-TRYPSIN
3a7z[1] D O14
(E)-4-((1-methylpiperidin-4-yloxyimino)methyl)benz..
A 90.9
/41.0
11
/11
TRY1_BOVIN Cationic trypsin
3a7y[1] D O13
(E)-4-((1-methylpiperidin-3-yloxyimino)methyl)benz..
A 92.3
/41.0
13
/13
TRY1_BOVIN Cationic trypsin
3rxb[1] G ALG
4-carbamimidamidobutanoic acid[10 atoms]
A 90.9
/41.0
11
/11
TRY1_BOVIN Cationic trypsin
1xuf[1] C BAZ
BIS(5-AMIDINO-BENZIMIDAZOLYL)METHANE ZINC[26 atoms..
A 87.5
/41.0
16
/16
TRY1_BOVIN TRYPSIN
1xug[4] D BAB
BIS(5-AMIDINO-BENZIMIDAZOLYL)METHANE[25 atoms]
A 84.6
/41.0
13
/13
TRY1_BOVIN TRYPSIN
1xuh[2] E BAO
BIS(5-AMIDINO-2-BENZIMIDAZOLYL)METHANONE[26 atoms]..
A 92.3
/41.0
13
/13
TRY1_BOVIN TRYPSIN
2anw[2] B BAM
BENZAMIDINE[9 atoms]
A 83.3
/44.0
12
/12
KLKB1_HUMAN plasma kallikrein, light chain
5mnh[13] E BAM
BENZAMIDINE[9 atoms]
A 90.9
/41.0
11
/11
TRY1_BOVIN Cationic trypsin
5pb1[1] M BAM
BENZAMIDINE[9 atoms]
B 83.3
/40.1
12
/12
FA7_HUMAN Coagulation factor VII heavy chain
1hj8[1] C BAM
BENZAMIDINE[9 atoms]
A 50.0
/41.6
2
/2
TRY1_SALSA TRYPSIN I
6i44[1] C BAM
BENZAMIDINE[9 atoms]
A 81.8
/44.2
11
/11
KLKB1_HUMAN Plasma kallikrein
7bs8[1] C BAM
BENZAMIDINE[9 atoms]
A 0.0
/41.0
2
/2
TRY1_BOVIN Cationic trypsin
1c2h[5] G BAK
BIS(5-AMIDINO-2-BENZIMIDAZOLYL)METHANE KETONE[26 a..
A 92.3
/41.0
13
/13
TRY1_BOVIN TRYPSIN
1c2g[2] G BAH
BIS(5-AMIDINO-2-BENZIMIDAZOLYL)METHANE KETONE HYDR..
A 86.7
/41.0
15
/15
TRY1_BOVIN TRYPSIN
1c1q[3] E BAI
(5-AMIDINO-2-BENZIMIDAZOLYL)(2-BENZIMIDAZOLYL)METH..
A 90.9
/41.0
11
/11
TRY1_BOVIN TRYPSIN
2ayw[1] C ONO
2-[2-({[4-(DIAMINOMETHYL)PHENYL]AMINO}CARBONYL)-6-..
A 81.2
/41.0
16
/17
TRY1_BOVIN Cationic trypsin
2ayw[1] D ONO
2-[2-({[4-(DIAMINOMETHYL)PHENYL]AMINO}CARBONYL)-6-..
A 44.4
/41.0
9
/9
TRY1_BOVIN Cationic trypsin
1c2k[1] F ABI
5-AMIDINO-BENZIMIDAZOLE[12 atoms]
A 91.7
/41.0
12
/12
TRY1_BOVIN TRYPSIN
1qbo[1] D 711
7-[[6-[[1-(1-IMINOETHYL)PIPERIDIN-4-YL]OXY]-2-METH..
A 80.0
/41.0
15
/15
TRY1_BOVIN PROTEIN (TRYPSIN)
2g5n[1] D 23M
2-(3-METHYLPHENYL)-1H-INDOLE-5-CARBOXIMIDAMIDE[19 ..
A 100.0
/41.0
12
/12
TRY1_BOVIN Cationic trypsin
3gy3[1] C PNT
1,5-BIS(4-AMIDINOPHENOXY)PENTANE[25 atoms]
A 81.2
/41.0
16
/16
TRY1_BOVIN Cationic trypsin
1qbn[1] D 688
2-[AMINO(IMINO)METHYL]-2-HYDROXYPHENOXY]-6-[3-(4,5..
A 78.6
/41.0
14
/14
TRY1_BOVIN PROTEIN (TRYPSIN)
2otv[1] D NCA
NICOTINAMIDE[9 atoms]
A 90.9
/41.0
11
/11
TRY1_BOVIN Cationic trypsin
1ppc[1] B MID
1-[N-(naphthalen-2-ylsulfonyl)glycyl-4-carbamimido..
A 87.5
/41.0
16
/16
TRY1_BOVIN TRYPSIN
1o5e[1] C 132
6-CHLORO-2-(2-HYDROXY-BIPHENYL-3-YL)-1H-INDOLE-5-C..
B 82.4
/43.2
17
/17
HEPS_HUMAN Serine protease hepsin
1gj6[1] C 132
6-CHLORO-2-(2-HYDROXY-BIPHENYL-3-YL)-1H-INDOLE-5-C..
A 88.2
/41.0
17
/17
TRY1_BOVIN BETA-TRYPSIN
6yza[1] C TP5
THIOPHENE-3-CARBOXIMIDAMIDE[8 atoms]
A 91.7
/41.0
12
/12
TRY1_BOVIN Cationic trypsin
5mno[3] E MRZ
piperidine-1-carboximidamide[9 atoms]
A 90.9
/41.0
11
/11
TRY1_BOVIN Cationic trypsin
5f8x[4] K MRZ
piperidine-1-carboximidamide[9 atoms]
A 90.0
/44.0
10
/10
KLKB1_HUMAN Plasma kallikrein
3a8a[2] F 4FZ
4-formylbenzenecarboximidamide[11 atoms]
A 90.9
/41.0
11
/11
TRY1_BOVIN Cationic trypsin
2j9n[1] G IPH
PHENOL[7 atoms]
A 0.0
/41.0
2
/3
TRY1_BOVIN CATIONIC TRYPSIN
1nc6[1] D ABB
(2S,4R)-1-ACETYL-N-[(1S)-4-[(AMINOIMINOMETHYL)AMIN..
A 87.5
/41.0
16
/16
TRY1_BOVIN Trypsinogen
5mnb[5] E 2AP
2-AMINOPYRIDINE[7 atoms]
A 90.9
/41.0
11
/11
TRY1_BOVIN Cationic trypsin
1gi1[3] D BMZ
2-(2-HYDROXY-PHENYL)-1H-BENZOIMIDAZOLE-5-CARBOXAMI..
A 91.7
/41.0
12
/12
TRY1_BOVIN BETA-TRYPSIN
5moo[2] C WOT
phenylazanium[10 atoms]
A 90.9
/41.0
11
/11
TRY1_BOVIN Cationic trypsin
5mnq[1] H J3I
(2~{S})-1-[(2~{R})-2-azanyl-3-phenyl-propanoyl]-~{..
A 81.2
/41.0
16
/16
TRY1_BOVIN Cationic trypsin
6qih[1] B J3T
[4-[(4~{S})-4-oxidanyl-5-oxidanylidene-1,3,2-dioxa..
A 83.3
/41.0
18
/18
TRY1_BOVIN Cationic trypsin
3rxk[1] H SZ8
methyl (4R)-4-amino-1-methyl-L-prolinate[11 atoms]..
A 91.7
/41.0
12
/12
TRY1_BOVIN Cationic trypsin
3rxl[1] G SZ9
1-(2,5-dimethylfuran-3-yl)methanamine[9 atoms]
A 90.0
/41.0
10
/10
TRY1_BOVIN Cationic trypsin
3rxg[1] I SZ3
trans-4-aminocyclohexanol[8 atoms]
A 90.0
/41.0
10
/10
TRY1_BOVIN Cationic trypsin
3rxa[2] H SZ1
cycloheptanamine[8 atoms]
A 90.9
/41.0
11
/11
TRY1_BOVIN Cationic trypsin
3rxs[4] G SZ4
1-(3-methoxyphenyl)methanamine[10 atoms]
A 90.0
/41.0
10
/10
TRY1_BOVIN Cationic trypsin
3aau[1] B GZC
N,N'''-{ethane-1,2-diylbis[nitrilo(E)methylylidene..
A 80.0
/41.0
15
/15
TRY1_BOVIN Cationic trypsin
4abf[1] H 513
1-(5-BROMO-1-BENZOTHIOPHEN-3-YL)METHANAMINE[12 ato..
A 91.7
/41.0
12
/12
TRY1_BOVIN CATIONIC TRYPSIN
1qb6[1] D 623
3,3'-[3,5-DIFLUORO-4-METHYL-2,6-PYRIDYLENEBIS(OXY)..
A 78.6
/41.0
14
/14
TRY1_BOVIN PROTEIN (TRYPSIN)
1yyy[1] C 0KV
2-{(3S)-3-[(benzylsulfonyl)amino]-2-oxopiperidin-1..
A 93.3
/41.0
15
/15
TRY1_BOVIN TRYPSIN
3rxf[1] I 4AP
4-AMINOPYRIDINE[7 atoms]
A 88.9
/41.0
9
/9
TRY1_BOVIN Cationic trypsin
1y5b[1] E TL3
2,5-BIS-O-{4-[AMINO(IMINO)METHYL]PHENYL}-1,4:3,6-D..
A 85.7
/41.0
14
/14
TRY1_BOVIN Trypsin, cationic
1y5a[1] D TL2
2-O-{4-[AMINO(IMINO)METHYL]PHENYL}-5-O-{3-[AMINO(I..
A 71.4
/41.0
14
/14
TRY1_BOVIN Trypsin, cationic
1y59[1] D TL1
2,5-BIS-O-{3-[AMINO(IMINO)METHYL]PHENYL}-1,4:3,6-D..
A 71.4
/41.0
14
/14
TRY1_BOVIN Trypsin, cationic
1qb1[1] C 974
1-[2-[5-[AMINO(IMINO)METHYL]-2-HYDROXYPHENOXY]-6-[..
A 81.2
/41.0
16
/16
TRY1_BOVIN PROTEIN (TRYPSIN)
1o2p[1] E 972
2-{5-[AMINO(IMINIO)METHYL]-6-CHLORO-1H-BENZIMIDAZO..
A 94.1
/41.0
17
/17
TRY1_BOVIN BETA-TRYPSIN
3nk8[1] G JKZ
4-(trifluoromethyl)-1,5,6,7-tetrahydro-2H-cyclopen..
A 92.3
/41.0
13
/13
TRY1_BOVIN Cationic trypsin
1y5u[1] E TL4
2-O-{3-[AMINO(IMINO)METHYL]PHENYL}-5-O-{4-[AMINO(I..
A 73.3
/41.0
15
/15
TRY1_BOVIN Trypsin, cationic
1o2j[2] E 656
2-{5-[AMINO(IMINIO)METHYL]-1H-BENZIMIDAZOL-2-YL}-6..
A 91.7
/41.0
12
/12
TRY1_BOVIN BETA-TRYPSIN
1o2i[1] D 655
2-{5-[AMINO(IMINIO)METHYL]-1H-BENZIMIDAZOL-2-YL}-6..
A 85.7
/41.0
14
/14
TRY1_BOVIN BETA-TRYPSIN
1ql7[1] D ZEN
[4-(6-CHLORO-NAPHTHALENE-2-SULFONYL)-PIPERAZIN-1-Y..
A 82.4
/41.0
17
/17
TRY1_BOVIN TRYPSIN
1eb2[1] D BPO
3-[(Z)-AMINO(IMINO)METHYL]-N-[2-(4-BENZOYL-1-PIPER..
A 80.0
/41.0
15
/15
TRY1_BOVIN TRYPSIN
3a7w[1] E O04
(E)-4-((tetrahydro-2H-pyran-2-yloxyimino)methyl)be..
A 91.7
/41.0
12
/12
TRY1_BOVIN Cationic trypsin
7bs4[2] C F5U
2-(5-methoxy-1H-indol-3-yl)ethanamine[14 atoms]
A 100.0
/41.0
10
/10
TRY1_BOVIN Cationic trypsin
7bs4[1] H F5U
2-(5-methoxy-1H-indol-3-yl)ethanamine[14 atoms]
A 50.0
/41.0
6
/6
TRY1_BOVIN Cationic trypsin
7bs3[1] C F5R
4-bromanylbenzenecarboximidamide[10 atoms]
A 90.9
/41.0
11
/11
TRY1_BOVIN Cationic trypsin
3a8d[7] H O09
(E)-2-(4-carbamimidoylbenzylideneaminooxy)acetic a..
A 92.3
/41.0
13
/13
TRY1_BOVIN Cationic trypsin
7bs5[2] C F5X
2-(6-methoxy-1H-indol-3-yl)ethanamine[14 atoms]
A 91.7
/41.0
12
/12
TRY1_BOVIN Cationic trypsin
2fww[4] G C1R
4-PIPERIDINEBUTYRATE[11 atoms]
C 92.3
/40.3
13
/13
TRYB2_HUMAN Tryptase beta-2
2fx4[1] C C1R
4-PIPERIDINEBUTYRATE[11 atoms]
A 92.9
/41.0
14
/14
TRY1_BOVIN trypsin
6yix[2] D 8M2
[azanyl(thiophen-3-yl)methylidene]azanium[8 atoms]..
A 91.7
/41.0
12
/12
TRY1_BOVIN Cationic trypsin
1qb9[1] E 806
7-[[2-[[1-(1-IMINOETHYL)PIPERIDIN-4-YL]OXY]-9H-CAR..
A 73.3
/41.0
15
/15
TRY1_BOVIN PROTEIN (TRYPSIN)
4aba[2] L SW1
1-[2-(thiophen-2-yl)-1,3-thiazol-4-yl]methanamine[..
A 90.0
/41.0
10
/10
TRY1_BOVIN CATIONIC TRYPSIN
3rxp[1] H SW3
1-(1,5-dimethyl-1H-pyrazol-3-yl)methanamine[9 atom..
A 90.0
/41.0
10
/10
TRY1_BOVIN Cationic trypsin
4abd[2] H SW2
1-[3-(1H-pyrrol-1-yl)phenyl]methanamine[13 atoms]
A 90.9
/41.0
11
/11
TRY1_BOVIN CATIONIC TRYPSIN
1o30[1] D 693
2-(5-{5-[AMINO(IMINIO)METHYL]-1H-BENZIMIDAZOL-2-YL..
A 87.5
/41.0
16
/16
TRY1_BOVIN BETA-TRYPSIN
1o3e[2] D 696
3-{5-[AMINO(IMINIO)METHYL]-1H-INDOL-2-YL}-1,1'-BIP..
A 86.7
/41.0
15
/15
TRY1_BOVIN BETA-TRYPSIN
3vpk[1] B GHS
6-carbamimidamidohexanoic acid[11 atoms]
A 92.9
/41.0
14
/14
TRY1_BOVIN Cationic trypsin
3rxh[1] H HSM
HISTAMINE[8 atoms]
A 88.9
/41.0
9
/9
TRY1_BOVIN Cationic trypsin
1bjv[1] F GP8
1-(2-AMIDINOPHENYL)-3-(PHENOXYPHENYL)UREA[26 atoms..
A 92.9
/41.0
14
/14
TRY1_BOVIN BETA-TRYPSIN
2zfs[2] C 12U
N-cycloheptylglycyl-N-(4-carbamimidoylbenzyl)-L-pr..
A 76.5
/41.0
17
/17
TRY1_BOVIN Cationic trypsin
1bju[1] D GP6
1-(4-AMIDINOPHENYL)-3-(4-CHLOROPHENYL)UREA[20 atom..
A 92.3
/41.0
13
/13
TRY1_BOVIN BETA-TRYPSIN
1o2q[1] D 991
2-{5-[AMINO(IMINIO)METHYL]-6-CHLORO-1H-INDOL-2-YL}..
A 88.9
/41.0
18
/18
TRY1_BOVIN BETA-TRYPSIN
1ghz[1] G 120
2-(2-OXO-1,2-DIHYDRO-PYRIDIN-3-YL)-1H-BENZOIMIDAZO..
A 91.7
/41.0
12
/12
TRY1_BOVIN BETA-TRYPSIN
1gi2[2] D 122
2-(2-HYDROXY-PHENYL)-3H-BENZOIMIDAZOLE-5-CARBOXAMI..
A 91.7
/41.0
12
/12
TRY1_BOVIN BETA-TRYPSIN
1gi5[1] E 123
2-(2-HYDROXY-5-METHOXY-PHENYL)-1H-BENZOIMIDAZOLE-5..
A 92.3
/41.0
13
/13
TRY1_BOVIN BETA-TRYPSIN
1gi6[1] E 124
2-(2-HYDROXY-PHENYL)-1H-INDOLE-5-CARBOXAMIDINE[19 ..
A 92.3
/41.0
13
/13
TRY1_BOVIN BETA-TRYPSIN
4ab8[1] I VXU
3,4-dihydro-2H-1,5-benzodioxepin-6-ylmethanamine[1..
A 90.9
/41.0
11
/11
TRY1_BOVIN CATIONIC TRYPSIN
4ab9[1] G VXQ
1-(2,3-dihydro-1-benzofuran-5-yl)methanamine[11 at..
A 91.7
/41.0
12
/12
TRY1_BOVIN CATIONIC TRYPSIN
1may[2] C ZAP
[N-(BENZYLOXYCARBONYL)AMINO](4-AMIDINOPHENYL)METHA..
A 87.5
/41.0
16
/16
TRY1_BOVIN BETA-TRYPSIN
1o2z[1] C 312
2-(5-{5-[AMINO(IMINIO)METHYL]-1H-BENZIMIDAZOL-2-YL..
A 86.7
/41.0
15
/15
TRY1_BOVIN BETA-TRYPSIN
2zdl[1] D 45U
(S)-N-(4-carbamimidoylbenzyl)-1-(2-(cyclopentyloxy..
A 81.2
/41.0
16
/16
TRY1_BOVIN Cationic trypsin
1pph[1] D 0ZG
3-[(2S)-2-{[(4-methylphenyl)sulfonyl]amino}-3-oxo-..
A 86.7
/41.0
15
/15
TRY1_BOVIN TRYPSIN
3vpk[1] D E4B
ethyl 4-hydroxybenzoate[12 atoms]
A 40.0
/41.0
5
/5
TRY1_BOVIN Cationic trypsin
1o2h[1] C CR3
2-{5-[AMINO(IMINIO)METHYL]-1H-INDOL-2-YL}-6-(CYCLO..
A 85.7
/41.0
14
/14
TRY1_BOVIN BETA-TRYPSIN
1o3b[4] D 780
3-{5-[AMINO(IMINIO)METHYL]-1H-BENZIMIDAZOL-2-YL}-1..
A 92.9
/41.0
14
/14
TRY1_BOVIN BETA-TRYPSIN
1o2t[1] D 783
3-{5-[AMINO(IMINIO)METHYL]-1H-INDOL-2-YL}-5-METHOX..
A 86.7
/41.0
15
/15
TRY1_BOVIN BETA-TRYPSIN
7bs7[1] D ANL
ANILINE[7 atoms]
A 50.0
/41.0
4
/4
TRY1_BOVIN Cationic trypsin
5mna[4] D ANL
ANILINE[7 atoms]
A 90.0
/41.0
10
/10
TRY1_BOVIN Cationic trypsin
7bs7[1] H ANL
ANILINE[7 atoms]
A 33.3
/41.0
3
/3
TRY1_BOVIN Cationic trypsin
3nkk[1] G JLZ
3-fluoro-4-methylbenzenecarboximidamide[11 atoms]
A 91.7
/41.0
12
/12
TRY1_BOVIN Cationic trypsin
1k1i[1] C FD1
N-ALPHA-(2-NAPHTHYLSULFONYL)-N-(3-AMIDINO-L-PHENYL..
A 86.7
/41.0
15
/15
TRY1_BOVIN TRYPSIN
1k1l[1] D FD3
N-ALPHA-(2-NAPHTHYLSULFONYL)-3-AMIDINO-L-PHENYLALA..
A 81.2
/41.0
16
/16
TRY1_BOVIN TRYPSIN
1k1j[1] D FD2
N-ALPHA-(2-NAPHTHYLSULFONYL)-N(3-AMIDINO-L-PHENYLA..
A 83.3
/41.0
18
/18
TRY1_BOVIN TRYPSIN
1k1m[1] D FD4
N-ALPHA-(2-NAPHTHYLSULFONYL)-N(3-AMIDINO-L-PHENYLA..
A 81.2
/41.0
16
/16
TRY1_BOVIN TRYPSIN
5lgo[1] D 6VZ
(2~{S},4~{S})-1-[4-(aminomethyl)-3-methoxy-phenyl]..
A 80.0
/41.0
20
/20
TRY1_BOVIN Cationic trypsin
3aav[2] F A2C
3,3'-[ethane-1,2-diylbis(nitrilomethylylidene)]bis..
B 86.7
/41.0
15
/15
TRY1_BOVIN Cationic trypsin
7brz[2] C F66
2-(2-methyl-1H-indol-3-yl)ethanamine[13 atoms]
A 91.7
/41.0
12
/12
TRY1_BOVIN Cationic trypsin
3aas[1] B GUS
(E)-N-[(5-carbamimidamido-2-hydroxyphenyl)methylid..
A 92.3
/41.0
13
/13
TRY1_BOVIN Cationic trypsin
2zdm[1] C 46U
(S)-N-(4-carbamimidoylbenzyl)-1-(2-(cyclohexyloxy)..
A 76.5
/41.0
17
/17
TRY1_BOVIN Cationic trypsin
1y3y[2] C UIR
(1R,3AS,4R,8AS,8BR)-4-(2-BENZO[1,3]DIOXOL-5-YL-1-C..
A 100.0
/41.0
11
/11
TRY1_BOVIN Trypsin, cationic
7bs2[2] C SRO
SEROTONIN[13 atoms]
A 100.0
/41.0
11
/11
TRY1_BOVIN Cationic trypsin
1rxp[1] D 169
1-(4-TERT-BUTYLCARBAMOYL-PIPERAZINE-1-CARBONYL)-3-..
A 83.3
/41.0
18
/18
TRY1_BOVIN TRYPSIN
1auj[1] C PPB
1-{[1-(2-AMINO-3-PHENYL-PROPIONYL)-PYRROLIDINE-2-C..
A 92.3
/41.0
13
/13
TRY1_BOVIN TRYPSIN
1mts[3] C BX3
(+)-2-[4-[(-1-ACETIMIDOYL-4-PIPERIDINYL)OXY]-3-(7-..
A 75.0
/41.0
16
/16
TRY1_BOVIN TRYPSIN
1o35[1] D 802
2-{5-[AMINO(IMINIO)METHYL]-1H-BENZIMIDAZOL-2-YL}-4..
A 91.7
/41.0
12
/12
TRY1_BOVIN BETA-TRYPSIN
1o33[1] D 801
2-{5-[AMINO(IMINIO)METHYL]-1H-BENZIMIDAZOL-2-YL}PY..
A 92.3
/41.0
13
/13
TRY1_BOVIN BETA-TRYPSIN
1xuj[1] D BOZ
BIS(5-AMIDINO-BENZIMIDAZOLYL)METHANONE ZINC[27 ato..
A 92.9
/41.0
14
/14
TRY1_BOVIN TRYPSIN
1o2n[3] D 762
3-{5-[AMINO(IMINIO)METHYL]-6-CHLORO-1H-BENZIMIDAZO..
A 87.5
/41.0
16
/16
TRY1_BOVIN BETA-TRYPSIN
1k1n[1] C CCR
[N-[N-(4-METHOXY-2,3,6-TRIMETHYLPHENYLSULFONYL)-L-..
A 86.7
/41.0
15
/15
TRY1_BOVIN TRYPSIN
1y3x[1] C UIB
(1R,3AS,4R,8AS,8BR)-4-{5-(PHENYL[1,3]DIOXOL-5-YLME..
A 80.0
/41.0
15
/15
TRY1_BOVIN Trypsinogen, cationic
1y3u[1] C UIQ
(1R,3AS,4R,8AS,8BR)-4-(2-BENZO[1,3]DIOXOL-5-YLMETH..
A 78.6
/41.0
14
/14
TRY1_BOVIN Trypsin, cationic
1y3w[1] C UIP
(1R,3AS,4R,8AS,8BR)-4-(2-BENZO[1,3]DIOXOL-5-YLMETH..
A 80.0
/41.0
15
/15
TRY1_BOVIN Trypsinogen, cationic
1yp9[1] C UIZ
(1R,3AS,4R,8AS,8BR)-4-(2-BENZO[1,3]DIOXOL-5-YLMETH..
A 75.0
/41.0
16
/16
TRY1_BOVIN Cationic trypsin
1tx7[1] C 4CM
(4-CARBAMIMIDOYLPHENYL)-METHYL-PHOSPHINIC ACID[13 ..
A 100.0
/41.0
11
/11
TRY1_BOVIN Trypsinogen
3m35[1] B M35
1-[3-(aminomethyl)phenyl]-N-[3-fluoro-2'-(methylsu..
A 75.0
/41.0
16
/16
TRY1_BOVIN Cationic trypsin
3a89[4] F H06
(E)-4-((2-nicotinoylhydrazono)methyl)benzimidamide..
A 90.9
/41.0
11
/11
TRY1_BOVIN Cationic trypsin
6yzc[1] C AMH
TRANS-4-AMINOMETHYLCYCLOHEXANE-1-CARBOXYLIC ACID[1..
A 100.0
/41.0
10
/10
TRY1_BOVIN Cationic trypsin
1g36[1] D R11
4-{[1-METHYL-5-(2-METHYL-BENZOIMIDAZOL-1-YLMETHYL)..
A 81.2
/41.0
16
/16
TRY1_BOVIN TRYPSINOGEN, CATIONIC
4abe[1] J 913
(3-PYRAZOL-1-YLPHENYL)METHANAMINE[13 atoms]
A 91.7
/41.0
12
/12
TRY1_BOVIN CATIONIC TRYPSIN
2zq2[1] C 13U
N-cyclooctylglycyl-N-(4-carbamimidoylbenzyl)-L-pro..
A 76.5
/41.0
17
/17
TRY1_BOVIN Cationic trypsin
4abg[1] K 91B
1-[3-(4-METHYLPIPERAZIN-1-YL)PHENYL]METHANAMINE[15..
A 90.9
/41.0
11
/11
TRY1_BOVIN CATIONIC TRYPSIN
1tx8[1] C AM4
4-(METHYLSULFONYL)BENZENECARBOXIMIDAMIDE[13 atoms]..
A 100.0
/41.0
11
/11
TRY1_BOVIN Trypsinogen
7bsa[2] C 6SO
2-(5-chloranyl-1~{H}-indol-3-yl)ethanamine[13 atom..
A 100.0
/41.0
11
/11
TRY1_BOVIN Cationic trypsin
1o2v[5] D 847
2-(3-{5-[AMINO(IMINIO)METHYL]-1H-BENZIMIDAZOL-2-YL..
A 92.3
/41.0
13
/13
TRY1_BOVIN BETA-TRYPSIN
2g8t[1] D MI2
2-(2-METHYLPHENYL)-1H-INDOLE-5-CARBOXIMIDAMIDE[19 ..
A 92.3
/41.0
13
/13
TRY1_BOVIN Cationic trypsin
2zq1[2] D 11U
(S)-N-(4-carbamimidoylbenzyl)-1-(2-(cyclohexylamin..
A 75.0
/41.0
16
/16
TRY1_BOVIN Cationic trypsin
3a8b[1] L BR6
(E)-4-((4-bromophenylimino)methyl)benzimidamide[18..
A 92.3
/41.0
13
/13
TRY1_BOVIN Cationic trypsin
4abb[1] H K9S
1-(1-BENZOTHIOPHEN-3-YL)METHANAMINE[11 atoms]
A 90.9
/41.0
11
/11
TRY1_BOVIN CATIONIC TRYPSIN
2g5v[1] C 22M
2-(2-METHYLPHENYL)-1H-INDOLE-6-CARBOXIMIDAMIDE[19 ..
A 91.7
/41.0
12
/12
TRY1_BOVIN Cationic trypsin
3iti[1] B BRV
5-amino-2,4,6-tribromobenzene-1,3-dicarboxylic aci..
A 12.5
/41.0
8
/8
TRY1_BOVIN Cationic trypsin
3gy6[4] C BRN
BERENIL[21 atoms]
A 91.7
/41.0
12
/12
TRY1_BOVIN Cationic trypsin
1mtw[1] C DX9
(2S)-3-(7-carbamimidoylnaphthalen-2-yl)-2-[4-({(3R..
A 75.0
/41.0
16
/16
TRY1_BOVIN TRYPSIN
6yiu[1] C 3AB
3-aminobenzamide[10 atoms]
A 90.9
/41.0
11
/11
TRY1_BOVIN Cationic trypsin
5lh4[1] F 6W4
(2~{S},4~{S})-1-[4-(aminomethyl)phenyl]carbonyl-4-..
A 81.8
/41.0
22
/22
TRY1_BOVIN Cationic trypsin
1o2o[1] D 950
2-{5-[AMINO(IMINIO)METHYL]-6-FLUORO-1H-BENZIMIDAZO..
A 93.3
/41.0
15
/15
TRY1_BOVIN BETA-TRYPSIN
3a7v[1] E 3FZ
3-formylbenzenecarboximidamide[11 atoms]
A 91.7
/41.0
12
/12
TRY1_BOVIN Cationic trypsin
1c5t[2] C ESP
THIENO[2,3-B]PYRIDINE-2-CARBOXAMIDINE[12 atoms]
A 91.7
/41.0
12
/12
TRY1_BOVIN PROTEIN (TRYPSIN)
1c5s[1] I ESX
BENZO[B]THIOPHENE-2-CARBOXAMIDINE[12 atoms]
A 91.7
/41.0
12
/12
TRY1_BOVIN PROTEIN (TRYPSIN)
5lh8[1] E 6WH
(2~{S},4~{S})-1-[4-(aminomethyl)-3-methoxy-phenyl]..
A 83.3
/41.0
18
/19
TRY1_BOVIN Cationic trypsin
1c5r[2] F ESI
4-IODOBENZO[B]THIOPHENE-2-CARBOXAMIDINE[13 atoms]
A 91.7
/41.0
12
/12
TRY1_BOVIN PROTEIN (TRYPSIN)
1k1p[1] C MEL
[((1R)-2-{(2S)-2-[({4-[AMINO(IMINO)METHYL]BENZYL}A..
A 75.0
/41.0
16
/16
TRY1_BOVIN TRYPSIN
6zfk[1] H 479
4-oxo-N-[(1S)-1-(pyridin-3-yl)ethyl]-4-(thiophen-2..
A 28.6
/41.0
7
/7
TRY1_BOVIN Cationic trypsin
6zfk[1] I 479
4-oxo-N-[(1S)-1-(pyridin-3-yl)ethyl]-4-(thiophen-2..
A 77.8
/41.0
9
/9
TRY1_BOVIN Cationic trypsin
1w7x[2] F 413
(S)-[(R)-2-(4-BENZYLOXY-3-METHOXY-PHENYL)-2-(4-CAR..
A 65.0
/39.9
20
/20
FA7_HUMAN BLOOD COAGULATION FACTOR VIIA
5pao[1] K 7Z7
(2S)-2,3-dihydroxy-N-[[3-[5-hydroxy-4-(1H-pyrrolo[..
B 78.6
/40.4
14
/14
FA7_HUMAN Coagulation factor VII heavy chain
5pae[1] F 7YA
(2S)-2-hydroxy-N-[[3-[5-hydroxy-4-(1H-pyrrolo[3,2-..
B 78.6
/40.4
14
/14
FA7_HUMAN Coagulation factor VII heavy chain
5pb5[1] D 9RY
N-({3-[5-hydroxy-4-(7H-pyrrolo[2,3-d]pyrimidin-6-y..
B 71.4
/40.4
14
/14
FA7_HUMAN Coagulation factor VII heavy chain
5pab[1] C 7XD
1-[[3-[2-oxidanyl-3-(1~{H}-pyrrolo[3,2-c]pyridin-2..
A 68.8
/40.4
16
/16
FA7_HUMAN Coagulation factor VII heavy chain
6x5p[1] C UQD
3-chloro-4-{[5-hydroxy-6-(4-methylphenyl)pyrimidin..
A 80.0
/40.4
15
/17
FA9_HUMAN Coagulation factor IX
2fs9[4] F C4A
ETHYL {(1S)-5-AMINO-1-[(5-{4-[(2,3-DIHYDRO-1H-INDE..
B 70.0
/40.3
20
/20
TRYB2_HUMAN Tryptase beta-2
3v7t[4] I 0GX
{(3-exo)-3-[5-(aminomethyl)-2-fluorophenyl]-8-azab..
C 76.9
/40.3
13
/13
Q6NZY1_HUMAN TPSB2 protein
3v7t[4] G 0GX
{(3-exo)-3-[5-(aminomethyl)-2-fluorophenyl]-8-azab..
D 0.0
/40.3
3
/3
Q6NZY1_HUMAN TPSB2 protein
2fxr[8] H C3A
ALLYL {(1S)-1-[(5-{4-[(2,3-DIHYDRO-1H-INDEN-2-YLAM..
D 75.0
/40.3
20
/20
TRYB2_HUMAN Tryptase beta-2
1a0l[4] E APA
(2S)-3-(4-carbamimidoylphenyl)-2-hydroxypropanoic ..
A 85.7
/40.3
14
/14
TRYB2_HUMAN BETA-TRYPTASE
4mpw[4] F 2AJ
[(1,1,3,3-tetramethyldisiloxane-1,3-diyl)di-1-benz..
A 71.4
/40.3
14
/14
TRYB1_HUMAN Tryptase alpha/beta-1
4mpx[4] G 2AV
[(1,1,3,3-tetramethyldisiloxane-1,3-diyl)di-1-benz..
A 71.4
/40.3
14
/14
TRYB1_HUMAN Tryptase alpha/beta-1
2za5[4] H 2FF
(5-(aminomethyl)-2H-spiro[benzofuran-3,4'-piperidi..
D 75.0
/40.3
16
/16
Q6B052_HUMAN Tryptase beta 2
2za5[4] G 2FF
(5-(aminomethyl)-2H-spiro[benzofuran-3,4'-piperidi..
A 0.0
/40.3
3
/3
Q6B052_HUMAN Tryptase beta 2
4mpv[4] C 2A4
(2R,4S)-N,N'-bis[3-({4-[3-(aminomethyl)phenyl]pipe..
B 69.2
/40.3
13
/13
TRYB1_HUMAN Tryptase alpha/beta-1
2fx6[2] C 270
2H-BENZOIMIDAZOL-2-YLAMINE[10 atoms]
A 91.7
/41.0
12
/12
TRY1_BOVIN Trypsin
2fpz[4] E 270
2H-BENZOIMIDAZOL-2-YLAMINE[10 atoms]
A 90.9
/40.3
11
/11
TRYB2_HUMAN Tryptase beta-2
4mpu[4] F X2A
(6S,8R)-N,N'-bis[3-({4-[3-(aminomethyl)phenyl]pipe..
B 71.4
/40.3
14
/14
TRYB1_HUMAN Tryptase alpha/beta-1
2gdd[4] G 5AM
BENZYL {(1S)-5-AMINO-1-[(S)-HYDROXY(5-{[4-(4-PHENY..
C 72.7
/40.3
22
/22
TRYB2_HUMAN Tryptase beta-2
2zeb[4] G 11M
1-(1'-{[3-(methylsulfanyl)-2-benzothiophen-1-yl]ca..
C 75.0
/40.3
12
/12
Q6B052_HUMAN Tryptase beta 2
2zeb[4] G 11M
1-(1'-{[3-(methylsulfanyl)-2-benzothiophen-1-yl]ca..
A 0.0
/40.3
2
/2
Q6B052_HUMAN Tryptase beta 2
2zec[4] F 11N
1-[1'-(3-phenylacryloyl)spiro[1-benzofuran-3,4'-pi..
B 76.9
/40.3
13
/13
Q6B052_HUMAN Tryptase beta 2
2zec[4] F 11N
1-[1'-(3-phenylacryloyl)spiro[1-benzofuran-3,4'-pi..
D 0.0
/40.3
2
/2
Q6B052_HUMAN Tryptase beta 2
6p0p[1] C Y35
(3'-{4-[3-(aminomethyl)phenyl]piperidine-1-carbony..
A 76.9
/40.3
13
/13
TRYB1_HUMAN Tryptase alpha/beta-1
2bm2[4] E PM2
1-[3-(1-{[5-(2-PHENYLETHYL)PYRIDIN-3-YL]CARBONYL}P..
C 0.0
/40.3
4
/4
TRYB2_HUMAN HUMAN BETA2 TRYPTASE
2bm2[4] E PM2
1-[3-(1-{[5-(2-PHENYLETHYL)PYRIDIN-3-YL]CARBONYL}P..
A 76.9
/40.3
13
/13
TRYB2_HUMAN HUMAN BETA2 TRYPTASE
4a6l[4] H P43
1-{3-[1-({5-[(2-fluorophenyl)ethynyl]furan-2-yl}ca..
B 0.0
/40.3
3
/3
TRYB1_HUMAN TRYPTASE ALPHA/BETA-1
4a6l[4] H P43
1-{3-[1-({5-[(2-fluorophenyl)ethynyl]furan-2-yl}ca..
D 71.4
/40.3
14
/14
TRYB1_HUMAN TRYPTASE ALPHA/BETA-1
4mqa[4] F X00
{(1,1,3,3-tetramethyldisiloxane-1,3-diyl)bis[5-(me..
B 71.4
/40.3
14
/14
TRYB1_HUMAN Tryptase alpha/beta-1
5f03[2] C 5TA
(5~{S})-5-[[3-(aminomethyl)phenoxy]methyl]-3-[3-[2..
A 75.0
/40.3
16
/16
TRYB2_HUMAN Tryptase beta-2
6x5l[1] C UQG
4-{[5-hydroxy-6-(4-methylphenyl)pyrimidin-4-yl]ami..
A 92.9
/40.2
14
/16
FA9_HUMAN Coagulation factor IX
4x8u[1] C 3ZB
5-chloro-1H-indole-2-carboxylic acid[13 atoms]
A 81.8
/40.2
11
/11
FA7_HUMAN Factor VIIa (Heavy Chain)
5u6j[1] C 82J
3-{[(2R)-17-ethyl-4-methyl-3,12-dioxo-7-[(propan-2..
A 68.2
/40.2
22
/22
FA7_HUMAN Coagulation factor VII Heavy Chain
5l30[1] C 70A
(2R,15R)-2-[(1-aminoisoquinolin-6-yl)amino]-4,15,1..
A 68.4
/40.2
19
/19
FA7_HUMAN Coagulation factor VII (Heavy Chain)
4x8s[1] C 3Z7
4-bromo-2-methoxyphenol[10 atoms]
A 85.7
/40.1
14
/14
FA7_HUMAN Factor VIIa (Heavy Chain)
5pav[1] N 7ZM
N-(6-aminopyridin-3-yl)-5-hydroxy-1-phenylpyrazole..
B 78.6
/40.1
14
/14
FA7_HUMAN Coagulation factor VII heavy chain
6vvu[4] R 0GJ
L-alpha-glutamyl-N-{(1S)-4-{[amino(iminio)methyl]a..
C 92.9
/40.3
14
/14
TRYB1_HUMAN Tryptase alpha/beta-1
2b8o[5] M 0GJ
L-alpha-glutamyl-N-{(1S)-4-{[amino(iminio)methyl]a..
B 78.6
/40.1
14
/14
FA7_HUMAN Coagulation factor VII heavy chain
5jb8[2] D 0GJ
L-alpha-glutamyl-N-{(1S)-4-{[amino(iminio)methyl]a..
B 86.7
/40.4
15
/15
FA9_HUMAN Coagulation factor IX
1bui[1] D 0GJ
L-alpha-glutamyl-N-{(1S)-4-{[amino(iminio)methyl]a..
A 100.0
/40.1
12
/12
PLMN_HUMAN Plasminogen
5pb6[1] J 9RV
N-({3-[5-hydroxy-4-(1H-pyrrolo[3,2-c]pyridin-2-yl)..
B 78.6
/40.1
14
/14
FA7_HUMAN Coagulation factor VII heavy chain
5ugd[1] B 89S
Nalpha-[trans-4-(aminomethyl)cyclohexane-1-carbony..
A 88.2
/40.1
17
/17
PLMN_HUMAN Plasminogen
5ugg[1] B 89M
Nalpha-[trans-4-(aminomethyl)cyclohexane-1-carbony..
A 93.8
/40.1
16
/16
PLMN_HUMAN Plasminogen
4nga[1] C 2KF
(2R)-2-[(1-aminoisoquinolin-6-yl)amino]-2-[3-ethox..
A 68.2
/40.1
22
/22
FA7_HUMAN Factor VIIa (Heavy Chain)
4jyu[1] C 1OK
(2R)-2-[(1-aminoisoquinolin-6-yl)amino]-2-[3-ethox..
A 68.4
/40.1
19
/19
FA7_HUMAN Factor VII light chain
4jyv[1] C 1OJ
(2R)-2-[3-ethoxy-4-(propan-2-yloxy)phenyl]-2-(isoq..
A 66.7
/40.1
18
/18
FA7_HUMAN Factor VII light chain
2bz6[1] C 346
(R)-(4-CARBAMIMIDOYL-PHENYLAMINO)-[5-ETHOXY-2-FLUO..
A 76.5
/40.1
17
/17
FA7_HUMAN BLOOD COAGULATION FACTOR VIIA
2c4f[1] F GIL
2-{[6-{3-[AMINO(IMINO)METHYL]PHENOXY}-4-(DIISOPROP..
A 68.4
/40.1
19
/19
FA7_HUMAN COAGULATION FACTOR VII PRECURSOR
4na9[1] C 1T7
3'-amino-5'-[(2S,4R)-6-carbamimidoyl-4-phenyl-1,2,..
A 87.5
/40.1
16
/16
FA7_HUMAN Coagulation factor VII heavy chain
1ygc[2] K 905
(R)-4-[2-(3-AMINO-BENZENESULFONYLAMINO)-1-(3,5-DIE..
A 77.8
/40.1
18
/18
FA7_HUMAN Coagulation factor VII
4jzf[1] C 1NL
2-{2-[(3-carbamoylphenyl)carbamoyl]-6-methoxypyrid..
A 70.6
/40.1
17
/17
FA7_HUMAN Factor VIIa (Heavy Chain)
4jzd[1] C 1NJ
2-{2-[(4-carbamimidoylphenyl)carbamoyl]-6-methoxyp..
A 81.2
/40.1
16
/16
FA7_HUMAN Factor VIIa (Heavy Chain)
4yt6[1] C 4JY
4-[[(R)-(5-ethoxy-2-fluoranyl-3-propan-2-yloxy-phe..
A 75.0
/40.1
20
/20
FA7_HUMAN Coagulation factor VII (heavy chain)
4zxx[1] C 4T0
N-{3-[(2R)-1-{(2R)-2-[(1-aminoisoquinolin-6-yl)ami..
A 63.2
/40.1
19
/19
FA7_HUMAN Coagulation factor VIIa heavy chain
1wun[1] O P5B
N-(ETHYLSULFONYL)TRYPTOPHYL-N~1~-{4-[AMINO(IMINO)M..
B 68.2
/40.1
22
/22
FA7_HUMAN Coagulation factor VII