HOMCOS(prot_sch_conbars.cgi):

#WARNING:no index is registered index "YP_009725309.1" in "https://rest.uniprot.org/uniprotkb/" url "https://rest.uniprot.org/uniprotkb/YP_009725309.1.txt".
Please visit the UniProt website(https://www.uniprot.org), and get a proper ID/AC for your query protein.

		Contact Molecules for Homologous Proteins
[Summary Bars]	[SiteTable]	Full Bars[80 %]	[Back to Search Page]	[Back to HOMCOS]
[SupCon3D]	[help]	seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]	[show] [download] [help]

PID

QueryLength

Homolgous Sequence in PDB

UniProt Query

TITLE

5815

527

YP_009725309.1()

QUERYSEQ

AENVTGLFKDCSKVITGLHPTQAPTHLSVDTKFKTEGLCVDIPGIPKDMTYRRLISMMGFKMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVAVPTGYVDTPNNTDFSRVSAKPPPGDQFKHLI
PLMYKGLPWNVVRIKIVQMLSDTLKNLSDRVVFVLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNPFMIDVQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEYPIIG
DELKINAACRKVQHMVVKAALLADKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDKAYKIEELFYSYATHSDKFTDGVCLFWNCNVDRYPANSIVCRFDTRVLSNLNLPGCDGGSLYVNKHAFHTPAFDKSAFVNLKQLPFFYYSDS
PCESHGKQVVSDIDYVPLKSATCITRCNLGGAVCRHHANEYRLYLDAYNMMISAGFSLWVYKQFDTYNLWNTFTRLQ

[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [YP_009725309.1()]

527
	region	name	description
	1-10	DISORDER	predicted by DISOPRED

MONOMER

527

pdb_id a¹ identity[%]² description

7egq P 100.0 R1AB_SARS2 Proofreading exoribonuclease

7eiz I 100.0 R1AB_SARS2 Proofreading exoribonuclease

7egq H 100.0 R1AB_SARS2 Proofreading exoribonuclease

7n0b B 100.0 R1AB_SARS2 Proofreading exoribonuclease

7n0c B 99.8 R1AB_SARS2 Proofreading exoribonuclease

7n0d K 99.8 R1AB_SARS2 Proofreading exoribonuclease

7n0d B 99.8 R1AB_SARS2 Proofreading exoribonuclease

7n0d D 99.8 R1AB_SARS2 Proofreading exoribonuclease

7n0d I 99.8 R1AB_SARS2 Proofreading exoribonuclease

5c8t D 94.9 R1AB_CVHSA Guanine-N7 methyltransferase

5c8s D 94.9 R1AB_CVHSA Guanine-N7 methyltransferase

5c8u B 94.9 R1AB_CVHSA Guanine-N7 methyltransferase

5c8u D 94.9 R1AB_CVHSA Guanine-N7 methyltransferase

5c8t B 94.9 R1AB_CVHSA Guanine-N7 methyltransferase

5c8s B 94.9 R1AB_CVHSA Guanine-N7 methyltransferase

5nfy D 94.7 Q1T6X8_CVHSA Polyprotein 1ab

5nfy C 94.7 Q1T6X8_CVHSA Polyprotein 1ab

5nfy B 94.7 Q1T6X8_CVHSA Polyprotein 1ab

5nfy A 94.7 Q1T6X8_CVHSA Polyprotein 1ab

5slp A 100.0 R1AB_SARS2 Proofreading exoribonuclease nsp14

5sme A 100.0 R1AB_SARS2 Proofreading exoribonuclease nsp14

5smc A 100.0 R1AB_SARS2 Proofreading exoribonuclease nsp14

5sma A 100.0 R1AB_SARS2 Proofreading exoribonuclease nsp14

5slm A 100.0 R1AB_SARS2 Proofreading exoribonuclease nsp14

5slj A 100.0 R1AB_SARS2 Proofreading exoribonuclease nsp14

5sl1 A 100.0 R1AB_SARS2 Proofreading exoribonuclease nsp14

5slf A 100.0 R1AB_SARS2 Proofreading exoribonuclease nsp14

5sl2 A 100.0 R1AB_SARS2 Proofreading exoribonuclease nsp14

5sm9 A 100.0 R1AB_SARS2 Proofreading exoribonuclease nsp14

5sm4 A 100.0 R1AB_SARS2 Proofreading exoribonuclease nsp14

5sm0 A 100.0 R1AB_SARS2 Proofreading exoribonuclease nsp14

5slw A 100.0 R1AB_SARS2 Proofreading exoribonuclease nsp14

5sla A 100.0 R1AB_SARS2 Proofreading exoribonuclease nsp14

5sky A 100.0 R1AB_SARS2 Proofreading exoribonuclease nsp14

5smh A 100.0 R1AB_SARS2 Proofreading exoribonuclease nsp14

5sl4 A 100.0 R1AB_SARS2 Proofreading exoribonuclease nsp14

5smd A 100.0 R1AB_SARS2 Proofreading exoribonuclease nsp14

5smb A 100.0 R1AB_SARS2 Proofreading exoribonuclease nsp14

5sll A 100.0 R1AB_SARS2 Proofreading exoribonuclease nsp14

5slk A 100.0 R1AB_SARS2 Proofreading exoribonuclease nsp14

5slg A 100.0 R1AB_SARS2 Proofreading exoribonuclease nsp14

5sl5 A 100.0 R1AB_SARS2 Proofreading exoribonuclease nsp14

5skx A 100.0 R1AB_SARS2 Proofreading exoribonuclease nsp14

5slz A 100.0 R1AB_SARS2 Proofreading exoribonuclease nsp14

5smk A 100.0 R1AB_SARS2 Proofreading exoribonuclease nsp14

5smi A 100.0 R1AB_SARS2 Proofreading exoribonuclease nsp14

5smg A 100.0 R1AB_SARS2 Proofreading exoribonuclease nsp14

5smf A 100.0 R1AB_SARS2 Proofreading exoribonuclease nsp14

5sls A 100.0 R1AB_SARS2 Proofreading exoribonuclease nsp14

5slr A 100.0 R1AB_SARS2 Proofreading exoribonuclease nsp14

5sld A 100.0 R1AB_SARS2 Proofreading exoribonuclease nsp14

5slc A 100.0 R1AB_SARS2 Proofreading exoribonuclease nsp14

5slb A 100.0 R1AB_SARS2 Proofreading exoribonuclease nsp14

5sl9 A 100.0 R1AB_SARS2 Proofreading exoribonuclease nsp14

5sl3 A 100.0 R1AB_SARS2 Proofreading exoribonuclease nsp14

5sl7 A 100.0 R1AB_SARS2 Proofreading exoribonuclease nsp14

5skw A 100.0 R1AB_SARS2 Proofreading exoribonuclease nsp14

5sm6 A 100.0 R1AB_SARS2 Proofreading exoribonuclease nsp14

5sm5 A 100.0 R1AB_SARS2 Proofreading exoribonuclease nsp14

5sm2 A 100.0 R1AB_SARS2 Proofreading exoribonuclease nsp14

5sm1 A 100.0 R1AB_SARS2 Proofreading exoribonuclease nsp14

5sm8 A 100.0 R1AB_SARS2 Proofreading exoribonuclease nsp14

5slt A 100.0 R1AB_SARS2 Proofreading exoribonuclease nsp14

5slv A 100.0 R1AB_SARS2 Proofreading exoribonuclease nsp14

5slq A 100.0 R1AB_SARS2 Proofreading exoribonuclease nsp14

5sl8 A 100.0 R1AB_SARS2 Proofreading exoribonuclease nsp14

5skz A 100.0 R1AB_SARS2 Proofreading exoribonuclease nsp14

5sm7 A 100.0 R1AB_SARS2 Proofreading exoribonuclease nsp14

5sm3 A 100.0 R1AB_SARS2 Proofreading exoribonuclease nsp14

5sle A 100.0 R1AB_SARS2 Proofreading exoribonuclease nsp14

7qif A 100.0 R1AB_SARS2 Proofreading exoribonuclease nsp14

5slh A 100.0 R1AB_SARS2 Proofreading exoribonuclease nsp14

5sl0 A 100.0 R1AB_SARS2 Proofreading exoribonuclease nsp14

7qgi A 100.0 R1AB_SARS2 Proofreading exoribonuclease nsp14

5sly A 100.0 R1AB_SARS2 Proofreading exoribonuclease nsp14

5slu A 100.0 R1AB_SARS2 Proofreading exoribonuclease nsp14

5sl6 A 100.0 R1AB_SARS2 Proofreading exoribonuclease nsp14

5sli A 100.0 R1AB_SARS2 Proofreading exoribonuclease nsp14

5sln A 100.0 R1AB_SARS2 Proofreading exoribonuclease nsp14

5slx A 100.0 R1AB_SARS2 Proofreading exoribonuclease nsp14

5slo A 100.0 R1AB_SARS2 Proofreading exoribonuclease nsp14

7r2v A 99.5 R1AB_SARS2 Proofreading exoribonuclease nsp14

7r2v B 99.5 R1AB_SARS2 Proofreading exoribonuclease nsp14

7mc5 A 99.7 R1AB_SARS2 Proofreading exoribonuclease

7diy B 100.0 R1AB_SARS2 nsp14-ExoN protein

7mc6 A 99.6 R1AB_SARS2 Proofreading exoribonuclease

7tw8 A 98.9 ETV6_HUMAN R1AB_SARS2 Transcription factor ETV6,Proofreading exoribonuclease nsp14 chimera

8frj A 98.9 ETV6_HUMAN R1AB_SARS2 Transcription factor ETV6,Guanine-N7 methyltransferase nsp14 chimera

7tw7 A 98.9 ETV6_HUMAN R1AB_SARS2 Transcription factor ETV6,Proofreading exoribonuclease nsp14 chimera

7tw9 A 98.9 ETV6_HUMAN R1AB_SARS2 Transcription factor ETV6,Proofreading exoribonuclease nsp14 chimera

8bwu A 97.4 ETV6_HUMAN R1AB_SARS2 Transcription factor ETV6,Proofreading exoribonuclease nsp14

8frk A 98.9 ETV6_HUMAN R1AB_SARS2 Transcription factor ETV6,Guanine-N7 methyltransferase nsp14 chimera

1.a¹:asym_id for the homologue. 2.identity[%]²:sequence identity between the query and the homologue.

HETERO

527 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

7eiz A R1AB_SARS2 RNA-directed RNA polymerase[926 aa] I 100.0
/100.0 5
/5 R1AB_SARS2 Proofreading exoribonuclease

7eiz E R1AB_SARS2 Non-structural protein 9[113 aa] I 100.0
/100.0 3
/3 R1AB_SARS2 Proofreading exoribonuclease

5c8s A R1AB_CVHSA Non-structural protein 10[133 aa] B 98.0
/94.9 49
/49 R1AB_CVHSA Guanine-N7 methyltransferase

5c8s C R1AB_CVHSA Non-structural protein 10[133 aa] D 97.9
/94.9 47
/47 R1AB_CVHSA Guanine-N7 methyltransferase

5c8t A R1AB_CVHSA Non-structural protein 10[133 aa] B 98.0
/94.9 49
/49 R1AB_CVHSA Guanine-N7 methyltransferase

5c8t C R1AB_CVHSA Non-structural protein 10[133 aa] D 97.9
/94.9 48
/48 R1AB_CVHSA Guanine-N7 methyltransferase

5c8u A R1AB_CVHSA Non-structural protein 10[133 aa] B 97.9
/94.9 48
/48 R1AB_CVHSA Guanine-N7 methyltransferase

5c8u C R1AB_CVHSA Non-structural protein 10[133 aa] D 97.8
/94.9 45
/45 R1AB_CVHSA Guanine-N7 methyltransferase

5nfy E Q1T6X8_CVHSA Polyprotein 1ab[132 aa] A 98.0
/94.7 50
/50 Q1T6X8_CVHSA Polyprotein 1ab

5nfy F Q1T6X8_CVHSA Polyprotein 1ab[133 aa] B 98.1
/94.7 54
/54 Q1T6X8_CVHSA Polyprotein 1ab

5nfy H Q1T6X8_CVHSA Polyprotein 1ab[133 aa] C 98.1
/94.7 52
/52 Q1T6X8_CVHSA Polyprotein 1ab

5nfy G Q1T6X8_CVHSA Polyprotein 1ab[133 aa] D 98.0
/94.7 49
/49 Q1T6X8_CVHSA Polyprotein 1ab

7diy A R1AB_SARS2 nsp10 protein[131 aa] B 100.0
/100.0 50
/50 R1AB_SARS2 nsp14-ExoN protein

7eiz F R1AB_SARS2 Non-structural protein 10[131 aa] I 100.0
/100.0 44
/44 R1AB_SARS2 Proofreading exoribonuclease

7mc5 B R1AB_SARS2 Non-structural protein 10[130 aa] A 100.0
/99.7 52
/52 R1AB_SARS2 Proofreading exoribonuclease

7mc6 B R1AB_SARS2 Non-structural protein 10[130 aa] A 100.0
/99.6 50
/50 R1AB_SARS2 Proofreading exoribonuclease

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

COMPOUND

527 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

7qif B GTG
7-METHYL-GUANOSINE-5'-TRIPHOSPHATE-5'-GUANOSINE[52.. A 100.0
/100.0 14
/14 R1AB_SARS2 Proofreading exoribonuclease nsp14

5c8s K SAH
S-ADENOSYL-L-HOMOCYSTEINE[26 atoms] B 100.0
/94.9 14
/14 R1AB_CVHSA Guanine-N7 methyltransferase

5c8s S SAH
S-ADENOSYL-L-HOMOCYSTEINE[26 atoms] D 100.0
/94.9 15
/15 R1AB_CVHSA Guanine-N7 methyltransferase

7r2v C SAH
S-ADENOSYL-L-HOMOCYSTEINE[26 atoms] A 100.0
/99.5 15
/15 R1AB_SARS2 Proofreading exoribonuclease nsp14

7r2v L SAH
S-ADENOSYL-L-HOMOCYSTEINE[26 atoms] B 100.0
/99.5 14
/14 R1AB_SARS2 Proofreading exoribonuclease nsp14

7tw8 B SAH
S-ADENOSYL-L-HOMOCYSTEINE[26 atoms] A 100.0
/98.9 13
/13 ETV6_HUMAN R1AB_SARS2 Transcription factor ETV6,Proofreading exoribonucl..

8frj C AW2
5-bromo-7-{5-[(3-{[(4-tert-butylphenyl)carbamoyl]a.. A 100.0
/98.9 16
/16 ETV6_HUMAN R1AB_SARS2 Transcription factor ETV6,Guanine-N7 methyltransfe..

5c8t K SAM
S-ADENOSYLMETHIONINE[27 atoms] B 100.0
/94.9 13
/13 R1AB_CVHSA Guanine-N7 methyltransferase

5c8t R SAM
S-ADENOSYLMETHIONINE[27 atoms] D 100.0
/94.9 15
/15 R1AB_CVHSA Guanine-N7 methyltransferase

7tw7 C SAM
S-ADENOSYLMETHIONINE[27 atoms] A 100.0
/98.9 13
/13 ETV6_HUMAN R1AB_SARS2 Transcription factor ETV6,Proofreading exoribonucl..

7tw9 B SFG
SINEFUNGIN[27 atoms] A 100.0
/98.9 13
/13 ETV6_HUMAN R1AB_SARS2 Transcription factor ETV6,Proofreading exoribonucl..

8frk D MJ7
5'-S-(4-{[(4'-chloro[1,1'-biphenyl]-3-yl)methyl]am.. A 100.0
/98.9 14
/14 ETV6_HUMAN R1AB_SARS2 Transcription factor ETV6,Guanine-N7 methyltransfe..

8bwu B 6NR
(2~{S})-2-azanyl-4-[[(2~{S},3~{S},4~{R},5~{R})-5-(.. A 100.0
/97.4 13
/13 ETV6_HUMAN R1AB_SARS2 Transcription factor ETV6,Proofreading exoribonucl..

5c8s L G3A
GUANOSINE-P3-ADENOSINE-5',5'-TRIPHOSPHATE[50 atoms.. B 100.0
/94.9 16
/16 R1AB_CVHSA Guanine-N7 methyltransferase

5c8s T G3A
GUANOSINE-P3-ADENOSINE-5',5'-TRIPHOSPHATE[50 atoms.. D 100.0
/94.9 16
/16 R1AB_CVHSA Guanine-N7 methyltransferase

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

METAL

527 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

7mc5 V CL
CHLORIDE ION[1 atoms] A 100.0
/99.7 1
/1 R1AB_SARS2 Proofreading exoribonuclease

5c8s J MG
MAGNESIUM ION[1 atoms] B 100.0
/94.9 3
/3 R1AB_CVHSA Guanine-N7 methyltransferase

5c8s R MG
MAGNESIUM ION[1 atoms] D 100.0
/94.9 2
/2 R1AB_CVHSA Guanine-N7 methyltransferase

5c8t J MG
MAGNESIUM ION[1 atoms] B 100.0
/94.9 3
/3 R1AB_CVHSA Guanine-N7 methyltransferase

5c8t Q MG
MAGNESIUM ION[1 atoms] D 100.0
/94.9 3
/3 R1AB_CVHSA Guanine-N7 methyltransferase

5c8u J MG
MAGNESIUM ION[1 atoms] B 100.0
/94.9 3
/3 R1AB_CVHSA Guanine-N7 methyltransferase

5c8u P MG
MAGNESIUM ION[1 atoms] D 100.0
/94.9 4
/4 R1AB_CVHSA Guanine-N7 methyltransferase

7diy G MG
MAGNESIUM ION[1 atoms] B 100.0
/100.0 3
/3 R1AB_SARS2 nsp14-ExoN protein

7eiz S MG
MAGNESIUM ION[1 atoms] I 100.0
/100.0 2
/2 R1AB_SARS2 Proofreading exoribonuclease

7mc6 M MG
MAGNESIUM ION[1 atoms] A 100.0
/99.6 3
/3 R1AB_SARS2 Proofreading exoribonuclease

5c8s G ZN
ZINC ION[1 atoms] B 100.0
/94.9 4
/4 R1AB_CVHSA Guanine-N7 methyltransferase

5c8s H ZN
ZINC ION[1 atoms] B 100.0
/94.9 4
/4 R1AB_CVHSA Guanine-N7 methyltransferase

5c8s I ZN
ZINC ION[1 atoms] B 100.0
/94.9 4
/4 R1AB_CVHSA Guanine-N7 methyltransferase

5c8s O ZN
ZINC ION[1 atoms] D 100.0
/94.9 4
/4 R1AB_CVHSA Guanine-N7 methyltransferase

5c8s P ZN
ZINC ION[1 atoms] D 100.0
/94.9 4
/4 R1AB_CVHSA Guanine-N7 methyltransferase

5c8s Q ZN
ZINC ION[1 atoms] D 100.0
/94.9 4
/4 R1AB_CVHSA Guanine-N7 methyltransferase

5c8t G ZN
ZINC ION[1 atoms] B 100.0
/94.9 4
/4 R1AB_CVHSA Guanine-N7 methyltransferase

5c8t H ZN
ZINC ION[1 atoms] B 100.0
/94.9 4
/4 R1AB_CVHSA Guanine-N7 methyltransferase

5c8t I ZN
ZINC ION[1 atoms] B 100.0
/94.9 4
/4 R1AB_CVHSA Guanine-N7 methyltransferase

5c8t N ZN
ZINC ION[1 atoms] D 100.0
/94.9 4
/4 R1AB_CVHSA Guanine-N7 methyltransferase

5c8t O ZN
ZINC ION[1 atoms] D 100.0
/94.9 4
/4 R1AB_CVHSA Guanine-N7 methyltransferase

5c8t P ZN
ZINC ION[1 atoms] D 100.0
/94.9 5
/5 R1AB_CVHSA Guanine-N7 methyltransferase

5c8u G ZN
ZINC ION[1 atoms] B 100.0
/94.9 4
/4 R1AB_CVHSA Guanine-N7 methyltransferase

5c8u H ZN
ZINC ION[1 atoms] B 100.0
/94.9 4
/4 R1AB_CVHSA Guanine-N7 methyltransferase

5c8u I ZN
ZINC ION[1 atoms] B 100.0
/94.9 4
/4 R1AB_CVHSA Guanine-N7 methyltransferase

5c8u M ZN
ZINC ION[1 atoms] D 100.0
/94.9 4
/4 R1AB_CVHSA Guanine-N7 methyltransferase

5c8u N ZN
ZINC ION[1 atoms] D 100.0
/94.9 4
/4 R1AB_CVHSA Guanine-N7 methyltransferase

5c8u O ZN
ZINC ION[1 atoms] D 100.0
/94.9 4
/4 R1AB_CVHSA Guanine-N7 methyltransferase

5nfy I ZN
ZINC ION[1 atoms] A 100.0
/94.7 5
/5 Q1T6X8_CVHSA Polyprotein 1ab

5nfy J ZN
ZINC ION[1 atoms] A 100.0
/94.7 4
/4 Q1T6X8_CVHSA Polyprotein 1ab

5nfy K ZN
ZINC ION[1 atoms] A 100.0
/94.7 5
/5 Q1T6X8_CVHSA Polyprotein 1ab

5nfy N ZN
ZINC ION[1 atoms] B 100.0
/94.7 5
/5 Q1T6X8_CVHSA Polyprotein 1ab

5nfy O ZN
ZINC ION[1 atoms] B 100.0
/94.7 4
/4 Q1T6X8_CVHSA Polyprotein 1ab

5nfy P ZN
ZINC ION[1 atoms] B 100.0
/94.7 5
/5 Q1T6X8_CVHSA Polyprotein 1ab

5nfy Q ZN
ZINC ION[1 atoms] C 100.0
/94.7 5
/5 Q1T6X8_CVHSA Polyprotein 1ab

5nfy R ZN
ZINC ION[1 atoms] C 100.0
/94.7 4
/4 Q1T6X8_CVHSA Polyprotein 1ab

5nfy S ZN
ZINC ION[1 atoms] C 100.0
/94.7 5
/5 Q1T6X8_CVHSA Polyprotein 1ab

5nfy U ZN
ZINC ION[1 atoms] D 100.0
/94.7 6
/6 Q1T6X8_CVHSA Polyprotein 1ab

5nfy V ZN
ZINC ION[1 atoms] D 100.0
/94.7 4
/4 Q1T6X8_CVHSA Polyprotein 1ab

5nfy W ZN
ZINC ION[1 atoms] D 100.0
/94.7 5
/5 Q1T6X8_CVHSA Polyprotein 1ab

7diy E ZN
ZINC ION[1 atoms] B 100.0
/100.0 4
/4 R1AB_SARS2 nsp14-ExoN protein

7diy F ZN
ZINC ION[1 atoms] B 100.0
/100.0 4
/4 R1AB_SARS2 nsp14-ExoN protein

7eiz P ZN
ZINC ION[1 atoms] I 100.0
/100.0 5
/5 R1AB_SARS2 Proofreading exoribonuclease

7eiz Q ZN
ZINC ION[1 atoms] I 100.0
/100.0 4
/4 R1AB_SARS2 Proofreading exoribonuclease

7eiz R ZN
ZINC ION[1 atoms] I 100.0
/100.0 4
/4 R1AB_SARS2 Proofreading exoribonuclease

7mc5 C ZN
ZINC ION[1 atoms] A 100.0
/99.7 4
/4 R1AB_SARS2 Proofreading exoribonuclease

7mc5 D ZN
ZINC ION[1 atoms] A 100.0
/99.7 4
/4 R1AB_SARS2 Proofreading exoribonuclease

7mc6 C ZN
ZINC ION[1 atoms] A 100.0
/99.6 4
/4 R1AB_SARS2 Proofreading exoribonuclease

7mc6 D ZN
ZINC ION[1 atoms] A 100.0
/99.6 4
/4 R1AB_SARS2 Proofreading exoribonuclease

7qgi B ZN
ZINC ION[1 atoms] A 100.0
/100.0 4
/4 R1AB_SARS2 Proofreading exoribonuclease nsp14

7qgi C ZN
ZINC ION[1 atoms] A 100.0
/100.0 4
/4 R1AB_SARS2 Proofreading exoribonuclease nsp14

7qgi D ZN
ZINC ION[1 atoms] A 100.0
/100.0 4
/4 R1AB_SARS2 Proofreading exoribonuclease nsp14

7qif C ZN
ZINC ION[1 atoms] A 100.0
/100.0 4
/4 R1AB_SARS2 Proofreading exoribonuclease nsp14

7qif D ZN
ZINC ION[1 atoms] A 100.0
/100.0 4
/4 R1AB_SARS2 Proofreading exoribonuclease nsp14

7qif E ZN
ZINC ION[1 atoms] A 100.0
/100.0 4
/4 R1AB_SARS2 Proofreading exoribonuclease nsp14

7r2v F ZN
ZINC ION[1 atoms] A 100.0
/99.5 4
/4 R1AB_SARS2 Proofreading exoribonuclease nsp14

7r2v G ZN
ZINC ION[1 atoms] A 100.0
/99.5 4
/4 R1AB_SARS2 Proofreading exoribonuclease nsp14

7r2v H ZN
ZINC ION[1 atoms] A 100.0
/99.5 4
/4 R1AB_SARS2 Proofreading exoribonuclease nsp14

7r2v I ZN
ZINC ION[1 atoms] A 100.0
/99.5 2
/2 R1AB_SARS2 Proofreading exoribonuclease nsp14

7r2v J ZN
ZINC ION[1 atoms] A 100.0
/99.5 4
/4 R1AB_SARS2 Proofreading exoribonuclease nsp14

7r2v O ZN
ZINC ION[1 atoms] B 100.0
/99.5 4
/4 R1AB_SARS2 Proofreading exoribonuclease nsp14

7r2v P ZN
ZINC ION[1 atoms] B 100.0
/99.5 4
/4 R1AB_SARS2 Proofreading exoribonuclease nsp14

7r2v Q ZN
ZINC ION[1 atoms] B 100.0
/99.5 4
/4 R1AB_SARS2 Proofreading exoribonuclease nsp14

7r2v R ZN
ZINC ION[1 atoms] B 100.0
/99.5 3
/3 R1AB_SARS2 Proofreading exoribonuclease nsp14

7tw7 B ZN
ZINC ION[1 atoms] A 100.0
/98.9 4
/4 ETV6_HUMAN R1AB_SARS2 Transcription factor ETV6,Proofreading exoribonucl..

7tw8 C ZN
ZINC ION[1 atoms] A 100.0
/98.9 4
/4 ETV6_HUMAN R1AB_SARS2 Transcription factor ETV6,Proofreading exoribonucl..

7tw9 C ZN
ZINC ION[1 atoms] A 100.0
/98.9 4
/4 ETV6_HUMAN R1AB_SARS2 Transcription factor ETV6,Proofreading exoribonucl..

8bwu C ZN
ZINC ION[1 atoms] A 100.0
/97.4 4
/4 ETV6_HUMAN R1AB_SARS2 Transcription factor ETV6,Proofreading exoribonucl..

8frj B ZN
ZINC ION[1 atoms] A 100.0
/98.9 4
/4 ETV6_HUMAN R1AB_SARS2 Transcription factor ETV6,Guanine-N7 methyltransfe..

8frk B ZN
ZINC ION[1 atoms] A 100.0
/98.9 4
/4 ETV6_HUMAN R1AB_SARS2 Transcription factor ETV6,Guanine-N7 methyltransfe..

8frk E K
POTASSIUM ION[1 atoms] A 100.0
/98.9 4
/4 ETV6_HUMAN R1AB_SARS2 Transcription factor ETV6,Guanine-N7 methyltransfe..

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

PRECIPITANT

527 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

7qgi E PO4
PHOSPHATE ION[5 atoms] A 100.0
/100.0 4
/4 R1AB_SARS2 Proofreading exoribonuclease nsp14

7qgi F PO4
PHOSPHATE ION[5 atoms] A 100.0
/100.0 5
/5 R1AB_SARS2 Proofreading exoribonuclease nsp14

7qif F PO4
PHOSPHATE ION[5 atoms] A 100.0
/100.0 6
/6 R1AB_SARS2 Proofreading exoribonuclease nsp14

7qif G PO4
PHOSPHATE ION[5 atoms] A 100.0
/100.0 6
/6 R1AB_SARS2 Proofreading exoribonuclease nsp14

7mc5 P TLA
L(+)-TARTARIC ACID[10 atoms] A 100.0
/99.7 4
/4 R1AB_SARS2 Proofreading exoribonuclease

7mc5 Q TLA
L(+)-TARTARIC ACID[10 atoms] A 100.0
/99.7 6
/6 R1AB_SARS2 Proofreading exoribonuclease

7mc5 AA EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/99.7 1
/1 R1AB_SARS2 Proofreading exoribonuclease

7mc5 DA EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/99.7 2
/2 R1AB_SARS2 Proofreading exoribonuclease

7mc5 E EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/99.7 2
/2 R1AB_SARS2 Proofreading exoribonuclease

7mc5 F EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/99.7 6
/6 R1AB_SARS2 Proofreading exoribonuclease

7mc5 G EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/99.7 4
/4 R1AB_SARS2 Proofreading exoribonuclease

7mc5 H EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/99.7 4
/4 R1AB_SARS2 Proofreading exoribonuclease

7mc5 I EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/99.7 3
/3 R1AB_SARS2 Proofreading exoribonuclease

7mc5 J EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/99.7 4
/4 R1AB_SARS2 Proofreading exoribonuclease

7mc5 K EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/99.7 4
/4 R1AB_SARS2 Proofreading exoribonuclease

7mc5 L EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/99.7 4
/4 R1AB_SARS2 Proofreading exoribonuclease

7mc5 M EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/99.7 3
/3 R1AB_SARS2 Proofreading exoribonuclease

7mc5 N EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/99.7 4
/4 R1AB_SARS2 Proofreading exoribonuclease

7mc5 O EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/99.7 5
/5 R1AB_SARS2 Proofreading exoribonuclease

7mc5 R EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/99.7 5
/5 R1AB_SARS2 Proofreading exoribonuclease

7mc5 S EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/99.7 6
/6 R1AB_SARS2 Proofreading exoribonuclease

7mc5 T EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/99.7 5
/5 R1AB_SARS2 Proofreading exoribonuclease

7mc5 U EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/99.7 4
/4 R1AB_SARS2 Proofreading exoribonuclease

7mc5 W EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/99.7 3
/3 R1AB_SARS2 Proofreading exoribonuclease

7mc6 E EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/99.6 4
/4 R1AB_SARS2 Proofreading exoribonuclease

7mc6 F EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/99.6 3
/3 R1AB_SARS2 Proofreading exoribonuclease

7mc6 G EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/99.6 5
/5 R1AB_SARS2 Proofreading exoribonuclease

7mc6 H EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/99.6 3
/3 R1AB_SARS2 Proofreading exoribonuclease

7mc6 I EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/99.6 6
/6 R1AB_SARS2 Proofreading exoribonuclease

7mc6 J EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/99.6 6
/6 R1AB_SARS2 Proofreading exoribonuclease

7mc6 K EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/99.6 3
/3 R1AB_SARS2 Proofreading exoribonuclease

7mc6 P EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/99.6 1
/1 R1AB_SARS2 Proofreading exoribonuclease

7r2v E TRS
2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL[8 atoms] A 100.0
/99.5 2
/2 R1AB_SARS2 Proofreading exoribonuclease nsp14

5nfy L PEG
DI(HYDROXYETHYL)ETHER[7 atoms] A 100.0
/94.7 2
/2 Q1T6X8_CVHSA Polyprotein 1ab

5nfy T PEG
DI(HYDROXYETHYL)ETHER[7 atoms] C 100.0
/94.7 1
/1 Q1T6X8_CVHSA Polyprotein 1ab

7r2v D PEG
DI(HYDROXYETHYL)ETHER[7 atoms] A 100.0
/99.5 4
/4 R1AB_SARS2 Proofreading exoribonuclease nsp14

7r2v K PEG
DI(HYDROXYETHYL)ETHER[7 atoms] B 100.0
/99.5 3
/3 R1AB_SARS2 Proofreading exoribonuclease nsp14

7r2v M PEG
DI(HYDROXYETHYL)ETHER[7 atoms] B 100.0
/99.5 4
/4 R1AB_SARS2 Proofreading exoribonuclease nsp14

7r2v N PEG
DI(HYDROXYETHYL)ETHER[7 atoms] B 100.0
/99.5 1
/1 R1AB_SARS2 Proofreading exoribonuclease nsp14

7tw9 D PEG
DI(HYDROXYETHYL)ETHER[7 atoms] A 100.0
/98.9 6
/6 ETV6_HUMAN R1AB_SARS2 Transcription factor ETV6,Proofreading exoribonucl..

7tw9 E EOH
ETHANOL[3 atoms] A 100.0
/98.9 4
/4 ETV6_HUMAN R1AB_SARS2 Transcription factor ETV6,Proofreading exoribonucl..

7tw9 F MOH
METHANOL[2 atoms] A 100.0
/98.9 3
/3 ETV6_HUMAN R1AB_SARS2 Transcription factor ETV6,Proofreading exoribonucl..

7tw9 G MOH
METHANOL[2 atoms] A 100.0
/98.9 2
/2 ETV6_HUMAN R1AB_SARS2 Transcription factor ETV6,Proofreading exoribonucl..

7tw9 I MOH
METHANOL[2 atoms] A 100.0
/98.9 4
/4 ETV6_HUMAN R1AB_SARS2 Transcription factor ETV6,Proofreading exoribonucl..

7tw9 J MOH
METHANOL[2 atoms] A 100.0
/98.9 4
/4 ETV6_HUMAN R1AB_SARS2 Transcription factor ETV6,Proofreading exoribonucl..

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

MONOMER
527
	pdb_id	a¹	identity[%]²	description
	7egq	P	100.0	R1AB_SARS2 Proofreading exoribonuclease
	7eiz	I	100.0	R1AB_SARS2 Proofreading exoribonuclease
	7egq	H	100.0	R1AB_SARS2 Proofreading exoribonuclease
	7n0b	B	100.0	R1AB_SARS2 Proofreading exoribonuclease
	7n0c	B	99.8	R1AB_SARS2 Proofreading exoribonuclease
	7n0d	K	99.8	R1AB_SARS2 Proofreading exoribonuclease
	7n0d	B	99.8	R1AB_SARS2 Proofreading exoribonuclease
	7n0d	D	99.8	R1AB_SARS2 Proofreading exoribonuclease
	7n0d	I	99.8	R1AB_SARS2 Proofreading exoribonuclease
	5c8t	D	94.9	R1AB_CVHSA Guanine-N7 methyltransferase
	5c8s	D	94.9	R1AB_CVHSA Guanine-N7 methyltransferase
	5c8u	B	94.9	R1AB_CVHSA Guanine-N7 methyltransferase
	5c8u	D	94.9	R1AB_CVHSA Guanine-N7 methyltransferase
	5c8t	B	94.9	R1AB_CVHSA Guanine-N7 methyltransferase
	5c8s	B	94.9	R1AB_CVHSA Guanine-N7 methyltransferase
	5nfy	D	94.7	Q1T6X8_CVHSA Polyprotein 1ab
	5nfy	C	94.7	Q1T6X8_CVHSA Polyprotein 1ab
	5nfy	B	94.7	Q1T6X8_CVHSA Polyprotein 1ab
	5nfy	A	94.7	Q1T6X8_CVHSA Polyprotein 1ab
	5slp	A	100.0	R1AB_SARS2 Proofreading exoribonuclease nsp14
	5sme	A	100.0	R1AB_SARS2 Proofreading exoribonuclease nsp14
	5smc	A	100.0	R1AB_SARS2 Proofreading exoribonuclease nsp14
	5sma	A	100.0	R1AB_SARS2 Proofreading exoribonuclease nsp14
	5slm	A	100.0	R1AB_SARS2 Proofreading exoribonuclease nsp14
	5slj	A	100.0	R1AB_SARS2 Proofreading exoribonuclease nsp14
	5sl1	A	100.0	R1AB_SARS2 Proofreading exoribonuclease nsp14
	5slf	A	100.0	R1AB_SARS2 Proofreading exoribonuclease nsp14
	5sl2	A	100.0	R1AB_SARS2 Proofreading exoribonuclease nsp14
	5sm9	A	100.0	R1AB_SARS2 Proofreading exoribonuclease nsp14
	5sm4	A	100.0	R1AB_SARS2 Proofreading exoribonuclease nsp14
	5sm0	A	100.0	R1AB_SARS2 Proofreading exoribonuclease nsp14
	5slw	A	100.0	R1AB_SARS2 Proofreading exoribonuclease nsp14
	5sla	A	100.0	R1AB_SARS2 Proofreading exoribonuclease nsp14
	5sky	A	100.0	R1AB_SARS2 Proofreading exoribonuclease nsp14
	5smh	A	100.0	R1AB_SARS2 Proofreading exoribonuclease nsp14
	5sl4	A	100.0	R1AB_SARS2 Proofreading exoribonuclease nsp14
	5smd	A	100.0	R1AB_SARS2 Proofreading exoribonuclease nsp14
	5smb	A	100.0	R1AB_SARS2 Proofreading exoribonuclease nsp14
	5sll	A	100.0	R1AB_SARS2 Proofreading exoribonuclease nsp14
	5slk	A	100.0	R1AB_SARS2 Proofreading exoribonuclease nsp14
	5slg	A	100.0	R1AB_SARS2 Proofreading exoribonuclease nsp14
	5sl5	A	100.0	R1AB_SARS2 Proofreading exoribonuclease nsp14
	5skx	A	100.0	R1AB_SARS2 Proofreading exoribonuclease nsp14
	5slz	A	100.0	R1AB_SARS2 Proofreading exoribonuclease nsp14
	5smk	A	100.0	R1AB_SARS2 Proofreading exoribonuclease nsp14
	5smi	A	100.0	R1AB_SARS2 Proofreading exoribonuclease nsp14
	5smg	A	100.0	R1AB_SARS2 Proofreading exoribonuclease nsp14
	5smf	A	100.0	R1AB_SARS2 Proofreading exoribonuclease nsp14
	5sls	A	100.0	R1AB_SARS2 Proofreading exoribonuclease nsp14
	5slr	A	100.0	R1AB_SARS2 Proofreading exoribonuclease nsp14
	5sld	A	100.0	R1AB_SARS2 Proofreading exoribonuclease nsp14
	5slc	A	100.0	R1AB_SARS2 Proofreading exoribonuclease nsp14
	5slb	A	100.0	R1AB_SARS2 Proofreading exoribonuclease nsp14
	5sl9	A	100.0	R1AB_SARS2 Proofreading exoribonuclease nsp14
	5sl3	A	100.0	R1AB_SARS2 Proofreading exoribonuclease nsp14
	5sl7	A	100.0	R1AB_SARS2 Proofreading exoribonuclease nsp14
	5skw	A	100.0	R1AB_SARS2 Proofreading exoribonuclease nsp14
	5sm6	A	100.0	R1AB_SARS2 Proofreading exoribonuclease nsp14
	5sm5	A	100.0	R1AB_SARS2 Proofreading exoribonuclease nsp14
	5sm2	A	100.0	R1AB_SARS2 Proofreading exoribonuclease nsp14
	5sm1	A	100.0	R1AB_SARS2 Proofreading exoribonuclease nsp14
	5sm8	A	100.0	R1AB_SARS2 Proofreading exoribonuclease nsp14
	5slt	A	100.0	R1AB_SARS2 Proofreading exoribonuclease nsp14
	5slv	A	100.0	R1AB_SARS2 Proofreading exoribonuclease nsp14
	5slq	A	100.0	R1AB_SARS2 Proofreading exoribonuclease nsp14
	5sl8	A	100.0	R1AB_SARS2 Proofreading exoribonuclease nsp14
	5skz	A	100.0	R1AB_SARS2 Proofreading exoribonuclease nsp14
	5sm7	A	100.0	R1AB_SARS2 Proofreading exoribonuclease nsp14
	5sm3	A	100.0	R1AB_SARS2 Proofreading exoribonuclease nsp14
	5sle	A	100.0	R1AB_SARS2 Proofreading exoribonuclease nsp14
	7qif	A	100.0	R1AB_SARS2 Proofreading exoribonuclease nsp14
	5slh	A	100.0	R1AB_SARS2 Proofreading exoribonuclease nsp14
	5sl0	A	100.0	R1AB_SARS2 Proofreading exoribonuclease nsp14
	7qgi	A	100.0	R1AB_SARS2 Proofreading exoribonuclease nsp14
	5sly	A	100.0	R1AB_SARS2 Proofreading exoribonuclease nsp14
	5slu	A	100.0	R1AB_SARS2 Proofreading exoribonuclease nsp14
	5sl6	A	100.0	R1AB_SARS2 Proofreading exoribonuclease nsp14
	5sli	A	100.0	R1AB_SARS2 Proofreading exoribonuclease nsp14
	5sln	A	100.0	R1AB_SARS2 Proofreading exoribonuclease nsp14
	5slx	A	100.0	R1AB_SARS2 Proofreading exoribonuclease nsp14
	5slo	A	100.0	R1AB_SARS2 Proofreading exoribonuclease nsp14
	7r2v	A	99.5	R1AB_SARS2 Proofreading exoribonuclease nsp14
	7r2v	B	99.5	R1AB_SARS2 Proofreading exoribonuclease nsp14
	7mc5	A	99.7	R1AB_SARS2 Proofreading exoribonuclease
	7diy	B	100.0	R1AB_SARS2 nsp14-ExoN protein
	7mc6	A	99.6	R1AB_SARS2 Proofreading exoribonuclease
	7tw8	A	98.9	ETV6_HUMAN R1AB_SARS2 Transcription factor ETV6,Proofreading exoribonuclease nsp14 chimera
	8frj	A	98.9	ETV6_HUMAN R1AB_SARS2 Transcription factor ETV6,Guanine-N7 methyltransferase nsp14 chimera
	7tw7	A	98.9	ETV6_HUMAN R1AB_SARS2 Transcription factor ETV6,Proofreading exoribonuclease nsp14 chimera
	7tw9	A	98.9	ETV6_HUMAN R1AB_SARS2 Transcription factor ETV6,Proofreading exoribonuclease nsp14 chimera
	8bwu	A	97.4	ETV6_HUMAN R1AB_SARS2 Transcription factor ETV6,Proofreading exoribonuclease nsp14
	8frk	A	98.9	ETV6_HUMAN R1AB_SARS2 Transcription factor ETV6,Guanine-N7 methyltransferase nsp14 chimera
	1.a¹:asym_id for the homologue. 2.identity[%]²:sequence identity between the query and the homologue.

HETERO
527	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	7eiz	A	R1AB_SARS2 RNA-directed RNA polymerase[926 aa]	I	100.0 /100.0	5 /5	R1AB_SARS2 Proofreading exoribonuclease
	7eiz	E	R1AB_SARS2 Non-structural protein 9[113 aa]	I	100.0 /100.0	3 /3	R1AB_SARS2 Proofreading exoribonuclease
	5c8s	A	R1AB_CVHSA Non-structural protein 10[133 aa]	B	98.0 /94.9	49 /49	R1AB_CVHSA Guanine-N7 methyltransferase
	5c8s	C	R1AB_CVHSA Non-structural protein 10[133 aa]	D	97.9 /94.9	47 /47	R1AB_CVHSA Guanine-N7 methyltransferase
	5c8t	A	R1AB_CVHSA Non-structural protein 10[133 aa]	B	98.0 /94.9	49 /49	R1AB_CVHSA Guanine-N7 methyltransferase
	5c8t	C	R1AB_CVHSA Non-structural protein 10[133 aa]	D	97.9 /94.9	48 /48	R1AB_CVHSA Guanine-N7 methyltransferase
	5c8u	A	R1AB_CVHSA Non-structural protein 10[133 aa]	B	97.9 /94.9	48 /48	R1AB_CVHSA Guanine-N7 methyltransferase
	5c8u	C	R1AB_CVHSA Non-structural protein 10[133 aa]	D	97.8 /94.9	45 /45	R1AB_CVHSA Guanine-N7 methyltransferase
	5nfy	E	Q1T6X8_CVHSA Polyprotein 1ab[132 aa]	A	98.0 /94.7	50 /50	Q1T6X8_CVHSA Polyprotein 1ab
	5nfy	F	Q1T6X8_CVHSA Polyprotein 1ab[133 aa]	B	98.1 /94.7	54 /54	Q1T6X8_CVHSA Polyprotein 1ab
	5nfy	H	Q1T6X8_CVHSA Polyprotein 1ab[133 aa]	C	98.1 /94.7	52 /52	Q1T6X8_CVHSA Polyprotein 1ab
	5nfy	G	Q1T6X8_CVHSA Polyprotein 1ab[133 aa]	D	98.0 /94.7	49 /49	Q1T6X8_CVHSA Polyprotein 1ab
	7diy	A	R1AB_SARS2 nsp10 protein[131 aa]	B	100.0 /100.0	50 /50	R1AB_SARS2 nsp14-ExoN protein
	7eiz	F	R1AB_SARS2 Non-structural protein 10[131 aa]	I	100.0 /100.0	44 /44	R1AB_SARS2 Proofreading exoribonuclease
	7mc5	B	R1AB_SARS2 Non-structural protein 10[130 aa]	A	100.0 /99.7	52 /52	R1AB_SARS2 Proofreading exoribonuclease
	7mc6	B	R1AB_SARS2 Non-structural protein 10[130 aa]	A	100.0 /99.6	50 /50	R1AB_SARS2 Proofreading exoribonuclease
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
COMPOUND
527	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	7qif	B	GTG 7-METHYL-GUANOSINE-5'-TRIPHOSPHATE-5'-GUANOSINE[52..	A	100.0 /100.0	14 /14	R1AB_SARS2 Proofreading exoribonuclease nsp14
	5c8s	K	SAH S-ADENOSYL-L-HOMOCYSTEINE[26 atoms]	B	100.0 /94.9	14 /14	R1AB_CVHSA Guanine-N7 methyltransferase
	5c8s	S	SAH S-ADENOSYL-L-HOMOCYSTEINE[26 atoms]	D	100.0 /94.9	15 /15	R1AB_CVHSA Guanine-N7 methyltransferase
	7r2v	C	SAH S-ADENOSYL-L-HOMOCYSTEINE[26 atoms]	A	100.0 /99.5	15 /15	R1AB_SARS2 Proofreading exoribonuclease nsp14
	7r2v	L	SAH S-ADENOSYL-L-HOMOCYSTEINE[26 atoms]	B	100.0 /99.5	14 /14	R1AB_SARS2 Proofreading exoribonuclease nsp14
	7tw8	B	SAH S-ADENOSYL-L-HOMOCYSTEINE[26 atoms]	A	100.0 /98.9	13 /13	ETV6_HUMAN R1AB_SARS2 Transcription factor ETV6,Proofreading exoribonucl..
	8frj	C	AW2 5-bromo-7-{5-[(3-{[(4-tert-butylphenyl)carbamoyl]a..	A	100.0 /98.9	16 /16	ETV6_HUMAN R1AB_SARS2 Transcription factor ETV6,Guanine-N7 methyltransfe..
	5c8t	K	SAM S-ADENOSYLMETHIONINE[27 atoms]	B	100.0 /94.9	13 /13	R1AB_CVHSA Guanine-N7 methyltransferase
	5c8t	R	SAM S-ADENOSYLMETHIONINE[27 atoms]	D	100.0 /94.9	15 /15	R1AB_CVHSA Guanine-N7 methyltransferase
	7tw7	C	SAM S-ADENOSYLMETHIONINE[27 atoms]	A	100.0 /98.9	13 /13	ETV6_HUMAN R1AB_SARS2 Transcription factor ETV6,Proofreading exoribonucl..
	7tw9	B	SFG SINEFUNGIN[27 atoms]	A	100.0 /98.9	13 /13	ETV6_HUMAN R1AB_SARS2 Transcription factor ETV6,Proofreading exoribonucl..
	8frk	D	MJ7 5'-S-(4-{[(4'-chloro[1,1'-biphenyl]-3-yl)methyl]am..	A	100.0 /98.9	14 /14	ETV6_HUMAN R1AB_SARS2 Transcription factor ETV6,Guanine-N7 methyltransfe..
	8bwu	B	6NR (2~{S})-2-azanyl-4-[[(2~{S},3~{S},4~{R},5~{R})-5-(..	A	100.0 /97.4	13 /13	ETV6_HUMAN R1AB_SARS2 Transcription factor ETV6,Proofreading exoribonucl..
	5c8s	L	G3A GUANOSINE-P3-ADENOSINE-5',5'-TRIPHOSPHATE[50 atoms..	B	100.0 /94.9	16 /16	R1AB_CVHSA Guanine-N7 methyltransferase
	5c8s	T	G3A GUANOSINE-P3-ADENOSINE-5',5'-TRIPHOSPHATE[50 atoms..	D	100.0 /94.9	16 /16	R1AB_CVHSA Guanine-N7 methyltransferase
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
METAL
527	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	7mc5	V	CL CHLORIDE ION[1 atoms]	A	100.0 /99.7	1 /1	R1AB_SARS2 Proofreading exoribonuclease
	5c8s	J	MG MAGNESIUM ION[1 atoms]	B	100.0 /94.9	3 /3	R1AB_CVHSA Guanine-N7 methyltransferase
	5c8s	R	MG MAGNESIUM ION[1 atoms]	D	100.0 /94.9	2 /2	R1AB_CVHSA Guanine-N7 methyltransferase
	5c8t	J	MG MAGNESIUM ION[1 atoms]	B	100.0 /94.9	3 /3	R1AB_CVHSA Guanine-N7 methyltransferase
	5c8t	Q	MG MAGNESIUM ION[1 atoms]	D	100.0 /94.9	3 /3	R1AB_CVHSA Guanine-N7 methyltransferase
	5c8u	J	MG MAGNESIUM ION[1 atoms]	B	100.0 /94.9	3 /3	R1AB_CVHSA Guanine-N7 methyltransferase
	5c8u	P	MG MAGNESIUM ION[1 atoms]	D	100.0 /94.9	4 /4	R1AB_CVHSA Guanine-N7 methyltransferase
	7diy	G	MG MAGNESIUM ION[1 atoms]	B	100.0 /100.0	3 /3	R1AB_SARS2 nsp14-ExoN protein
	7eiz	S	MG MAGNESIUM ION[1 atoms]	I	100.0 /100.0	2 /2	R1AB_SARS2 Proofreading exoribonuclease
	7mc6	M	MG MAGNESIUM ION[1 atoms]	A	100.0 /99.6	3 /3	R1AB_SARS2 Proofreading exoribonuclease
	5c8s	G	ZN ZINC ION[1 atoms]	B	100.0 /94.9	4 /4	R1AB_CVHSA Guanine-N7 methyltransferase
	5c8s	H	ZN ZINC ION[1 atoms]	B	100.0 /94.9	4 /4	R1AB_CVHSA Guanine-N7 methyltransferase
	5c8s	I	ZN ZINC ION[1 atoms]	B	100.0 /94.9	4 /4	R1AB_CVHSA Guanine-N7 methyltransferase
	5c8s	O	ZN ZINC ION[1 atoms]	D	100.0 /94.9	4 /4	R1AB_CVHSA Guanine-N7 methyltransferase
	5c8s	P	ZN ZINC ION[1 atoms]	D	100.0 /94.9	4 /4	R1AB_CVHSA Guanine-N7 methyltransferase
	5c8s	Q	ZN ZINC ION[1 atoms]	D	100.0 /94.9	4 /4	R1AB_CVHSA Guanine-N7 methyltransferase
	5c8t	G	ZN ZINC ION[1 atoms]	B	100.0 /94.9	4 /4	R1AB_CVHSA Guanine-N7 methyltransferase
	5c8t	H	ZN ZINC ION[1 atoms]	B	100.0 /94.9	4 /4	R1AB_CVHSA Guanine-N7 methyltransferase
	5c8t	I	ZN ZINC ION[1 atoms]	B	100.0 /94.9	4 /4	R1AB_CVHSA Guanine-N7 methyltransferase
	5c8t	N	ZN ZINC ION[1 atoms]	D	100.0 /94.9	4 /4	R1AB_CVHSA Guanine-N7 methyltransferase
	5c8t	O	ZN ZINC ION[1 atoms]	D	100.0 /94.9	4 /4	R1AB_CVHSA Guanine-N7 methyltransferase
	5c8t	P	ZN ZINC ION[1 atoms]	D	100.0 /94.9	5 /5	R1AB_CVHSA Guanine-N7 methyltransferase
	5c8u	G	ZN ZINC ION[1 atoms]	B	100.0 /94.9	4 /4	R1AB_CVHSA Guanine-N7 methyltransferase
	5c8u	H	ZN ZINC ION[1 atoms]	B	100.0 /94.9	4 /4	R1AB_CVHSA Guanine-N7 methyltransferase
	5c8u	I	ZN ZINC ION[1 atoms]	B	100.0 /94.9	4 /4	R1AB_CVHSA Guanine-N7 methyltransferase
	5c8u	M	ZN ZINC ION[1 atoms]	D	100.0 /94.9	4 /4	R1AB_CVHSA Guanine-N7 methyltransferase
	5c8u	N	ZN ZINC ION[1 atoms]	D	100.0 /94.9	4 /4	R1AB_CVHSA Guanine-N7 methyltransferase
	5c8u	O	ZN ZINC ION[1 atoms]	D	100.0 /94.9	4 /4	R1AB_CVHSA Guanine-N7 methyltransferase
	5nfy	I	ZN ZINC ION[1 atoms]	A	100.0 /94.7	5 /5	Q1T6X8_CVHSA Polyprotein 1ab
	5nfy	J	ZN ZINC ION[1 atoms]	A	100.0 /94.7	4 /4	Q1T6X8_CVHSA Polyprotein 1ab
	5nfy	K	ZN ZINC ION[1 atoms]	A	100.0 /94.7	5 /5	Q1T6X8_CVHSA Polyprotein 1ab
	5nfy	N	ZN ZINC ION[1 atoms]	B	100.0 /94.7	5 /5	Q1T6X8_CVHSA Polyprotein 1ab
	5nfy	O	ZN ZINC ION[1 atoms]	B	100.0 /94.7	4 /4	Q1T6X8_CVHSA Polyprotein 1ab
	5nfy	P	ZN ZINC ION[1 atoms]	B	100.0 /94.7	5 /5	Q1T6X8_CVHSA Polyprotein 1ab
	5nfy	Q	ZN ZINC ION[1 atoms]	C	100.0 /94.7	5 /5	Q1T6X8_CVHSA Polyprotein 1ab
	5nfy	R	ZN ZINC ION[1 atoms]	C	100.0 /94.7	4 /4	Q1T6X8_CVHSA Polyprotein 1ab
	5nfy	S	ZN ZINC ION[1 atoms]	C	100.0 /94.7	5 /5	Q1T6X8_CVHSA Polyprotein 1ab
	5nfy	U	ZN ZINC ION[1 atoms]	D	100.0 /94.7	6 /6	Q1T6X8_CVHSA Polyprotein 1ab
	5nfy	V	ZN ZINC ION[1 atoms]	D	100.0 /94.7	4 /4	Q1T6X8_CVHSA Polyprotein 1ab
	5nfy	W	ZN ZINC ION[1 atoms]	D	100.0 /94.7	5 /5	Q1T6X8_CVHSA Polyprotein 1ab
	7diy	E	ZN ZINC ION[1 atoms]	B	100.0 /100.0	4 /4	R1AB_SARS2 nsp14-ExoN protein
	7diy	F	ZN ZINC ION[1 atoms]	B	100.0 /100.0	4 /4	R1AB_SARS2 nsp14-ExoN protein
	7eiz	P	ZN ZINC ION[1 atoms]	I	100.0 /100.0	5 /5	R1AB_SARS2 Proofreading exoribonuclease
	7eiz	Q	ZN ZINC ION[1 atoms]	I	100.0 /100.0	4 /4	R1AB_SARS2 Proofreading exoribonuclease
	7eiz	R	ZN ZINC ION[1 atoms]	I	100.0 /100.0	4 /4	R1AB_SARS2 Proofreading exoribonuclease
	7mc5	C	ZN ZINC ION[1 atoms]	A	100.0 /99.7	4 /4	R1AB_SARS2 Proofreading exoribonuclease
	7mc5	D	ZN ZINC ION[1 atoms]	A	100.0 /99.7	4 /4	R1AB_SARS2 Proofreading exoribonuclease
	7mc6	C	ZN ZINC ION[1 atoms]	A	100.0 /99.6	4 /4	R1AB_SARS2 Proofreading exoribonuclease
	7mc6	D	ZN ZINC ION[1 atoms]	A	100.0 /99.6	4 /4	R1AB_SARS2 Proofreading exoribonuclease
	7qgi	B	ZN ZINC ION[1 atoms]	A	100.0 /100.0	4 /4	R1AB_SARS2 Proofreading exoribonuclease nsp14
	7qgi	C	ZN ZINC ION[1 atoms]	A	100.0 /100.0	4 /4	R1AB_SARS2 Proofreading exoribonuclease nsp14
	7qgi	D	ZN ZINC ION[1 atoms]	A	100.0 /100.0	4 /4	R1AB_SARS2 Proofreading exoribonuclease nsp14
	7qif	C	ZN ZINC ION[1 atoms]	A	100.0 /100.0	4 /4	R1AB_SARS2 Proofreading exoribonuclease nsp14
	7qif	D	ZN ZINC ION[1 atoms]	A	100.0 /100.0	4 /4	R1AB_SARS2 Proofreading exoribonuclease nsp14
	7qif	E	ZN ZINC ION[1 atoms]	A	100.0 /100.0	4 /4	R1AB_SARS2 Proofreading exoribonuclease nsp14
	7r2v	F	ZN ZINC ION[1 atoms]	A	100.0 /99.5	4 /4	R1AB_SARS2 Proofreading exoribonuclease nsp14
	7r2v	G	ZN ZINC ION[1 atoms]	A	100.0 /99.5	4 /4	R1AB_SARS2 Proofreading exoribonuclease nsp14
	7r2v	H	ZN ZINC ION[1 atoms]	A	100.0 /99.5	4 /4	R1AB_SARS2 Proofreading exoribonuclease nsp14
	7r2v	I	ZN ZINC ION[1 atoms]	A	100.0 /99.5	2 /2	R1AB_SARS2 Proofreading exoribonuclease nsp14
	7r2v	J	ZN ZINC ION[1 atoms]	A	100.0 /99.5	4 /4	R1AB_SARS2 Proofreading exoribonuclease nsp14
	7r2v	O	ZN ZINC ION[1 atoms]	B	100.0 /99.5	4 /4	R1AB_SARS2 Proofreading exoribonuclease nsp14
	7r2v	P	ZN ZINC ION[1 atoms]	B	100.0 /99.5	4 /4	R1AB_SARS2 Proofreading exoribonuclease nsp14
	7r2v	Q	ZN ZINC ION[1 atoms]	B	100.0 /99.5	4 /4	R1AB_SARS2 Proofreading exoribonuclease nsp14
	7r2v	R	ZN ZINC ION[1 atoms]	B	100.0 /99.5	3 /3	R1AB_SARS2 Proofreading exoribonuclease nsp14
	7tw7	B	ZN ZINC ION[1 atoms]	A	100.0 /98.9	4 /4	ETV6_HUMAN R1AB_SARS2 Transcription factor ETV6,Proofreading exoribonucl..
	7tw8	C	ZN ZINC ION[1 atoms]	A	100.0 /98.9	4 /4	ETV6_HUMAN R1AB_SARS2 Transcription factor ETV6,Proofreading exoribonucl..
	7tw9	C	ZN ZINC ION[1 atoms]	A	100.0 /98.9	4 /4	ETV6_HUMAN R1AB_SARS2 Transcription factor ETV6,Proofreading exoribonucl..
	8bwu	C	ZN ZINC ION[1 atoms]	A	100.0 /97.4	4 /4	ETV6_HUMAN R1AB_SARS2 Transcription factor ETV6,Proofreading exoribonucl..
	8frj	B	ZN ZINC ION[1 atoms]	A	100.0 /98.9	4 /4	ETV6_HUMAN R1AB_SARS2 Transcription factor ETV6,Guanine-N7 methyltransfe..
	8frk	B	ZN ZINC ION[1 atoms]	A	100.0 /98.9	4 /4	ETV6_HUMAN R1AB_SARS2 Transcription factor ETV6,Guanine-N7 methyltransfe..
	8frk	E	K POTASSIUM ION[1 atoms]	A	100.0 /98.9	4 /4	ETV6_HUMAN R1AB_SARS2 Transcription factor ETV6,Guanine-N7 methyltransfe..
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
527	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	7qgi	E	PO4 PHOSPHATE ION[5 atoms]	A	100.0 /100.0	4 /4	R1AB_SARS2 Proofreading exoribonuclease nsp14
	7qgi	F	PO4 PHOSPHATE ION[5 atoms]	A	100.0 /100.0	5 /5	R1AB_SARS2 Proofreading exoribonuclease nsp14
	7qif	F	PO4 PHOSPHATE ION[5 atoms]	A	100.0 /100.0	6 /6	R1AB_SARS2 Proofreading exoribonuclease nsp14
	7qif	G	PO4 PHOSPHATE ION[5 atoms]	A	100.0 /100.0	6 /6	R1AB_SARS2 Proofreading exoribonuclease nsp14
	7mc5	P	TLA L(+)-TARTARIC ACID[10 atoms]	A	100.0 /99.7	4 /4	R1AB_SARS2 Proofreading exoribonuclease
	7mc5	Q	TLA L(+)-TARTARIC ACID[10 atoms]	A	100.0 /99.7	6 /6	R1AB_SARS2 Proofreading exoribonuclease
	7mc5	AA	EDO 1,2-ETHANEDIOL[4 atoms]	A	100.0 /99.7	1 /1	R1AB_SARS2 Proofreading exoribonuclease
	7mc5	DA	EDO 1,2-ETHANEDIOL[4 atoms]	A	100.0 /99.7	2 /2	R1AB_SARS2 Proofreading exoribonuclease
	7mc5	E	EDO 1,2-ETHANEDIOL[4 atoms]	A	100.0 /99.7	2 /2	R1AB_SARS2 Proofreading exoribonuclease
	7mc5	F	EDO 1,2-ETHANEDIOL[4 atoms]	A	100.0 /99.7	6 /6	R1AB_SARS2 Proofreading exoribonuclease
	7mc5	G	EDO 1,2-ETHANEDIOL[4 atoms]	A	100.0 /99.7	4 /4	R1AB_SARS2 Proofreading exoribonuclease
	7mc5	H	EDO 1,2-ETHANEDIOL[4 atoms]	A	100.0 /99.7	4 /4	R1AB_SARS2 Proofreading exoribonuclease
	7mc5	I	EDO 1,2-ETHANEDIOL[4 atoms]	A	100.0 /99.7	3 /3	R1AB_SARS2 Proofreading exoribonuclease
	7mc5	J	EDO 1,2-ETHANEDIOL[4 atoms]	A	100.0 /99.7	4 /4	R1AB_SARS2 Proofreading exoribonuclease
	7mc5	K	EDO 1,2-ETHANEDIOL[4 atoms]	A	100.0 /99.7	4 /4	R1AB_SARS2 Proofreading exoribonuclease
	7mc5	L	EDO 1,2-ETHANEDIOL[4 atoms]	A	100.0 /99.7	4 /4	R1AB_SARS2 Proofreading exoribonuclease
	7mc5	M	EDO 1,2-ETHANEDIOL[4 atoms]	A	100.0 /99.7	3 /3	R1AB_SARS2 Proofreading exoribonuclease
	7mc5	N	EDO 1,2-ETHANEDIOL[4 atoms]	A	100.0 /99.7	4 /4	R1AB_SARS2 Proofreading exoribonuclease
	7mc5	O	EDO 1,2-ETHANEDIOL[4 atoms]	A	100.0 /99.7	5 /5	R1AB_SARS2 Proofreading exoribonuclease
	7mc5	R	EDO 1,2-ETHANEDIOL[4 atoms]	A	100.0 /99.7	5 /5	R1AB_SARS2 Proofreading exoribonuclease
	7mc5	S	EDO 1,2-ETHANEDIOL[4 atoms]	A	100.0 /99.7	6 /6	R1AB_SARS2 Proofreading exoribonuclease
	7mc5	T	EDO 1,2-ETHANEDIOL[4 atoms]	A	100.0 /99.7	5 /5	R1AB_SARS2 Proofreading exoribonuclease
	7mc5	U	EDO 1,2-ETHANEDIOL[4 atoms]	A	100.0 /99.7	4 /4	R1AB_SARS2 Proofreading exoribonuclease
	7mc5	W	EDO 1,2-ETHANEDIOL[4 atoms]	A	100.0 /99.7	3 /3	R1AB_SARS2 Proofreading exoribonuclease
	7mc6	E	EDO 1,2-ETHANEDIOL[4 atoms]	A	100.0 /99.6	4 /4	R1AB_SARS2 Proofreading exoribonuclease
	7mc6	F	EDO 1,2-ETHANEDIOL[4 atoms]	A	100.0 /99.6	3 /3	R1AB_SARS2 Proofreading exoribonuclease
	7mc6	G	EDO 1,2-ETHANEDIOL[4 atoms]	A	100.0 /99.6	5 /5	R1AB_SARS2 Proofreading exoribonuclease
	7mc6	H	EDO 1,2-ETHANEDIOL[4 atoms]	A	100.0 /99.6	3 /3	R1AB_SARS2 Proofreading exoribonuclease
	7mc6	I	EDO 1,2-ETHANEDIOL[4 atoms]	A	100.0 /99.6	6 /6	R1AB_SARS2 Proofreading exoribonuclease
	7mc6	J	EDO 1,2-ETHANEDIOL[4 atoms]	A	100.0 /99.6	6 /6	R1AB_SARS2 Proofreading exoribonuclease
	7mc6	K	EDO 1,2-ETHANEDIOL[4 atoms]	A	100.0 /99.6	3 /3	R1AB_SARS2 Proofreading exoribonuclease
	7mc6	P	EDO 1,2-ETHANEDIOL[4 atoms]	A	100.0 /99.6	1 /1	R1AB_SARS2 Proofreading exoribonuclease
	7r2v	E	TRS 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL[8 atoms]	A	100.0 /99.5	2 /2	R1AB_SARS2 Proofreading exoribonuclease nsp14
	5nfy	L	PEG DI(HYDROXYETHYL)ETHER[7 atoms]	A	100.0 /94.7	2 /2	Q1T6X8_CVHSA Polyprotein 1ab
	5nfy	T	PEG DI(HYDROXYETHYL)ETHER[7 atoms]	C	100.0 /94.7	1 /1	Q1T6X8_CVHSA Polyprotein 1ab
	7r2v	D	PEG DI(HYDROXYETHYL)ETHER[7 atoms]	A	100.0 /99.5	4 /4	R1AB_SARS2 Proofreading exoribonuclease nsp14
	7r2v	K	PEG DI(HYDROXYETHYL)ETHER[7 atoms]	B	100.0 /99.5	3 /3	R1AB_SARS2 Proofreading exoribonuclease nsp14
	7r2v	M	PEG DI(HYDROXYETHYL)ETHER[7 atoms]	B	100.0 /99.5	4 /4	R1AB_SARS2 Proofreading exoribonuclease nsp14
	7r2v	N	PEG DI(HYDROXYETHYL)ETHER[7 atoms]	B	100.0 /99.5	1 /1	R1AB_SARS2 Proofreading exoribonuclease nsp14
	7tw9	D	PEG DI(HYDROXYETHYL)ETHER[7 atoms]	A	100.0 /98.9	6 /6	ETV6_HUMAN R1AB_SARS2 Transcription factor ETV6,Proofreading exoribonucl..
	7tw9	E	EOH ETHANOL[3 atoms]	A	100.0 /98.9	4 /4	ETV6_HUMAN R1AB_SARS2 Transcription factor ETV6,Proofreading exoribonucl..
	7tw9	F	MOH METHANOL[2 atoms]	A	100.0 /98.9	3 /3	ETV6_HUMAN R1AB_SARS2 Transcription factor ETV6,Proofreading exoribonucl..
	7tw9	G	MOH METHANOL[2 atoms]	A	100.0 /98.9	2 /2	ETV6_HUMAN R1AB_SARS2 Transcription factor ETV6,Proofreading exoribonucl..
	7tw9	I	MOH METHANOL[2 atoms]	A	100.0 /98.9	4 /4	ETV6_HUMAN R1AB_SARS2 Transcription factor ETV6,Proofreading exoribonucl..
	7tw9	J	MOH METHANOL[2 atoms]	A	100.0 /98.9	4 /4	ETV6_HUMAN R1AB_SARS2 Transcription factor ETV6,Proofreading exoribonucl..
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

Contact Molecules for Homologous Proteins

Full Bars[80 %]

UniProt Feature Tables [YP_009725309.1()]