Contact Molecules for Homologous Proteins | ||||
[Summary Bars] |
[SiteTable] |
|
[Back to Search Page] |
[Back to HOMCOS] |
[SupCon3D] |
[help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
4624 | 113 | 60 | YP_009725305.1() | |
QUERYSEQ |
NNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ |
113 | region | name | description |
1-8 | DISORDER | predicted by DISOPRED |
MONOMER | |||||||
113 | |||||||
pdb_id | a1 | identity[%]2 | description | ||||
6w4b | B | 100.0 | R1AB_SARS2 Non-structural protein 9 | ||||
7kri | B | 100.0 | R1AB_SARS2 Non-structural protein 9 | ||||
7kri | A | 100.0 | R1AB_SARS2 Non-structural protein 9 | ||||
7n3k | G | 100.0 | R1AB_SARS2 Non-structural protein 9 | ||||
8sqj | E | 100.0 | R1AB_SARS2 Non-structural protein 9 | ||||
8gwo | I | 100.0 | R1AB_SARS2 Non-structural protein 9 | ||||
8gwn | I | 100.0 | R1AB_SARS2 Non-structural protein 9 | ||||
8sqk | E | 100.0 | R1AB_SARS2 Non-structural protein 9 | ||||
7eiz | E | 100.0 | R1AB_SARS2 Non-structural protein 9 | ||||
8gwi | I | 100.0 | R1AB_SARS2 Non-structural protein 9 | ||||
8gw1 | I | 100.0 | R1AB_SARS2 Non-structural protein 9 | ||||
8gwm | G | 100.0 | R1AB_SARS2 Non-structural protein 9 | ||||
8gwk | I | 100.0 | R1AB_SARS2 Non-structural protein 9 | ||||
8gwe | G | 100.0 | R1AB_SARS2 Non-structural protein 9 | ||||
6wxd | A | 100.0 | R1AB_SARS2 Non-structural protein 9 | ||||
8gwb | G | 100.0 | R1AB_SARS2 Non-structural protein 9 | ||||
7egq | F | 100.0 | R1AB_SARS2 Non-structural protein 9 | ||||
7egq | N | 100.0 | R1AB_SARS2 Non-structural protein 9 | ||||
7cyq | I | 100.0 | R1AB_SARS2 Non-structural protein 9 | ||||
8gwf | I | 100.0 | R1AB_SARS2 Non-structural protein 9 | ||||
8gwg | I | 100.0 | R1AB_SARS2 Non-structural protein 9 | ||||
7n3k | D | 100.0 | R1AB_SARS2 Non-structural protein 9 | ||||
7n3k | E | 100.0 | R1AB_SARS2 Non-structural protein 9 | ||||
7n3k | F | 100.0 | R1AB_SARS2 Non-structural protein 9 | ||||
7n3k | H | 100.0 | R1AB_SARS2 Non-structural protein 9 | ||||
7n3k | A | 100.0 | R1AB_SARS2 Non-structural protein 9 | ||||
7n3k | C | 100.0 | R1AB_SARS2 Non-structural protein 9 | ||||
7n3k | B | 100.0 | R1AB_SARS2 Non-structural protein 9 | ||||
7kri | C | 100.0 | R1AB_SARS2 Non-structural protein 9 | ||||
6w9q | A | 100.0 | R1AB_SARS2 3C-like proteinase peptide, Non-structural protein 9 fusion | ||||
6wc1 | A | 100.0 | SARS-coV-2 Non-structural protein 9 | ||||
6wc1 | B | 100.0 | SARS-coV-2 Non-structural protein 9 | ||||
1uw7 | A | 97.3 | R1AB_CVHSA NSP9 | ||||
6wxd | B | 100.0 | R1AB_SARS2 Non-structural protein 9 | ||||
6w4b | A | 100.0 | R1AB_SARS2 Non-structural protein 9 | ||||
1qz8 | A | 97.3 | R1AB_CVHSA polyprotein 1ab | ||||
7bwq | F | 100.0 | Nsp9 | ||||
7bwq | A | 100.0 | Nsp9 | ||||
7bwq | E | 100.0 | Nsp9 | ||||
7bwq | B | 100.0 | Nsp9 | ||||
1qz8 | B | 97.3 | R1AB_CVHSA polyprotein 1ab | ||||
7bwq | C | 100.0 | Nsp9 | ||||
7bwq | D | 100.0 | Nsp9 | ||||
3ee7 | B | 96.3 | R1A_CVHSA Replicase polyprotein 1a | ||||
3ee7 | D | 96.3 | R1A_CVHSA Replicase polyprotein 1a | ||||
3ee7 | C | 96.3 | R1A_CVHSA Replicase polyprotein 1a | ||||
3ee7 | A | 96.2 | R1A_CVHSA Replicase polyprotein 1a | ||||
8sq9 | E | 100.0 | R1AB_SARS2 Non-structural protein 9 | ||||
8dqu | C | 100.0 | R1AB_SARS2 Non-structural protein 9 | ||||
8dqu | D | 100.0 | R1AB_SARS2 Non-structural protein 9 | ||||
7thm | E | 100.0 | R1AB_SARS2 Non-structural protein 9 | ||||
2j97 | A | 54.9 | R1A_CVH22 REPLICASE POLYPROTEIN 1AB | ||||
2j98 | A | 43.4 | R1A_CVH22 REPLICASE POLYPROTEIN 1AB | ||||
2j98 | B | 50.0 | R1A_CVH22 REPLICASE POLYPROTEIN 1AB | ||||
5hiz | B | 50.0 | R1AB_PEDV7 Non-structural protein 9 | ||||
5hiz | A | 50.0 | R1AB_PEDV7 Non-structural protein 9 | ||||
5hiy | B | 44.8 | R1AB_PEDV7 Non-structural protein 9 | ||||
5hiy | A | 49.3 | R1AB_PEDV7 Non-structural protein 9 | ||||
5hiy | C | 50.7 | R1AB_PEDV7 Non-structural protein 9 | ||||
5ym8 | A | 40.0 | X2G6C4_9NIDO nsp9 | ||||
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue. |
HETERO | |||||||
113 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
7cyq | A | R1AB_SARS2 RNA-directed RNA polymerase[926 aa] | I | 100.0 /100.0 |
12 /12 |
R1AB_SARS2 Non-structural protein 9 | |
7eiz | A | R1AB_SARS2 RNA-directed RNA polymerase[926 aa] | E | 100.0 /100.0 |
11 /11 |
R1AB_SARS2 Non-structural protein 9 | |
7thm | A | R1AB_SARS2 RNA-directed RNA polymerase[860 aa] | E | 100.0 /100.0 |
11 /11 |
R1AB_SARS2 Non-structural protein 9 | |
8gw1 | A | R1AB_SARS2 Replicase polyprotein 1ab[928 aa] | I | 100.0 /100.0 |
11 /11 |
R1AB_SARS2 Non-structural protein 9 | |
8gwb | A | R1AB_SARS2 RNA-directed RNA polymerase[926 aa] | G | 100.0 /100.0 |
11 /11 |
R1AB_SARS2 Non-structural protein 9 | |
8gwe | A | R1AB_SARS2 RNA-directed RNA polymerase[931 aa] | G | 100.0 /100.0 |
13 /13 |
R1AB_SARS2 Non-structural protein 9 | |
8gwf | A | R1AB_SARS2 RNA-directed RNA polymerase[931 aa] | I | 100.0 /100.0 |
13 /13 |
R1AB_SARS2 Non-structural protein 9 | |
8gwg | A | R1AB_SARS2 RNA-directed RNA polymerase[931 aa] | I | 100.0 /100.0 |
13 /13 |
R1AB_SARS2 Non-structural protein 9 | |
8gwi | A | R1AB_SARS2 RNA-directed RNA polymerase[931 aa] | I | 100.0 /100.0 |
13 /13 |
R1AB_SARS2 Non-structural protein 9 | |
8gwk | A | R1AB_SARS2 RNA-directed RNA polymerase[931 aa] | I | 100.0 /100.0 |
12 /12 |
R1AB_SARS2 Non-structural protein 9 | |
8gwm | A | R1AB_SARS2 RNA-directed RNA polymerase[928 aa] | G | 100.0 /100.0 |
12 /12 |
R1AB_SARS2 Non-structural protein 9 | |
8gwn | A | R1AB_SARS2 RNA-directed RNA polymerase[926 aa] | I | 100.0 /100.0 |
10 /10 |
R1AB_SARS2 Non-structural protein 9 | |
8gwo | A | R1AB_SARS2 RNA-directed RNA polymerase[926 aa] | I | 100.0 /100.0 |
12 /12 |
R1AB_SARS2 Non-structural protein 9 | |
8sq9 | A | R1AB_SARS2 RNA-directed RNA polymerase[926 aa] | E | 100.0 /100.0 |
14 /14 |
R1AB_SARS2 Non-structural protein 9 | |
8sqj | A | R1AB_SARS2 RNA-directed RNA polymerase[929 aa] | E | 100.0 /100.0 |
14 /14 |
R1AB_SARS2 Non-structural protein 9 | |
8sqk | A | R1AB_SARS2 RNA-directed RNA polymerase nsp12[929 aa] | E | 100.0 /100.0 |
12 /12 |
R1AB_SARS2 Non-structural protein 9 | |
7eiz | I | R1AB_SARS2 Proofreading exoribonuclease[523 aa] | E | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 9 | |
8dqu | A | Nanobody[127 aa] | C | 100.0 /100.0 |
15 /15 |
R1AB_SARS2 Non-structural protein 9 | |
8dqu | A | Nanobody[127 aa] | C | 100.0 /100.0 |
15 /15 |
R1AB_SARS2 Non-structural protein 9 | |
8dqu | A | Nanobody[127 aa] | C | 100.0 /100.0 |
15 /15 |
R1AB_SARS2 Non-structural protein 9 | |
8dqu | A | Nanobody[127 aa] | C | 100.0 /100.0 |
15 /15 |
R1AB_SARS2 Non-structural protein 9 | |
8dqu | A | Nanobody[127 aa] | C | 100.0 /100.0 |
15 /15 |
R1AB_SARS2 Non-structural protein 9 | |
8dqu | A | Nanobody[127 aa] | C | 100.0 /100.0 |
15 /15 |
R1AB_SARS2 Non-structural protein 9 | |
8dqu | B | Nanobody[126 aa] | D | 100.0 /100.0 |
15 /15 |
R1AB_SARS2 Non-structural protein 9 | |
8dqu | B | Nanobody[126 aa] | D | 100.0 /100.0 |
15 /15 |
R1AB_SARS2 Non-structural protein 9 | |
8dqu | B | Nanobody[126 aa] | D | 100.0 /100.0 |
15 /15 |
R1AB_SARS2 Non-structural protein 9 | |
8dqu | B | Nanobody[126 aa] | D | 100.0 /100.0 |
15 /15 |
R1AB_SARS2 Non-structural protein 9 | |
8dqu | B | Nanobody[126 aa] | D | 100.0 /100.0 |
15 /15 |
R1AB_SARS2 Non-structural protein 9 | |
8dqu | B | Nanobody[126 aa] | D | 100.0 /100.0 |
15 /15 |
R1AB_SARS2 Non-structural protein 9 | |
2j98 | B | R1A_CVH22 REPLICASE POLYPROTEIN 1AB[102 aa] | A | 66.7 /43.4 |
15 /15 |
R1A_CVH22 REPLICASE POLYPROTEIN 1AB | |
2j98 | A | R1A_CVH22 REPLICASE POLYPROTEIN 1AB[106 aa] | B | 72.7 /50.0 |
11 /14 |
R1A_CVH22 REPLICASE POLYPROTEIN 1AB | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
NUCLEOTIDE | |||||||
113 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
8gwb | H | RNA (5'-R(P*AP*U)-3') | G | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 9 | |
8gwe | H | RNA (5'-R(P*AP*UP*UP*A)-3') | G | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 9 | |
8sqj | H | SARS-CoV-2 5' UTR | E | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 9 | |
8sqk | H | SARS-CoV-2 5' UTR | E | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 9 | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
COMPOUND | |||||||
113 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
7cyq | L |
GDP
GUANOSINE-5'-DIPHOSPHATE[28 atoms] |
I | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 9 | |
7kri | E |
X0Y
1,3-dimethyl-1H-pyrrolo[3,4-d]pyrimidine-2,4(3H,6H.. |
A | 100.0 /100.0 |
6 /7 |
R1AB_SARS2 Non-structural protein 9 | |
7kri | E |
X0Y
1,3-dimethyl-1H-pyrrolo[3,4-d]pyrimidine-2,4(3H,6H.. |
A | 100.0 /100.0 |
6 /7 |
R1AB_SARS2 Non-structural protein 9 | |
7kri | F |
X0Y
1,3-dimethyl-1H-pyrrolo[3,4-d]pyrimidine-2,4(3H,6H.. |
A | 100.0 /100.0 |
3 /4 |
R1AB_SARS2 Non-structural protein 9 | |
7kri | F |
X0Y
1,3-dimethyl-1H-pyrrolo[3,4-d]pyrimidine-2,4(3H,6H.. |
A | 100.0 /100.0 |
3 /4 |
R1AB_SARS2 Non-structural protein 9 | |
7kri | H |
X0Y
1,3-dimethyl-1H-pyrrolo[3,4-d]pyrimidine-2,4(3H,6H.. |
B | 100.0 /100.0 |
5 /6 |
R1AB_SARS2 Non-structural protein 9 | |
7kri | H |
X0Y
1,3-dimethyl-1H-pyrrolo[3,4-d]pyrimidine-2,4(3H,6H.. |
B | 100.0 /100.0 |
5 /6 |
R1AB_SARS2 Non-structural protein 9 | |
7kri | I |
X0Y
1,3-dimethyl-1H-pyrrolo[3,4-d]pyrimidine-2,4(3H,6H.. |
B | 100.0 /100.0 |
2 /3 |
R1AB_SARS2 Non-structural protein 9 | |
7kri | I |
X0Y
1,3-dimethyl-1H-pyrrolo[3,4-d]pyrimidine-2,4(3H,6H.. |
B | 100.0 /100.0 |
2 /3 |
R1AB_SARS2 Non-structural protein 9 | |
7kri | L |
X0Y
1,3-dimethyl-1H-pyrrolo[3,4-d]pyrimidine-2,4(3H,6H.. |
C | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Non-structural protein 9 | |
7kri | L |
X0Y
1,3-dimethyl-1H-pyrrolo[3,4-d]pyrimidine-2,4(3H,6H.. |
C | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Non-structural protein 9 | |
7kri | M |
X0Y
1,3-dimethyl-1H-pyrrolo[3,4-d]pyrimidine-2,4(3H,6H.. |
C | 100.0 /100.0 |
3 /4 |
R1AB_SARS2 Non-structural protein 9 | |
7kri | M |
X0Y
1,3-dimethyl-1H-pyrrolo[3,4-d]pyrimidine-2,4(3H,6H.. |
C | 100.0 /100.0 |
3 /4 |
R1AB_SARS2 Non-structural protein 9 | |
7n3k | I |
ODN
(1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14.. |
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 9 | |
7n3k | J |
ODN
(1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14.. |
A | 100.0 /100.0 |
2 /3 |
R1AB_SARS2 Non-structural protein 9 | |
7n3k | I |
ODN
(1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14.. |
B | 100.0 /100.0 |
2 /3 |
R1AB_SARS2 Non-structural protein 9 | |
7n3k | J |
ODN
(1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14.. |
B | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Non-structural protein 9 | |
7n3k | L |
ODN
(1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14.. |
C | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Non-structural protein 9 | |
7n3k | M |
ODN
(1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14.. |
C | 100.0 /100.0 |
1 /2 |
R1AB_SARS2 Non-structural protein 9 | |
7n3k | L |
ODN
(1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14.. |
D | 100.0 /100.0 |
3 /4 |
R1AB_SARS2 Non-structural protein 9 | |
7n3k | M |
ODN
(1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14.. |
D | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Non-structural protein 9 | |
7n3k | O |
ODN
(1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14.. |
E | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Non-structural protein 9 | |
7n3k | P |
ODN
(1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14.. |
E | 100.0 /100.0 |
2 /3 |
R1AB_SARS2 Non-structural protein 9 | |
7n3k | O |
ODN
(1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14.. |
F | 100.0 /100.0 |
2 /3 |
R1AB_SARS2 Non-structural protein 9 | |
7n3k | P |
ODN
(1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14.. |
F | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Non-structural protein 9 | |
7n3k | R |
ODN
(1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14.. |
G | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Non-structural protein 9 | |
7n3k | T |
ODN
(1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14.. |
G | 100.0 /100.0 |
2 /3 |
R1AB_SARS2 Non-structural protein 9 | |
7n3k | R |
ODN
(1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14.. |
H | 100.0 /100.0 |
2 /3 |
R1AB_SARS2 Non-structural protein 9 | |
7n3k | T |
ODN
(1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14.. |
H | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Non-structural protein 9 | |
8gw1 | T |
U5P
URIDINE-5'-MONOPHOSPHATE[20 atoms] |
I | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 9 | |
8gwo | S |
U5P
URIDINE-5'-MONOPHOSPHATE[20 atoms] |
I | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 9 | |
8gwf | L |
GTP
GUANOSINE-5'-TRIPHOSPHATE[32 atoms] |
I | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 9 | |
8gwg | L |
GTP
GUANOSINE-5'-TRIPHOSPHATE[32 atoms] |
I | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 9 | |
8gwi | L |
GTP
GUANOSINE-5'-TRIPHOSPHATE[32 atoms] |
I | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 9 | |
8gwk | T |
F86
[(2~{R},3~{S},4~{R},5~{R})-5-(4-azanylpyrrolo[2,1-.. |
I | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 9 | |
8gwm | S |
6GS
2'-deoxy-2'-fluoro-2'-methyluridine 5'-(trihydroge.. |
G | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 9 | |
8sq9 | O |
WSB
5'-O-[(S)-hydroxy{[(S)-hydroxy(phosphonooxy)phosph.. |
E | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 9 | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
METAL | |||||||
113 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
7cyq | M |
MG
MAGNESIUM ION[1 atoms] |
I | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 9 | |
8sq9 | N |
MG
MAGNESIUM ION[1 atoms] |
E | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 9 | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
HOMO | |||||||
113 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
1qz8 | A | R1AB_CVHSA polyprotein 1ab[111 aa] | A | 100.0 /97.3 |
6 /6 |
R1AB_CVHSA polyprotein 1ab | |
1qz8 | A | R1AB_CVHSA polyprotein 1ab[111 aa] | A | 100.0 /97.3 |
6 /6 |
R1AB_CVHSA polyprotein 1ab | |
1qz8 | B | R1AB_CVHSA polyprotein 1ab[110 aa] | A | 100.0 /97.3 |
17 /17 |
R1AB_CVHSA polyprotein 1ab | |
1qz8 | B | R1AB_CVHSA polyprotein 1ab[110 aa] | A | 100.0 /97.3 |
17 /17 |
R1AB_CVHSA polyprotein 1ab | |
1qz8 | A | R1AB_CVHSA polyprotein 1ab[111 aa] | B | 100.0 /97.3 |
17 /17 |
R1AB_CVHSA polyprotein 1ab | |
1qz8 | A | R1AB_CVHSA polyprotein 1ab[111 aa] | B | 100.0 /97.3 |
17 /17 |
R1AB_CVHSA polyprotein 1ab | |
3ee7 | B | R1A_CVHSA Replicase polyprotein 1a[115 aa] | A | 92.9 /96.2 |
14 /14 |
R1A_CVHSA Replicase polyprotein 1a | |
3ee7 | A | R1A_CVHSA Replicase polyprotein 1a[106 aa] | B | 93.3 /96.3 |
15 /17 |
R1A_CVHSA Replicase polyprotein 1a | |
3ee7 | D | R1A_CVHSA Replicase polyprotein 1a[112 aa] | C | 93.3 /96.3 |
15 /17 |
R1A_CVHSA Replicase polyprotein 1a | |
3ee7 | C | R1A_CVHSA Replicase polyprotein 1a[110 aa] | D | 91.7 /96.3 |
12 /14 |
R1A_CVHSA Replicase polyprotein 1a | |
6w4b | B | R1AB_SARS2 Non-structural protein 9[116 aa] | A | 100.0 /100.0 |
16 /16 |
R1AB_SARS2 Non-structural protein 9 | |
6w4b | A | R1AB_SARS2 Non-structural protein 9[109 aa] | B | 100.0 /100.0 |
17 /18 |
R1AB_SARS2 Non-structural protein 9 | |
6w9q | A | R1AB_SARS2 3C-like proteinase peptide, Non-structural protein.. | A | 100.0 /100.0 |
20 /24 |
R1AB_SARS2 3C-like proteinase peptide, Non-structural protein.. | |
6w9q | A | R1AB_SARS2 3C-like proteinase peptide, Non-structural protein.. | A | 100.0 /100.0 |
20 /24 |
R1AB_SARS2 3C-like proteinase peptide, Non-structural protein.. | |
6wc1 | B | SARS-coV-2 Non-structural protein 9[111 aa] | A | 100.0 /100.0 |
18 /18 |
SARS-coV-2 Non-structural protein 9 | |
6wc1 | A | SARS-coV-2 Non-structural protein 9[112 aa] | B | 100.0 /100.0 |
22 /22 |
SARS-coV-2 Non-structural protein 9 | |
6wxd | B | R1AB_SARS2 Non-structural protein 9[110 aa] | A | 100.0 /100.0 |
18 /18 |
R1AB_SARS2 Non-structural protein 9 | |
6wxd | A | R1AB_SARS2 Non-structural protein 9[113 aa] | B | 100.0 /100.0 |
19 /19 |
R1AB_SARS2 Non-structural protein 9 | |
7bwq | B | Nsp9[108 aa] | A | 100.0 /100.0 |
13 /13 |
Nsp9 | |
7bwq | A | Nsp9[108 aa] | B | 100.0 /100.0 |
11 /11 |
Nsp9 | |
7bwq | D | Nsp9[106 aa] | C | 100.0 /100.0 |
10 /10 |
Nsp9 | |
7bwq | C | Nsp9[107 aa] | D | 100.0 /100.0 |
10 /10 |
Nsp9 | |
7bwq | F | Nsp9[108 aa] | E | 100.0 /100.0 |
12 /12 |
Nsp9 | |
7bwq | E | Nsp9[108 aa] | F | 100.0 /100.0 |
13 /13 |
Nsp9 | |
7kri | B | R1AB_SARS2 Non-structural protein 9[127 aa] | A | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 9 | |
7kri | B | R1AB_SARS2 Non-structural protein 9[127 aa] | A | 100.0 /100.0 |
19 /22 |
R1AB_SARS2 Non-structural protein 9 | |
7kri | B | R1AB_SARS2 Non-structural protein 9[127 aa] | A | 100.0 /100.0 |
19 /22 |
R1AB_SARS2 Non-structural protein 9 | |
7kri | B | R1AB_SARS2 Non-structural protein 9[127 aa] | A | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 9 | |
7kri | C | R1AB_SARS2 Non-structural protein 9[123 aa] | A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 9 | |
7kri | C | R1AB_SARS2 Non-structural protein 9[123 aa] | A | 100.0 /100.0 |
15 /18 |
R1AB_SARS2 Non-structural protein 9 | |
7kri | C | R1AB_SARS2 Non-structural protein 9[123 aa] | A | 100.0 /100.0 |
15 /18 |
R1AB_SARS2 Non-structural protein 9 | |
7kri | C | R1AB_SARS2 Non-structural protein 9[123 aa] | A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 9 | |
7kri | A | R1AB_SARS2 Non-structural protein 9[127 aa] | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 9 | |
7kri | A | R1AB_SARS2 Non-structural protein 9[127 aa] | B | 100.0 /100.0 |
19 /22 |
R1AB_SARS2 Non-structural protein 9 | |
7kri | A | R1AB_SARS2 Non-structural protein 9[127 aa] | B | 100.0 /100.0 |
19 /22 |
R1AB_SARS2 Non-structural protein 9 | |
7kri | A | R1AB_SARS2 Non-structural protein 9[127 aa] | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 9 | |
7kri | B | R1AB_SARS2 Non-structural protein 9[127 aa] | B | 100.0 /100.0 |
11 /14 |
R1AB_SARS2 Non-structural protein 9 | |
7kri | B | R1AB_SARS2 Non-structural protein 9[127 aa] | B | 100.0 /100.0 |
11 /14 |
R1AB_SARS2 Non-structural protein 9 | |
7kri | C | R1AB_SARS2 Non-structural protein 9[123 aa] | B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 9 | |
7kri | C | R1AB_SARS2 Non-structural protein 9[123 aa] | B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 9 | |
7kri | A | R1AB_SARS2 Non-structural protein 9[127 aa] | C | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Non-structural protein 9 | |
7kri | A | R1AB_SARS2 Non-structural protein 9[127 aa] | C | 100.0 /100.0 |
19 /22 |
R1AB_SARS2 Non-structural protein 9 | |
7kri | A | R1AB_SARS2 Non-structural protein 9[127 aa] | C | 100.0 /100.0 |
19 /22 |
R1AB_SARS2 Non-structural protein 9 | |
7kri | A | R1AB_SARS2 Non-structural protein 9[127 aa] | C | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Non-structural protein 9 | |
7kri | B | R1AB_SARS2 Non-structural protein 9[127 aa] | C | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 9 | |
7kri | B | R1AB_SARS2 Non-structural protein 9[127 aa] | C | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 9 | |
7kri | C | R1AB_SARS2 Non-structural protein 9[123 aa] | C | 100.0 /100.0 |
20 /23 |
R1AB_SARS2 Non-structural protein 9 | |
7kri | C | R1AB_SARS2 Non-structural protein 9[123 aa] | C | 100.0 /100.0 |
20 /23 |
R1AB_SARS2 Non-structural protein 9 | |
7n3k | B | R1AB_SARS2 Non-structural protein 9[124 aa] | A | 100.0 /100.0 |
21 /24 |
R1AB_SARS2 Non-structural protein 9 | |
7n3k | A | R1AB_SARS2 Non-structural protein 9[124 aa] | B | 100.0 /100.0 |
19 /22 |
R1AB_SARS2 Non-structural protein 9 | |
7n3k | D | R1AB_SARS2 Non-structural protein 9[124 aa] | C | 100.0 /100.0 |
20 /22 |
R1AB_SARS2 Non-structural protein 9 | |
7n3k | C | R1AB_SARS2 Non-structural protein 9[124 aa] | D | 100.0 /100.0 |
18 /20 |
R1AB_SARS2 Non-structural protein 9 | |
7n3k | F | R1AB_SARS2 Non-structural protein 9[124 aa] | E | 100.0 /100.0 |
21 /24 |
R1AB_SARS2 Non-structural protein 9 | |
7n3k | E | R1AB_SARS2 Non-structural protein 9[124 aa] | F | 100.0 /100.0 |
19 /23 |
R1AB_SARS2 Non-structural protein 9 | |
7n3k | H | R1AB_SARS2 Non-structural protein 9[124 aa] | G | 100.0 /100.0 |
20 /22 |
R1AB_SARS2 Non-structural protein 9 | |
7n3k | G | R1AB_SARS2 Non-structural protein 9[121 aa] | H | 100.0 /100.0 |
17 /20 |
R1AB_SARS2 Non-structural protein 9 | |
8dqu | D | R1AB_SARS2 Non-structural protein 9[74 aa] | C | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 Non-structural protein 9 | |
8dqu | D | R1AB_SARS2 Non-structural protein 9[74 aa] | C | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 Non-structural protein 9 | |
8dqu | D | R1AB_SARS2 Non-structural protein 9[74 aa] | C | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 Non-structural protein 9 | |
8dqu | D | R1AB_SARS2 Non-structural protein 9[74 aa] | C | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 Non-structural protein 9 | |
8dqu | D | R1AB_SARS2 Non-structural protein 9[74 aa] | C | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 Non-structural protein 9 | |
8dqu | D | R1AB_SARS2 Non-structural protein 9[74 aa] | C | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 Non-structural protein 9 | |
8dqu | C | R1AB_SARS2 Non-structural protein 9[78 aa] | D | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Non-structural protein 9 | |
8dqu | C | R1AB_SARS2 Non-structural protein 9[78 aa] | D | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Non-structural protein 9 | |
8dqu | C | R1AB_SARS2 Non-structural protein 9[78 aa] | D | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Non-structural protein 9 | |
8dqu | C | R1AB_SARS2 Non-structural protein 9[78 aa] | D | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Non-structural protein 9 | |
8dqu | C | R1AB_SARS2 Non-structural protein 9[78 aa] | D | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Non-structural protein 9 | |
8dqu | C | R1AB_SARS2 Non-structural protein 9[78 aa] | D | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Non-structural protein 9 | |
2j97 | A | R1A_CVH22 REPLICASE POLYPROTEIN 1AB[98 aa] | A | 86.4 /54.9 |
22 /22 |
R1A_CVH22 REPLICASE POLYPROTEIN 1AB | |
2j97 | A | R1A_CVH22 REPLICASE POLYPROTEIN 1AB[98 aa] | A | 86.4 /54.9 |
22 /22 |
R1A_CVH22 REPLICASE POLYPROTEIN 1AB | |
5hiy | B | R1AB_PEDV7 Non-structural protein 9[96 aa] | A | 44.4 /49.3 |
9 /10 |
R1AB_PEDV7 Non-structural protein 9 | |
5hiy | A | R1AB_PEDV7 Non-structural protein 9[95 aa] | B | 66.7 /44.8 |
9 /9 |
R1AB_PEDV7 Non-structural protein 9 | |
5hiy | C | R1AB_PEDV7 Non-structural protein 9[93 aa] | C | 57.1 /50.7 |
7 /7 |
R1AB_PEDV7 Non-structural protein 9 | |
5hiy | C | R1AB_PEDV7 Non-structural protein 9[93 aa] | C | 57.1 /50.7 |
7 /7 |
R1AB_PEDV7 Non-structural protein 9 | |
5hiz | B | R1AB_PEDV7 Non-structural protein 9[96 aa] | A | 55.6 /50.0 |
9 /11 |
R1AB_PEDV7 Non-structural protein 9 | |
5hiz | A | R1AB_PEDV7 Non-structural protein 9[96 aa] | B | 66.7 /50.0 |
9 /11 |
R1AB_PEDV7 Non-structural protein 9 | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
PRECIPITANT | |||||||
113 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
1qz8 | C |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /97.3 |
2 /2 |
R1AB_CVHSA polyprotein 1ab | |
1qz8 | C |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /97.3 |
3 /3 |
R1AB_CVHSA polyprotein 1ab | |
1qz8 | C |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /97.3 |
3 /3 |
R1AB_CVHSA polyprotein 1ab | |
1qz8 | C |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /97.3 |
2 /2 |
R1AB_CVHSA polyprotein 1ab | |
1qz8 | D |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /97.3 |
1 /1 |
R1AB_CVHSA polyprotein 1ab | |
1qz8 | D |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /97.3 |
1 /1 |
R1AB_CVHSA polyprotein 1ab | |
1qz8 | D |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /97.3 |
1 /1 |
R1AB_CVHSA polyprotein 1ab | |
1qz8 | D |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /97.3 |
1 /1 |
R1AB_CVHSA polyprotein 1ab | |
1qz8 | E |
SO4
SULFATE ION[5 atoms] |
A | 66.7 /97.3 |
3 /3 |
R1AB_CVHSA polyprotein 1ab | |
1qz8 | E |
SO4
SULFATE ION[5 atoms] |
A | 66.7 /97.3 |
3 /3 |
R1AB_CVHSA polyprotein 1ab | |
1qz8 | C |
SO4
SULFATE ION[5 atoms] |
B | 100.0 /97.3 |
1 /1 |
R1AB_CVHSA polyprotein 1ab | |
1qz8 | C |
SO4
SULFATE ION[5 atoms] |
B | 100.0 /97.3 |
1 /1 |
R1AB_CVHSA polyprotein 1ab | |
1qz8 | D |
SO4
SULFATE ION[5 atoms] |
B | 100.0 /97.3 |
3 /3 |
R1AB_CVHSA polyprotein 1ab | |
1qz8 | D |
SO4
SULFATE ION[5 atoms] |
B | 100.0 /97.3 |
3 /3 |
R1AB_CVHSA polyprotein 1ab | |
1qz8 | F |
SO4
SULFATE ION[5 atoms] |
B | 50.0 /97.3 |
2 /2 |
R1AB_CVHSA polyprotein 1ab | |
1qz8 | F |
SO4
SULFATE ION[5 atoms] |
B | 50.0 /97.3 |
2 /2 |
R1AB_CVHSA polyprotein 1ab | |
2j97 | C |
SO4
SULFATE ION[5 atoms] |
A | 40.0 /54.9 |
5 /5 |
R1A_CVH22 REPLICASE POLYPROTEIN 1AB | |
2j97 | C |
SO4
SULFATE ION[5 atoms] |
A | 40.0 /54.9 |
5 /5 |
R1A_CVH22 REPLICASE POLYPROTEIN 1AB | |
2j97 | D |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /54.9 |
1 /2 |
R1A_CVH22 REPLICASE POLYPROTEIN 1AB | |
2j97 | D |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /54.9 |
1 /2 |
R1A_CVH22 REPLICASE POLYPROTEIN 1AB | |
6wc1 | C |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /100.0 |
2 /2 |
SARS-coV-2 Non-structural protein 9 | |
6wxd | C |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 9 | |
6wxd | D |
SO4
SULFATE ION[5 atoms] |
B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 9 | |
6wxd | E |
SO4
SULFATE ION[5 atoms] |
B | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Non-structural protein 9 | |
7bwq | G |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /100.0 |
3 /3 |
Nsp9 | |
7bwq | H |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /100.0 |
5 /5 |
Nsp9 | |
7bwq | G |
SO4
SULFATE ION[5 atoms] |
B | 100.0 /100.0 |
1 /1 |
Nsp9 | |
7bwq | I |
SO4
SULFATE ION[5 atoms] |
B | 100.0 /100.0 |
4 /4 |
Nsp9 | |
7bwq | J |
SO4
SULFATE ION[5 atoms] |
C | 100.0 /100.0 |
4 /4 |
Nsp9 | |
7bwq | K |
SO4
SULFATE ION[5 atoms] |
E | 100.0 /100.0 |
2 /2 |
Nsp9 | |
7bwq | K |
SO4
SULFATE ION[5 atoms] |
F | 100.0 /100.0 |
2 /2 |
Nsp9 | |
7kri | D |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /100.0 |
2 /3 |
R1AB_SARS2 Non-structural protein 9 | |
7kri | D |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /100.0 |
2 /3 |
R1AB_SARS2 Non-structural protein 9 | |
7kri | G |
SO4
SULFATE ION[5 atoms] |
B | 100.0 /100.0 |
2 /3 |
R1AB_SARS2 Non-structural protein 9 | |
7kri | G |
SO4
SULFATE ION[5 atoms] |
B | 100.0 /100.0 |
2 /3 |
R1AB_SARS2 Non-structural protein 9 | |
7kri | J |
SO4
SULFATE ION[5 atoms] |
C | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 9 | |
7kri | J |
SO4
SULFATE ION[5 atoms] |
C | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 9 | |
7n3k | K |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 9 | |
7n3k | K |
SO4
SULFATE ION[5 atoms] |
B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 9 | |
7n3k | N |
SO4
SULFATE ION[5 atoms] |
C | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 9 | |
7n3k | N |
SO4
SULFATE ION[5 atoms] |
D | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 9 | |
7n3k | Q |
SO4
SULFATE ION[5 atoms] |
E | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 9 | |
7n3k | Q |
SO4
SULFATE ION[5 atoms] |
F | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 9 | |
7n3k | S |
SO4
SULFATE ION[5 atoms] |
G | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 9 | |
7n3k | S |
SO4
SULFATE ION[5 atoms] |
H | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 9 | |
3ee7 | E |
PO4
PHOSPHATE ION[5 atoms] |
A | 75.0 /96.2 |
4 /4 |
R1A_CVHSA Replicase polyprotein 1a | |
3ee7 | F |
PO4
PHOSPHATE ION[5 atoms] |
A | 100.0 /96.2 |
1 /1 |
R1A_CVHSA Replicase polyprotein 1a | |
3ee7 | G |
PO4
PHOSPHATE ION[5 atoms] |
A | 100.0 /96.2 |
1 /1 |
R1A_CVHSA Replicase polyprotein 1a | |
3ee7 | F |
PO4
PHOSPHATE ION[5 atoms] |
B | 100.0 /96.3 |
3 /3 |
R1A_CVHSA Replicase polyprotein 1a | |
3ee7 | M |
PO4
PHOSPHATE ION[5 atoms] |
B | 66.7 /96.3 |
3 /3 |
R1A_CVHSA Replicase polyprotein 1a | |
3ee7 | P |
PO4
PHOSPHATE ION[5 atoms] |
C | 66.7 /96.3 |
3 /3 |
R1A_CVHSA Replicase polyprotein 1a | |
3ee7 | W |
PO4
PHOSPHATE ION[5 atoms] |
C | 100.0 /96.3 |
3 /3 |
R1A_CVHSA Replicase polyprotein 1a | |
3ee7 | P |
PO4
PHOSPHATE ION[5 atoms] |
D | 100.0 /96.3 |
1 /1 |
R1A_CVHSA Replicase polyprotein 1a | |
3ee7 | U |
PO4
PHOSPHATE ION[5 atoms] |
D | 100.0 /96.3 |
1 /1 |
R1A_CVHSA Replicase polyprotein 1a | |
3ee7 | V |
PO4
PHOSPHATE ION[5 atoms] |
D | 75.0 /96.3 |
4 /4 |
R1A_CVHSA Replicase polyprotein 1a | |
3ee7 | W |
PO4
PHOSPHATE ION[5 atoms] |
D | 100.0 /96.3 |
1 /1 |
R1A_CVHSA Replicase polyprotein 1a | |
6w9q | B |
PO4
PHOSPHATE ION[5 atoms] |
A | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 3C-like proteinase peptide, Non-structural protein.. | |
6w9q | B |
PO4
PHOSPHATE ION[5 atoms] |
A | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 3C-like proteinase peptide, Non-structural protein.. | |
7kri | K |
MLI
MALONATE ION[7 atoms] |
A | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 9 | |
7kri | K |
MLI
MALONATE ION[7 atoms] |
A | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 9 | |
7kri | K |
MLI
MALONATE ION[7 atoms] |
B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 9 | |
7kri | K |
MLI
MALONATE ION[7 atoms] |
B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 9 | |
7kri | K |
MLI
MALONATE ION[7 atoms] |
C | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 9 | |
7kri | K |
MLI
MALONATE ION[7 atoms] |
C | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 9 | |
7kri | K |
MLI
MALONATE ION[7 atoms] |
C | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 9 | |
7kri | K |
MLI
MALONATE ION[7 atoms] |
C | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 9 | |
7thm | I |
POP
PYROPHOSPHATE 2-[9 atoms] |
E | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 9 | |
3ee7 | H |
GOL
GLYCEROL[6 atoms] |
A | 100.0 /96.2 |
1 /1 |
R1A_CVHSA Replicase polyprotein 1a | |
3ee7 | I |
GOL
GLYCEROL[6 atoms] |
A | 75.0 /96.2 |
4 /4 |
R1A_CVHSA Replicase polyprotein 1a | |
3ee7 | J |
GOL
GLYCEROL[6 atoms] |
A | 100.0 /96.2 |
6 /6 |
R1A_CVHSA Replicase polyprotein 1a | |
3ee7 | K |
GOL
GLYCEROL[6 atoms] |
A | 100.0 /96.2 |
3 /3 |
R1A_CVHSA Replicase polyprotein 1a | |
3ee7 | K |
GOL
GLYCEROL[6 atoms] |
B | 100.0 /96.3 |
1 /1 |
R1A_CVHSA Replicase polyprotein 1a | |
3ee7 | L |
GOL
GLYCEROL[6 atoms] |
B | 100.0 /96.3 |
1 /1 |
R1A_CVHSA Replicase polyprotein 1a | |
3ee7 | N |
GOL
GLYCEROL[6 atoms] |
B | 100.0 /96.3 |
4 /4 |
R1A_CVHSA Replicase polyprotein 1a | |
3ee7 | O |
GOL
GLYCEROL[6 atoms] |
B | 100.0 /96.3 |
3 /3 |
R1A_CVHSA Replicase polyprotein 1a | |
3ee7 | AA |
GOL
GLYCEROL[6 atoms] |
C | 100.0 /96.3 |
1 /1 |
R1A_CVHSA Replicase polyprotein 1a | |
3ee7 | Q |
GOL
GLYCEROL[6 atoms] |
C | 100.0 /96.3 |
5 /5 |
R1A_CVHSA Replicase polyprotein 1a | |
3ee7 | R |
GOL
GLYCEROL[6 atoms] |
C | 100.0 /96.3 |
2 /2 |
R1A_CVHSA Replicase polyprotein 1a | |
3ee7 | S |
GOL
GLYCEROL[6 atoms] |
C | 100.0 /96.3 |
4 /4 |
R1A_CVHSA Replicase polyprotein 1a | |
3ee7 | T |
GOL
GLYCEROL[6 atoms] |
C | 100.0 /96.3 |
2 /2 |
R1A_CVHSA Replicase polyprotein 1a | |
3ee7 | AA |
GOL
GLYCEROL[6 atoms] |
D | 100.0 /96.3 |
2 /2 |
R1A_CVHSA Replicase polyprotein 1a | |
3ee7 | BA |
GOL
GLYCEROL[6 atoms] |
D | 100.0 /96.3 |
2 /2 |
R1A_CVHSA Replicase polyprotein 1a | |
3ee7 | X |
GOL
GLYCEROL[6 atoms] |
D | 100.0 /96.3 |
4 /4 |
R1A_CVHSA Replicase polyprotein 1a | |
3ee7 | Y |
GOL
GLYCEROL[6 atoms] |
D | 100.0 /96.3 |
3 /3 |
R1A_CVHSA Replicase polyprotein 1a | |
3ee7 | Z |
GOL
GLYCEROL[6 atoms] |
D | 66.7 /96.3 |
3 /3 |
R1A_CVHSA Replicase polyprotein 1a | |
2j97 | B |
MPD
(4S)-2-METHYL-2,4-PENTANEDIOL[8 atoms] |
A | 100.0 /54.9 |
4 /5 |
R1A_CVH22 REPLICASE POLYPROTEIN 1AB | |
2j97 | B |
MPD
(4S)-2-METHYL-2,4-PENTANEDIOL[8 atoms] |
A | 100.0 /54.9 |
4 /5 |
R1A_CVH22 REPLICASE POLYPROTEIN 1AB | |
2j98 | C |
DTT
2,3-DIHYDROXY-1,4-DITHIOBUTANE[8 atoms] |
A | 50.0 /43.4 |
6 /6 |
R1A_CVH22 REPLICASE POLYPROTEIN 1AB | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. |