Contact Molecules for Homologous Proteins | ||||
[Summary Bars] |
[SiteTable] |
|
[Back to Search Page] |
[Back to HOMCOS] |
[SupCon3D] |
[help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
27906 | 918 | 28 | P40189(IL6RB_HUMAN) | RecName: Full=Interleukin-6 receptor subunit beta ; Short=IL-6 receptor subunit beta; Short=IL-6R subunit beta; Short=IL-6R-beta; Short=IL-6RB;AltName: Full=CDw130;AltName: Full=Interleukin-6 signal transducer;AltName: Full=Membrane glycoprotein 130; Short=gp130 ;AltName: Full=Oncostatin-M receptor subunit alpha;AltName: CD_antigen=CD130;Flags: Precursor; |
QUERYSEQ |
MLTLQTWLVQALFIFLTTESTGELLDPCGYISPESPVVQLHSNFTAVCVLKEKCMDYFHVNANYIVWKTNHFTIPKEQYTIINRTASSVTFTDIASLNIQLTCNILTFGQLEQNVYGITIISGLPPEKPKNLSCIVNEGKKMRCEWDGGR ETHLETNFTLKSEWATHKFADCKAKRDTPTSCTVDYSTVYFVNIEVWVEAENALGKVTSDHINFDPVYKVKPNPPHNLSVINSEELSSILKLTWTNPSIKSVIILKYNIQYRTKDASTWSQIPPEDTASTRSSFTVQDLKPFTEYVFRIR CMKEDGKGYWSDWSEEASGITYEDRPSKAPSFWYKIDPSHTQGYRTVQLVWKTLPPFEANGKILDYEVTLTRWKSHLQNYTVNATKLTVNLTNDRYLATLTVRNLVGKSDAAVLTIPACDFQATHPVMDLKAFPKDNMLWVEWTTPRESV KKYILEWCVLSDKAPCITDWQQEDGTVHRTYLRGNLAESKCYLITVTPVYADGPGSPESIKAYLKQAPPSKGPTVRTKKVGKNEAVLEWDQLPVDVQNGFIRNYTIFYRTIIGNETAVNVDSSHTEYTLSSLTSDTLYMVRMAAYTDEGG KDGPEFTFTTPKFAQGEIEAIVVPVCLAFLLTTLLGVLFCFNKRDLIKKHIWPNVPDPSKSHIAQWSPHTPPRHNFNSKDQMYSDGNFTDVSVVEIEANDKKPFPEDLKSLDLFKKEKINTEGHSSGIGGSSCMSSSRPSISSSDENESS QNTSSTVQYSTVVHSGYRHQVPSVQVFSRSESTQPLLDSEERPEDLQLVDHVDGGDGILPRQQYFKQNCSQHESSPDISHFERSKQVSSVNEEDFVRLKQQISDHISQSCGSGQMKMFQEVSAADAFGPGTEGQVERFETVGMEAATDEG MPKSYLPQTVRQGGYMPQ |
918 | region | name | description |
1-22 | SIGNAL | ||
23-918 | CHAIN | /note="Interleukin-6 receptor subunit beta" /id="PRO_0000010899" | |
23-619 | TOPO_DOM | /note="Extracellular" | |
620-641 | TRANSMEM | /note="Helical" | |
642-918 | TOPO_DOM | /note="Cytoplasmic" | |
26-120 | DOMAIN | /note="Ig-like C2-type" | |
125-216 | DOMAIN | /note="Fibronectin type-III 1" | |
224-324 | DOMAIN | /note="Fibronectin type-III 2" | |
329-424 | DOMAIN | /note="Fibronectin type-III 3" | |
426-517 | DOMAIN | /note="Fibronectin type-III 4" | |
518-613 | DOMAIN | /note="Fibronectin type-III 5" | |
660-681 | REGION | /note="Disordered" | |
722-758 | REGION | /note="Disordered" | |
724-758 | COMPBIAS | /note="Polar residues" | |
1-918 | DISORDER | predicted by DISOPRED |
MONOMER | |||||||
918 | |||||||
pdb_id | a1 | identity[%]2 | description | ||||
8d82 | F | 100.0 | IL6RB_HUMAN Interleukin-6 receptor subunit beta | ||||
8d82 | C | 100.0 | IL6RB_HUMAN Interleukin-6 receptor subunit beta | ||||
3l5h | A | 100.0 | IL6RB_HUMAN Interleukin-6 receptor subunit beta | ||||
8dpt | D | 100.0 | IL6RB_HUMAN Interleukin-6 receptor subunit beta | ||||
8dpt | A | 100.0 | IL6RB_HUMAN Interleukin-6 receptor subunit beta | ||||
8d7r | D | 100.0 | IL6RB_HUMAN Interleukin-6 receptor subunit beta | ||||
8d74 | A | 100.0 | IL6RB_HUMAN Interleukin-6 receptor subunit beta | ||||
8d6a | B | 100.0 | IL6RB_HUMAN Interleukin-6 receptor subunit beta | ||||
1i1r | A | 100.0 | IL6RB_HUMAN INTERLEUKIN-6 RECEPTOR BETA CHAIN | ||||
8dpu | M | 100.0 | IL6RB_HUMAN Interleukin-6 receptor subunit beta | ||||
8dpu | P | 100.0 | IL6RB_HUMAN Interleukin-6 receptor subunit beta | ||||
8dpu | J | 100.0 | IL6RB_HUMAN Interleukin-6 receptor subunit beta | ||||
8dpu | G | 100.0 | IL6RB_HUMAN Interleukin-6 receptor subunit beta | ||||
8dpu | D | 100.0 | IL6RB_HUMAN Interleukin-6 receptor subunit beta | ||||
8dpu | A | 100.0 | IL6RB_HUMAN Interleukin-6 receptor subunit beta | ||||
7u7n | B | 100.0 | IL6RB_HUMAN Interleukin-6 receptor subunit beta | ||||
1p9m | A | 100.0 | IL6RB_HUMAN Interleukin-6 receptor beta chain | ||||
8dps | D | 100.0 | IL6RB_HUMAN Interleukin-6 receptor subunit beta | ||||
8dps | A | 100.0 | IL6RB_HUMAN Interleukin-6 receptor subunit beta | ||||
8d85 | D | 100.0 | IL6RB_HUMAN Interleukin-6 receptor subunit beta | ||||
3l5i | A | 100.0 | IL6RB_HUMAN Interleukin-6 receptor subunit beta | ||||
3l5j | B | 100.0 | IL6RB_HUMAN Interleukin-6 receptor subunit beta | ||||
3l5j | A | 100.0 | IL6RB_HUMAN Interleukin-6 receptor subunit beta | ||||
1bqu | B | 99.5 | IL6RB_HUMAN PROTEIN (GP130) | ||||
1bqu | A | 99.5 | IL6RB_HUMAN PROTEIN (GP130) | ||||
1pvh | C | 100.0 | IL6RB_HUMAN Interleukin-6 receptor beta chain | ||||
1pvh | A | 100.0 | IL6RB_HUMAN Interleukin-6 receptor beta chain | ||||
1bj8 | A | 100.0 | IL6RB_HUMAN GP130 | ||||
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue. |
HETERO | |||||||
918 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
1i1r | B | Q98823_HHV8 VIRAL IL-6[167 aa] | A | 100.0 /100.0 |
11 /11 |
IL6RB_HUMAN INTERLEUKIN-6 RECEPTOR BETA CHAIN | |
1i1r | B | Q98823_HHV8 VIRAL IL-6[167 aa] | A | 100.0 /100.0 |
18 /18 |
IL6RB_HUMAN INTERLEUKIN-6 RECEPTOR BETA CHAIN | |
1i1r | B | Q98823_HHV8 VIRAL IL-6[167 aa] | A | 100.0 /100.0 |
18 /18 |
IL6RB_HUMAN INTERLEUKIN-6 RECEPTOR BETA CHAIN | |
1i1r | B | Q98823_HHV8 VIRAL IL-6[167 aa] | A | 100.0 /100.0 |
11 /11 |
IL6RB_HUMAN INTERLEUKIN-6 RECEPTOR BETA CHAIN | |
1p9m | B | IL6_HUMAN Interleukin-6[163 aa] | A | 100.0 /100.0 |
12 /12 |
IL6RB_HUMAN Interleukin-6 receptor beta chain | |
1p9m | B | IL6_HUMAN Interleukin-6[163 aa] | A | 100.0 /100.0 |
16 /16 |
IL6RB_HUMAN Interleukin-6 receptor beta chain | |
1p9m | B | IL6_HUMAN Interleukin-6[163 aa] | A | 100.0 /100.0 |
16 /16 |
IL6RB_HUMAN Interleukin-6 receptor beta chain | |
1p9m | B | IL6_HUMAN Interleukin-6[163 aa] | A | 100.0 /100.0 |
12 /12 |
IL6RB_HUMAN Interleukin-6 receptor beta chain | |
8d82 | B | IL6_HUMAN Interleukin-6[169 aa] | C | 100.0 /100.0 |
11 /11 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8d82 | E | IL6_HUMAN Interleukin-6[169 aa] | C | 100.0 /100.0 |
17 /17 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8d82 | B | IL6_HUMAN Interleukin-6[169 aa] | F | 100.0 /100.0 |
17 /17 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8d82 | E | IL6_HUMAN Interleukin-6[169 aa] | F | 100.0 /100.0 |
11 /11 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
1p9m | C | IL6RA_HUMAN Interleukin-6 receptor alpha chain[201 aa] | A | 100.0 /100.0 |
11 /11 |
IL6RB_HUMAN Interleukin-6 receptor beta chain | |
1p9m | C | IL6RA_HUMAN Interleukin-6 receptor alpha chain[201 aa] | A | 100.0 /100.0 |
4 /4 |
IL6RB_HUMAN Interleukin-6 receptor beta chain | |
1p9m | C | IL6RA_HUMAN Interleukin-6 receptor alpha chain[201 aa] | A | 100.0 /100.0 |
4 /4 |
IL6RB_HUMAN Interleukin-6 receptor beta chain | |
1p9m | C | IL6RA_HUMAN Interleukin-6 receptor alpha chain[201 aa] | A | 100.0 /100.0 |
11 /11 |
IL6RB_HUMAN Interleukin-6 receptor beta chain | |
1pvh | B | LIF_HUMAN Leukemia inhibitory factor[169 aa] | A | 100.0 /100.0 |
13 /13 |
IL6RB_HUMAN Interleukin-6 receptor beta chain | |
1pvh | D | LIF_HUMAN Leukemia inhibitory factor[169 aa] | C | 100.0 /100.0 |
14 /14 |
IL6RB_HUMAN Interleukin-6 receptor beta chain | |
8d6a | A | LIF_HUMAN Leukemia inhibitory factor[169 aa] | B | 100.0 /100.0 |
10 /10 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
7u7n | C | IL27B_HUMAN Interleukin-27 subunit beta[200 aa] | B | 100.0 /100.0 |
4 /4 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8d85 | A | IL27B_HUMAN Interleukin-27 subunit beta[201 aa] | D | 100.0 /100.0 |
2 /2 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
7u7n | D | IL27A_HUMAN Interleukin-27 subunit alpha[191 aa] | B | 100.0 /100.0 |
12 /12 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8d85 | B | IL27A_HUMAN Interleukin-27 subunit alpha[177 aa] | D | 100.0 /100.0 |
8 /8 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8d74 | B | CNTF_HUMAN Ciliary neurotrophic factor[174 aa] | A | 100.0 /100.0 |
12 /12 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8d74 | C | CNTFR_HUMAN Ciliary neurotrophic factor receptor subunit alpha.. | A | 100.0 /100.0 |
11 /11 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8d7r | B | CNTFR_HUMAN Ciliary neurotrophic factor receptor subunit alpha.. | D | 100.0 /100.0 |
12 /12 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8d7r | A | CLCF1_HUMAN Cardiotrophin-like cytokine factor 1[178 aa] | D | 100.0 /100.0 |
5 /5 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8d82 | A | IL6RA_HUMAN Soluble interleukin-6 receptor subunit alpha[296 a.. | C | 100.0 /100.0 |
11 /11 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8d82 | D | IL6RA_HUMAN Soluble interleukin-6 receptor subunit alpha[296 a.. | C | 100.0 /100.0 |
4 /4 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8d82 | A | IL6RA_HUMAN Soluble interleukin-6 receptor subunit alpha[296 a.. | F | 100.0 /100.0 |
4 /4 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8d82 | D | IL6RA_HUMAN Soluble interleukin-6 receptor subunit alpha[296 a.. | F | 100.0 /100.0 |
11 /11 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8dps | B | IL11_HUMAN Interleukin-11[165 aa] | A | 100.0 /100.0 |
10 /10 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8dps | E | IL11_HUMAN Interleukin-11[165 aa] | A | 100.0 /100.0 |
13 /13 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8dps | B | IL11_HUMAN Interleukin-11[165 aa] | D | 100.0 /100.0 |
12 /12 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8dps | E | IL11_HUMAN Interleukin-11[165 aa] | D | 100.0 /100.0 |
9 /9 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8dpt | B | IL11_HUMAN Interleukin-11[165 aa] | A | 100.0 /100.0 |
11 /11 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8dpt | E | IL11_HUMAN Interleukin-11[165 aa] | A | 100.0 /100.0 |
10 /10 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8dpt | B | IL11_HUMAN Interleukin-11[165 aa] | D | 100.0 /100.0 |
10 /10 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8dpt | E | IL11_HUMAN Interleukin-11[165 aa] | D | 100.0 /100.0 |
11 /11 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8dpu | B | IL11_HUMAN Interleukin-11[164 aa] | A | 100.0 /100.0 |
9 /9 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8dpu | E | IL11_HUMAN Interleukin-11[164 aa] | A | 100.0 /100.0 |
7 /7 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8dpu | B | IL11_HUMAN Interleukin-11[164 aa] | D | 100.0 /100.0 |
7 /7 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8dpu | E | IL11_HUMAN Interleukin-11[164 aa] | D | 100.0 /100.0 |
9 /9 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8dpu | H | IL11_HUMAN Interleukin-11[164 aa] | G | 100.0 /100.0 |
8 /8 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8dpu | K | IL11_HUMAN Interleukin-11[164 aa] | G | 100.0 /100.0 |
7 /7 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8dpu | H | IL11_HUMAN Interleukin-11[164 aa] | J | 100.0 /100.0 |
7 /7 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8dpu | K | IL11_HUMAN Interleukin-11[164 aa] | J | 100.0 /100.0 |
9 /9 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8dpu | N | IL11_HUMAN Interleukin-11[164 aa] | M | 100.0 /100.0 |
8 /8 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8dpu | Q | IL11_HUMAN Interleukin-11[164 aa] | M | 100.0 /100.0 |
8 /8 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8dpu | N | IL11_HUMAN Interleukin-11[164 aa] | P | 100.0 /100.0 |
7 /7 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8dpu | Q | IL11_HUMAN Interleukin-11[164 aa] | P | 100.0 /100.0 |
2 /2 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8dps | C | I11RA_HUMAN Interleukin-11 receptor subunit alpha[200 aa] | A | 100.0 /100.0 |
11 /11 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8dps | F | I11RA_HUMAN Interleukin-11 receptor subunit alpha[200 aa] | A | 100.0 /100.0 |
2 /2 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8dps | C | I11RA_HUMAN Interleukin-11 receptor subunit alpha[200 aa] | D | 100.0 /100.0 |
2 /2 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8dps | F | I11RA_HUMAN Interleukin-11 receptor subunit alpha[200 aa] | D | 100.0 /100.0 |
11 /11 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8dpt | C | I11RA_HUMAN Interleukin-11 receptor subunit alpha[294 aa] | A | 100.0 /100.0 |
12 /12 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8dpt | F | I11RA_HUMAN Interleukin-11 receptor subunit alpha[294 aa] | A | 100.0 /100.0 |
4 /4 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8dpt | C | I11RA_HUMAN Interleukin-11 receptor subunit alpha[294 aa] | D | 100.0 /100.0 |
3 /3 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8dpt | F | I11RA_HUMAN Interleukin-11 receptor subunit alpha[294 aa] | D | 100.0 /100.0 |
13 /13 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8dpu | C | I11RA_HUMAN Interleukin-11 receptor subunit alpha[283 aa] | A | 100.0 /100.0 |
10 /10 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8dpu | F | I11RA_HUMAN Interleukin-11 receptor subunit alpha[283 aa] | A | 100.0 /100.0 |
4 /4 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8dpu | C | I11RA_HUMAN Interleukin-11 receptor subunit alpha[283 aa] | D | 100.0 /100.0 |
4 /4 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8dpu | F | I11RA_HUMAN Interleukin-11 receptor subunit alpha[283 aa] | D | 100.0 /100.0 |
10 /10 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8dpu | I | I11RA_HUMAN Interleukin-11 receptor subunit alpha[283 aa] | G | 100.0 /100.0 |
10 /10 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8dpu | L | I11RA_HUMAN Interleukin-11 receptor subunit alpha[283 aa] | G | 100.0 /100.0 |
4 /4 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8dpu | I | I11RA_HUMAN Interleukin-11 receptor subunit alpha[283 aa] | J | 100.0 /100.0 |
4 /4 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8dpu | L | I11RA_HUMAN Interleukin-11 receptor subunit alpha[283 aa] | J | 100.0 /100.0 |
11 /11 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8dpu | O | I11RA_HUMAN Interleukin-11 receptor subunit alpha[283 aa] | M | 100.0 /100.0 |
10 /10 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8dpu | R | I11RA_HUMAN Interleukin-11 receptor subunit alpha[283 aa] | M | 100.0 /100.0 |
4 /4 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8dpu | O | I11RA_HUMAN Interleukin-11 receptor subunit alpha[283 aa] | P | 100.0 /100.0 |
4 /4 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8dpu | R | I11RA_HUMAN Interleukin-11 receptor subunit alpha[283 aa] | P | 100.0 /100.0 |
11 /11 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
COMPOUND | |||||||
918 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
7u7n | K |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
B | 100.0 /100.0 |
2 /2 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
7u7n | L |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
B | 100.0 /100.0 |
4 /4 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8d6a | I |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
B | 100.0 /100.0 |
2 /2 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8d6a | J |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
B | 100.0 /100.0 |
3 /3 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8d6a | K |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
B | 100.0 /100.0 |
4 /4 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8d6a | L |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
B | 100.0 /100.0 |
2 /2 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8d6a | M |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
B | 100.0 /100.0 |
1 /1 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8d74 | K |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 100.0 /100.0 |
1 /1 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8d74 | L |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 100.0 /100.0 |
4 /4 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8d74 | M |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 100.0 /100.0 |
3 /3 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8d74 | N |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 100.0 /100.0 |
2 /2 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8d74 | O |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 100.0 /100.0 |
3 /3 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8d7r | L |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
D | 100.0 /100.0 |
1 /1 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8d7r | M |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
D | 100.0 /100.0 |
4 /4 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8d7r | N |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
D | 100.0 /100.0 |
4 /4 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8d7r | O |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
D | 100.0 /100.0 |
3 /3 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8d82 | T |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
C | 100.0 /100.0 |
1 /1 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8d82 | U |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
C | 100.0 /100.0 |
5 /5 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8d82 | V |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
C | 100.0 /100.0 |
2 /2 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8d82 | W |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
C | 100.0 /100.0 |
3 /3 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8d82 | X |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
C | 100.0 /100.0 |
5 /5 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8d82 | Y |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
C | 100.0 /100.0 |
3 /3 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8d82 | CA |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
F | 100.0 /100.0 |
1 /1 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8d82 | DA |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
F | 100.0 /100.0 |
5 /5 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8d82 | EA |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
F | 100.0 /100.0 |
2 /2 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8d82 | FA |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
F | 100.0 /100.0 |
3 /3 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8d82 | GA |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
F | 100.0 /100.0 |
5 /5 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8d82 | HA |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
F | 100.0 /100.0 |
3 /3 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8d85 | J |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
D | 100.0 /100.0 |
1 /1 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8d85 | K |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
D | 100.0 /100.0 |
2 /2 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8d85 | L |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
D | 100.0 /100.0 |
1 /1 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8dps | K |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 100.0 /100.0 |
2 /2 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8dps | L |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 100.0 /100.0 |
2 /2 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8dps | M |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
D | 100.0 /100.0 |
2 /2 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8dps | N |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
D | 100.0 /100.0 |
2 /2 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8dpt | K |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 100.0 /100.0 |
2 /2 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8dpt | L |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 100.0 /100.0 |
3 /3 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8dpt | M |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
D | 100.0 /100.0 |
2 /2 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8dpt | N |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
D | 100.0 /100.0 |
3 /3 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8dpu | EA |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 100.0 /100.0 |
2 /2 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8dpu | FA |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 100.0 /100.0 |
2 /2 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8dpu | HA |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
D | 100.0 /100.0 |
2 /2 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8dpu | IA |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
D | 100.0 /100.0 |
2 /2 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8dpu | KA |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
G | 100.0 /100.0 |
2 /2 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8dpu | LA |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
G | 100.0 /100.0 |
2 /2 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8dpu | NA |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
J | 100.0 /100.0 |
2 /2 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8dpu | OA |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
J | 100.0 /100.0 |
2 /2 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8dpu | QA |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
M | 100.0 /100.0 |
2 /2 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8dpu | RA |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
M | 100.0 /100.0 |
2 /2 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8dpu | TA |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
P | 100.0 /100.0 |
2 /2 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8dpu | UA |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
P | 100.0 /100.0 |
2 /2 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
METAL | |||||||
918 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
1pvh | E |
IOD
IODIDE ION[1 atoms] |
A | 100.0 /100.0 |
1 /1 |
IL6RB_HUMAN Interleukin-6 receptor beta chain | |
3l5i | O |
CL
CHLORIDE ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
3l5i | Q |
CL
CHLORIDE ION[1 atoms] |
A | 100.0 /100.0 |
2 /2 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
3l5i | T |
CL
CHLORIDE ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
3l5j | D |
CL
CHLORIDE ION[1 atoms] |
A | 100.0 /100.0 |
3 /3 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
3l5j | E |
CL
CHLORIDE ION[1 atoms] |
B | 100.0 /100.0 |
5 /5 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
3l5j | F |
CL
CHLORIDE ION[1 atoms] |
B | 100.0 /100.0 |
5 /5 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
3l5j | G |
CL
CHLORIDE ION[1 atoms] |
B | 100.0 /100.0 |
4 /4 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
OTHERPOLY | |||||||
918 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
3l5h | B | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | A | 100.0 /100.0 |
2 /2 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
3l5h | D | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | A | 100.0 /100.0 |
3 /3 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
3l5h | H | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | A | 100.0 /100.0 |
1 /1 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
7u7n | E | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | B | 100.0 /100.0 |
1 /1 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8d6a | D | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | B | 100.0 /100.0 |
2 /2 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8d74 | E | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | A | 100.0 /100.0 |
1 /1 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8d7r | I | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | D | 100.0 /100.0 |
1 /1 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8d82 | H | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | C | 100.0 /100.0 |
4 /4 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8d82 | I | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | C | 100.0 /100.0 |
6 /6 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8d82 | J | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | C | 100.0 /100.0 |
3 /3 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8d82 | K | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | C | 100.0 /100.0 |
1 /1 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8d82 | M | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | F | 100.0 /100.0 |
4 /4 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8d82 | N | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | F | 100.0 /100.0 |
6 /6 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8d82 | O | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | F | 100.0 /100.0 |
3 /3 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8d82 | P | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | F | 100.0 /100.0 |
1 /1 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8d85 | F | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | D | 100.0 /100.0 |
4 /4 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8d85 | G | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | D | 100.0 /100.0 |
2 /2 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8dps | G | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | A | 100.0 /100.0 |
4 /4 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8dps | I | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | D | 100.0 /100.0 |
4 /4 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8dpt | I | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | A | 100.0 /100.0 |
5 /5 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8dpt | J | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | D | 100.0 /100.0 |
5 /5 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8dpu | S | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | A | 100.0 /100.0 |
3 /3 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8dpu | U | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | D | 100.0 /100.0 |
3 /3 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8dpu | W | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | G | 100.0 /100.0 |
3 /3 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8dpu | Y | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | J | 100.0 /100.0 |
3 /3 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8dpu | AA | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | M | 100.0 /100.0 |
3 /3 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
8dpu | CA | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | P | 100.0 /100.0 |
3 /3 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
3l5h | C | beta-D-mannopyranose-(1-4)-beta-D-mannopyranose-(1.. | A | 100.0 /100.0 |
1 /1 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
3l5h | F | beta-D-mannopyranose-(1-4)-beta-D-mannopyranose-(1.. | A | 100.0 /100.0 |
5 /5 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
3l5h | E | beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. | A | 100.0 /100.0 |
3 /3 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
7u7n | G | beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. | B | 100.0 /100.0 |
2 /2 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
7u7n | H | beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. | B | 100.0 /100.0 |
1 /1 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
3l5h | G | alpha-L-fucopyranose-(1-6)-2-acetamido-2-deoxy-bet.. | A | 100.0 /100.0 |
2 /2 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
7u7n | F | alpha-D-mannopyranose-(1-6)-beta-D-mannopyranose-(.. | B | 100.0 /100.0 |
3 /3 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
HOMO | |||||||
918 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
1bqu | B | IL6RB_HUMAN PROTEIN (GP130)[215 aa] | A | 100.0 /99.5 |
9 /9 |
IL6RB_HUMAN PROTEIN (GP130) | |
1bqu | A | IL6RB_HUMAN PROTEIN (GP130)[208 aa] | B | 100.0 /99.5 |
11 /11 |
IL6RB_HUMAN PROTEIN (GP130) | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
PRECIPITANT | |||||||
918 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
1bqu | C |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /99.5 |
4 /4 |
IL6RB_HUMAN PROTEIN (GP130) | |
1bqu | D |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /99.5 |
1 /1 |
IL6RB_HUMAN PROTEIN (GP130) | |
1bqu | E |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /99.5 |
2 /2 |
IL6RB_HUMAN PROTEIN (GP130) | |
1bqu | D |
SO4
SULFATE ION[5 atoms] |
B | 100.0 /99.5 |
1 /1 |
IL6RB_HUMAN PROTEIN (GP130) | |
1bqu | H |
SO4
SULFATE ION[5 atoms] |
B | 100.0 /99.5 |
4 /4 |
IL6RB_HUMAN PROTEIN (GP130) | |
1bqu | I |
SO4
SULFATE ION[5 atoms] |
B | 100.0 /99.5 |
2 /2 |
IL6RB_HUMAN PROTEIN (GP130) | |
1bqu | J |
SO4
SULFATE ION[5 atoms] |
B | 100.0 /99.5 |
3 /3 |
IL6RB_HUMAN PROTEIN (GP130) | |
3l5h | I |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /100.0 |
1 /1 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
3l5h | J |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /100.0 |
1 /1 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
3l5h | K |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /100.0 |
1 /1 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
3l5i | B |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
2 /2 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
3l5i | C |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
5 /5 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
3l5i | D |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 87.5 /100.0 |
8 /8 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
3l5i | E |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
8 /8 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
3l5i | F |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
6 /6 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
3l5i | G |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
5 /5 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
3l5i | H |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 75.0 /100.0 |
4 /4 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
3l5i | I |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
7 /7 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
3l5i | J |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
5 /5 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
3l5i | K |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
5 /5 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
3l5i | L |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
5 /5 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
3l5i | M |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
4 /4 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
3l5i | N |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
3 /3 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
3l5i | P |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 83.3 /100.0 |
6 /6 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
3l5i | R |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
5 /5 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
3l5i | S |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
5 /5 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
3l5i | U |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
2 /2 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
3l5j | C |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
8 /8 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta | |
1bqu | F |
GOL
GLYCEROL[6 atoms] |
A | 100.0 /99.5 |
6 /6 |
IL6RB_HUMAN PROTEIN (GP130) | |
1bqu | G |
GOL
GLYCEROL[6 atoms] |
A | 100.0 /99.5 |
8 /8 |
IL6RB_HUMAN PROTEIN (GP130) | |
1bqu | K |
GOL
GLYCEROL[6 atoms] |
B | 100.0 /99.5 |
6 /6 |
IL6RB_HUMAN PROTEIN (GP130) | |
1bqu | L |
GOL
GLYCEROL[6 atoms] |
B | 100.0 /99.5 |
6 /6 |
IL6RB_HUMAN PROTEIN (GP130) | |
1bqu | M |
GOL
GLYCEROL[6 atoms] |
B | 100.0 /99.5 |
4 /4 |
IL6RB_HUMAN PROTEIN (GP130) | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. |