Contact Molecules for Homologous Proteins | ||||
[Summary Bars] |
[SiteTable] |
|
[Back to Search Page] |
[Back to HOMCOS] |
[SupCon3D] |
[help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
1989388 | 932 | 66 | YP_009725307.1() | |
QUERYSEQ |
SADAQSFLNRVCGVSAARLTPCGTGTSTDVVYRAFDIYNDKVAGFAKFLKTNCCRFQEKDEDDNLIDSYFVVKRHTFSNYQHEETIYNLLKDCPAVAKHDFFKFRIDGDMVPHISRQRLTKYTMADLVYALRHFDEGNCDTLKEILVTYN CCDDDYFNKKDWYDFVENPDILRVYANLGERVRQALLKTVQFCDAMRNAGIVGVLTLDNQDLNGNWYDFGDFIQTTPGSGVPVVDSYYSLLMPILTLTRALTAESHVDTDLTKPYIKWDLLKYDFTEERLKLFDRYFKYWDQTYHPNCVN CLDDRCILHCANFNVLFSTVFPPTSFGPLVRKIFVDGVPFVVSTGYHFRELGVVHNQDVNLHSSRLSFKELLVYAADPAMHAASGNLLLDKRTTCFSVAALTNNVAFQTVKPGNFNKDFYDFAVSKGFFKEGSSVELKHFFFAQDGNAAI SDYDYYRYNLPTMCDIRQLLFVVEVVDKYFDCYDGGCINANQVIVNNLDKSAGFPFNKWGKARLYYDSMSYEDQDALFAYTKRNVIPTITQMNLKYAISAKNRARTVAGVSICSTMTNRQFHQKLLKSIAATRGATVVIGTSKFYGGWHN MLKTVYSDVENPHLMGWDYPKCDRAMPNMLRIMASLVLARKHTTCCSLSHRFYRLANECAQVLSEMVMCGGSLYVKPGGTSSGDATTAYANSVFNICQAVTANVNALLSTDGNKIADKYVRNLQHRLYECLYRNRDVDTDFVNEFYAYLR KHFSMMILSDDAVVCFNSTYASQGLVASIKNFKSVLYYQNNVFMSEAKCWTETDLTKGPHEFCSQHTMLVKQGDDYVYLPYPDPSRILGAGCFVDDIVKTDGTLMIERFVSLAIDAYPLTKHPNQEYADVFHLYLQYIRKLHDELTGHML DMYSVMLTNDNTSRYWEPEFYEAMYTPHTVLQ |
932 | region | name | description |
1-932 | DISORDER | predicted by DISOPRED |
MONOMER | |||||||
932 | |||||||
pdb_id | a1 | identity[%]2 | description | ||||
8gwf | A | 100.0 | R1AB_SARS2 RNA-directed RNA polymerase | ||||
8gwi | A | 100.0 | R1AB_SARS2 RNA-directed RNA polymerase | ||||
8gwg | A | 100.0 | R1AB_SARS2 RNA-directed RNA polymerase | ||||
8gwe | A | 100.0 | R1AB_SARS2 RNA-directed RNA polymerase | ||||
8gwk | A | 100.0 | R1AB_SARS2 RNA-directed RNA polymerase | ||||
7uoe | A | 100.0 | R1AB_SARS2 RNA-directed RNA polymerase | ||||
7uob | A | 100.0 | R1AB_SARS2 RNA-directed RNA polymerase | ||||
8sqk | A | 100.0 | R1AB_SARS2 RNA-directed RNA polymerase nsp12 | ||||
8sqj | A | 100.0 | R1AB_SARS2 RNA-directed RNA polymerase | ||||
8gwm | A | 100.0 | R1AB_SARS2 RNA-directed RNA polymerase | ||||
7dte | A | 100.0 | R1AB_SARS2 RNA-directed RNA polymerase | ||||
8gw1 | A | 99.9 | R1AB_SARS2 Replicase polyprotein 1ab | ||||
7uo4 | A | 100.0 | R1AB_SARS2 RNA-directed RNA polymerase | ||||
7rdx | A | 100.0 | R1AB_SARS2 RNA-directed RNA polymerase | ||||
7re1 | A | 100.0 | R1AB_SARS2 RNA-directed RNA polymerase | ||||
7rdz | A | 100.0 | R1AB_SARS2 RNA-directed RNA polymerase | ||||
7re2 | A | 100.0 | R1AB_SARS2 RNA-directed RNA polymerase | ||||
7re0 | A | 100.0 | R1AB_SARS2 RNA-directed RNA polymerase | ||||
7re3 | J | 100.0 | R1AB_SARS2 RNA-directed RNA polymerase | ||||
7re3 | A | 100.0 | R1AB_SARS2 RNA-directed RNA polymerase | ||||
7rdy | A | 100.0 | R1AB_SARS2 RNA-directed RNA polymerase | ||||
7kro | A | 100.0 | R1AB_SARS2 RNA-directed RNA polymerase | ||||
7krp | A | 100.0 | R1AB_SARS2 RNA-directed RNA polymerase | ||||
7krn | A | 100.0 | R1AB_SARS2 RNA-directed RNA polymerase | ||||
7c2k | A | 100.0 | R1AB_SARS2 RNA-directed RNA polymerase | ||||
7egq | I | 100.0 | R1AB_SARS2 RNA-directed RNA polymerase | ||||
7egq | A | 100.0 | R1AB_SARS2 RNA-directed RNA polymerase | ||||
7ed5 | A | 100.0 | R1AB_SARS2 RNA-directed RNA polymerase | ||||
7cyq | A | 100.0 | R1AB_SARS2 RNA-directed RNA polymerase | ||||
7uo9 | A | 100.0 | R1AB_SARS2 RNA-directed RNA polymerase | ||||
6xez | A | 100.0 | R1AB_SARS2 RNA-directed RNA polymerase | ||||
8sq9 | A | 100.0 | R1AB_SARS2 RNA-directed RNA polymerase | ||||
7uo7 | A | 100.0 | R1AB_SARS2 RNA-directed RNA polymerase | ||||
8gwn | A | 100.0 | R1AB_SARS2 RNA-directed RNA polymerase | ||||
8gwo | A | 100.0 | R1AB_SARS2 RNA-directed RNA polymerase | ||||
8gwb | A | 100.0 | R1AB_SARS2 RNA-directed RNA polymerase | ||||
7eiz | A | 100.0 | R1AB_SARS2 RNA-directed RNA polymerase | ||||
7cxm | A | 99.9 | R1AB_SARS2 RNA-directed RNA polymerase | ||||
7cxn | A | 99.9 | R1AB_SARS2 RNA-directed RNA polymerase | ||||
7dok | C | 100.0 | R1AB_SARS2 RNA-directed RNA polymerase | ||||
7btf | A | 100.0 | R1AB_SARS2 RNA-directed RNA polymerase | ||||
7bzf | A | 100.0 | R1AB_SARS2 RNA-directed RNA polymerase | ||||
7aap | A | 100.0 | R1AB_SARS2 Non-structural protein 12 | ||||
7dfg | C | 100.0 | R1AB_SARS2 RNA-directed RNA polymerase | ||||
7dfh | A | 100.0 | R1AB_SARS2 RNA-directed RNA polymeras | ||||
7doi | A | 100.0 | R1AB_SARS2 RNA-directed RNA polymerase | ||||
7d4f | D | 100.0 | R1AB_SARS2 RNA-directed RNA polymerase | ||||
8gy6 | A | 100.0 | R1AB_SARS2 RNA-directed RNA polymerase | ||||
6m71 | A | 100.0 | R1AB_SARS2 RNA-directed RNA polymerase | ||||
7thm | A | 100.0 | R1AB_SARS2 RNA-directed RNA polymerase | ||||
6yyt | A | 100.0 | R1AB_SARS2 nsp12 | ||||
7bv1 | A | 100.0 | R1AB_SARS2 RNA-directed RNA polymerase | ||||
7bv2 | A | 100.0 | R1AB_SARS2 RNA-directed RNA polymerase | ||||
7l1f | A | 100.0 | R1AB_SARS2 RNA-directed RNA polymerase | ||||
7ctt | A | 100.0 | R1AB_SARS2 RNA-directed RNA polymerase | ||||
7ozu | A | 100.0 | R1AB_SARS2 Replicase polyprotein 1ab | ||||
7oyg | A | 100.0 | R1AB_SARS2 SARS-CoV-2 RNA-dependent RNA polymerase (nsp12) | ||||
7ozv | A | 100.0 | R1AB_SARS2 Replicase polyprotein 1ab | ||||
7oyg | F | 100.0 | R1AB_SARS2 SARS-CoV-2 RNA-dependent RNA polymerase (nsp12) | ||||
7b3c | A | 100.0 | R1AB_SARS2 RNA-directed RNA polymerase nsp12 | ||||
7b3d | A | 100.0 | R1AB_SARS2 SARS-CoV-2 RNA-dependent RNA polymerase nsp12 | ||||
7b3b | A | 100.0 | R1AB_SARS2 RNA-directed RNA polymerase nsp12 | ||||
7bw4 | A | 100.0 | R1AB_SARS2 RNA-directed RNA polymerase | ||||
6xqb | A | 100.0 | R1AB_SARS2 RNA-directed RNA polymerase | ||||
6nur | A | 97.0 | R1AB_CVHSA NSP12 | ||||
6nus | A | 96.6 | R1AB_CVHSA NSP12 | ||||
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue. |
HETERO | |||||||
932 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
6m71 | B | R1AB_SARS2 Non-structural protein 7[70 aa] | A | 100.0 /100.0 |
12 /12 |
R1AB_SARS2 RNA-directed RNA polymerase | |
6nur | C | R1AB_CVHSA NSP7[70 aa] | A | 100.0 /97.0 |
14 /14 |
R1AB_CVHSA NSP12 | |
6xez | C | R1AB_SARS2 Non-structural protein 7[73 aa] | A | 100.0 /100.0 |
16 /16 |
R1AB_SARS2 RNA-directed RNA polymerase | |
6xqb | C | R1AB_SARS2 Non-structural protein 7[62 aa] | A | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 RNA-directed RNA polymerase | |
6yyt | C | R1AB_SARS2 nsp7[73 aa] | A | 100.0 /100.0 |
18 /18 |
R1AB_SARS2 nsp12 | |
7aap | C | R1AB_SARS2 Non-structural protein 7[67 aa] | A | 100.0 /100.0 |
14 /14 |
R1AB_SARS2 Non-structural protein 12 | |
7b3b | C | R1AB_SARS2 Non-structural protein 7[62 aa] | A | 100.0 /100.0 |
18 /18 |
R1AB_SARS2 RNA-directed RNA polymerase nsp12 | |
7b3c | C | R1AB_SARS2 Non-structural protein 7[62 aa] | A | 100.0 /100.0 |
19 /19 |
R1AB_SARS2 RNA-directed RNA polymerase nsp12 | |
7b3d | C | R1AB_SARS2 SARS-CoV-2 nsp7[62 aa] | A | 100.0 /100.0 |
15 /15 |
R1AB_SARS2 SARS-CoV-2 RNA-dependent RNA polymerase nsp12 | |
7btf | B | R1AB_SARS2 Non-structural protein 7[68 aa] | A | 100.0 /100.0 |
19 /19 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7bv1 | C | R1AB_SARS2 Non-structural protein 7[63 aa] | A | 100.0 /100.0 |
14 /14 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7bv2 | C | R1AB_SARS2 Non-structural protein 7[63 aa] | A | 100.0 /100.0 |
14 /14 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7bw4 | C | R1AB_SARS2 Non-structural protein 7[65 aa] | A | 100.0 /100.0 |
10 /10 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7bzf | C | R1AB_SARS2 Non-structural protein 7[68 aa] | A | 100.0 /100.0 |
16 /16 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7c2k | C | R1AB_SARS2 Non-structural protein 7[73 aa] | A | 100.0 /100.0 |
18 /18 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7ctt | C | R1AB_SARS2 Non-structural protein 7[63 aa] | A | 100.0 /100.0 |
16 /16 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7cxm | C | R1AB_SARS2 Non-structural protein 7[72 aa] | A | 100.0 /99.9 |
13 /13 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7cxn | C | R1AB_SARS2 Non-structural protein 7[72 aa] | A | 100.0 /99.9 |
15 /15 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7cyq | C | R1AB_SARS2 Non-structural protein 7[72 aa] | A | 100.0 /100.0 |
16 /16 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7d4f | B | R1AB_SARS2 Non-structural protein 7[63 aa] | D | 100.0 /100.0 |
16 /16 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7dfg | E | R1AB_SARS2 Non-structural protein 7[69 aa] | C | 100.0 /100.0 |
17 /17 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7dfh | C | R1AB_SARS2 Non-structural protein 7[63 aa] | A | 100.0 /100.0 |
18 /18 |
R1AB_SARS2 RNA-directed RNA polymeras | |
7doi | C | R1AB_SARS2 Non-structural protein 7[69 aa] | A | 100.0 /100.0 |
19 /19 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7dok | E | R1AB_SARS2 Non-structural protein 7[69 aa] | C | 100.0 /100.0 |
15 /15 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7dte | C | R1AB_SARS2 Non-structural protein 7[73 aa] | A | 100.0 /100.0 |
18 /18 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7ed5 | C | R1AB_SARS2 Non-structural protein 7[72 aa] | A | 100.0 /100.0 |
18 /18 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7egq | C | R1AB_SARS2 Non-structural protein 7[72 aa] | A | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7egq | K | R1AB_SARS2 Non-structural protein 7[72 aa] | I | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7eiz | C | R1A_SARS2 Non-structural protein 7[72 aa] | A | 100.0 /100.0 |
11 /11 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7krn | C | R1AB_SARS2 Non-structural protein 7[75 aa] | A | 100.0 /100.0 |
18 /18 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7kro | C | R1AB_SARS2 Non-structural protein 7[75 aa] | A | 100.0 /100.0 |
16 /16 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7krp | C | R1AB_SARS2 Non-structural protein 7[75 aa] | A | 100.0 /100.0 |
18 /18 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7l1f | C | R1AB_SARS2 Non-structural protein 7[63 aa] | A | 100.0 /100.0 |
13 /13 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7oyg | C | R1AB_SARS2 SARS-CoV-2 nsp7[62 aa] | A | 100.0 /100.0 |
15 /15 |
R1AB_SARS2 SARS-CoV-2 RNA-dependent RNA polymerase (nsp12) | |
7oyg | H | R1AB_SARS2 SARS-CoV-2 nsp7[62 aa] | F | 100.0 /100.0 |
15 /15 |
R1AB_SARS2 SARS-CoV-2 RNA-dependent RNA polymerase (nsp12) | |
7ozu | C | R1AB_SARS2 Non-structural protein 7[62 aa] | A | 100.0 /100.0 |
16 /16 |
R1AB_SARS2 Replicase polyprotein 1ab | |
7ozv | C | R1AB_SARS2 Non-structural protein 7[62 aa] | A | 100.0 /100.0 |
14 /14 |
R1AB_SARS2 Replicase polyprotein 1ab | |
7rdx | C | R1AB_SARS2 Non-structural protein 7[75 aa] | A | 100.0 /100.0 |
16 /16 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7rdy | C | R1AB_SARS2 Non-structural protein 7[75 aa] | A | 100.0 /100.0 |
15 /15 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7rdz | C | R1AB_SARS2 Non-structural protein 7[73 aa] | A | 100.0 /100.0 |
18 /18 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7re0 | C | R1AB_SARS2 Non-structural protein 7[75 aa] | A | 100.0 /100.0 |
15 /15 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7re1 | C | R1AB_SARS2 Non-structural protein 7[75 aa] | A | 100.0 /100.0 |
16 /16 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7re2 | C | R1AB_SARS2 Non-structural protein 7[75 aa] | A | 100.0 /100.0 |
17 /17 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7re3 | C | R1AB_SARS2 Non-structural protein 7[75 aa] | A | 100.0 /100.0 |
18 /18 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7re3 | K | R1AB_SARS2 Non-structural protein 7[75 aa] | J | 100.0 /100.0 |
18 /18 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7uo4 | C | R1AB_SARS2 Non-structural protein 7[73 aa] | A | 100.0 /100.0 |
17 /17 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7uo7 | C | R1AB_SARS2 Non-structural protein 7[73 aa] | A | 100.0 /100.0 |
19 /19 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7uo9 | C | R1AB_SARS2 Non-structural protein 7[73 aa] | A | 100.0 /100.0 |
16 /16 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7uob | C | R1AB_SARS2 Non-structural protein 7[73 aa] | A | 100.0 /100.0 |
15 /15 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7uoe | C | R1AB_SARS2 Non-structural protein 7[73 aa] | A | 100.0 /100.0 |
17 /17 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gw1 | C | R1A_SARS2 Non-structural protein 7[72 aa] | A | 100.0 /99.9 |
15 /15 |
R1AB_SARS2 Replicase polyprotein 1ab | |
8gwb | C | R1A_SARS2 Non-structural protein 7[72 aa] | A | 100.0 /100.0 |
17 /17 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gwe | C | R1A_SARS2 Replicase polyprotein 1a[78 aa] | A | 100.0 /100.0 |
13 /13 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gwf | C | R1A_SARS2 Non-structural protein 7[78 aa] | A | 100.0 /100.0 |
13 /13 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gwg | C | R1A_SARS2 Non-structural protein 7[78 aa] | A | 100.0 /100.0 |
13 /13 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gwi | C | R1A_SARS2 Non-structural protein 7[78 aa] | A | 100.0 /100.0 |
13 /13 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gwk | C | R1A_SARS2 Non-structural protein 7[76 aa] | A | 100.0 /100.0 |
14 /14 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gwm | C | R1A_SARS2 Non-structural protein 7[72 aa] | A | 100.0 /100.0 |
14 /14 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gwn | C | R1A_SARS2 Non-structural protein 7[72 aa] | A | 100.0 /100.0 |
11 /11 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gwo | C | R1A_SARS2 Non-structural protein 7[72 aa] | A | 100.0 /100.0 |
14 /14 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gy6 | C | R1A_SARS2 Non-structural protein 7[56 aa] | A | 100.0 /100.0 |
12 /12 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8sq9 | C | R1AB_SARS2 Non-structural protein 7[73 aa] | A | 100.0 /100.0 |
14 /14 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8sqj | C | R1AB_SARS2 Non-structural protein 7[72 aa] | A | 100.0 /100.0 |
13 /13 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8sqk | C | R1AB_SARS2 Non-structural protein 7[73 aa] | A | 100.0 /100.0 |
16 /16 |
R1AB_SARS2 RNA-directed RNA polymerase nsp12 | |
6m71 | C | R1AB_SARS2 Non-structural protein 8[43 aa] | A | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 RNA-directed RNA polymerase | |
6m71 | D | R1AB_SARS2 Non-structural protein 8[113 aa] | A | 100.0 /100.0 |
46 /46 |
R1AB_SARS2 RNA-directed RNA polymerase | |
6nur | B | R1A_CVHSA NSP8[115 aa] | A | 100.0 /97.0 |
49 /49 |
R1AB_CVHSA NSP12 | |
6nur | D | R1A_CVHSA NSP8[109 aa] | A | 100.0 /97.0 |
2 /2 |
R1AB_CVHSA NSP12 | |
6nus | B | R1A_CVHSA NSP8[112 aa] | A | 100.0 /96.6 |
44 /44 |
R1AB_CVHSA NSP12 | |
6xez | B | R1AB_SARS2 Non-structural protein 8[186 aa] | A | 100.0 /100.0 |
34 /34 |
R1AB_SARS2 RNA-directed RNA polymerase | |
6xez | D | R1AB_SARS2 Non-structural protein 8[186 aa] | A | 100.0 /100.0 |
12 /12 |
R1AB_SARS2 RNA-directed RNA polymerase | |
6xqb | B | R1AB_SARS2 Non-structural protein 8[114 aa] | A | 100.0 /100.0 |
40 /40 |
R1AB_SARS2 RNA-directed RNA polymerase | |
6yyt | B | R1AB_SARS2 nsp8[186 aa] | A | 100.0 /100.0 |
47 /47 |
R1AB_SARS2 nsp12 | |
6yyt | D | R1AB_SARS2 nsp8[186 aa] | A | 100.0 /100.0 |
15 /15 |
R1AB_SARS2 nsp12 | |
7aap | B | R1AB_SARS2 Non-structural protein 8[114 aa] | A | 100.0 /100.0 |
48 /48 |
R1AB_SARS2 Non-structural protein 12 | |
7b3b | B | R1AB_SARS2 Non-structural protein 8[115 aa] | A | 100.0 /100.0 |
48 /48 |
R1AB_SARS2 RNA-directed RNA polymerase nsp12 | |
7b3c | B | R1AB_SARS2 Non-structural protein 8[115 aa] | A | 100.0 /100.0 |
44 /44 |
R1AB_SARS2 RNA-directed RNA polymerase nsp12 | |
7b3d | B | R1AB_SARS2 SARS-CoV-2 nsp8[115 aa] | A | 100.0 /100.0 |
43 /43 |
R1AB_SARS2 SARS-CoV-2 RNA-dependent RNA polymerase nsp12 | |
7btf | C | R1AB_SARS2 Non-structural protein 8[126 aa] | A | 100.0 /100.0 |
51 /51 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7btf | D | R1AB_SARS2 Non-structural protein 8[104 aa] | A | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7bv1 | B | R1AB_SARS2 Non-structural protein 8[114 aa] | A | 100.0 /100.0 |
42 /42 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7bv2 | B | R1AB_SARS2 Non-structural protein 8[114 aa] | A | 100.0 /100.0 |
46 /46 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7bw4 | B | R1AB_SARS2 Non-structural protein 8[115 aa] | A | 100.0 /100.0 |
42 /42 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7bzf | B | R1AB_SARS2 Non-structural protein 8[114 aa] | A | 100.0 /100.0 |
51 /51 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7bzf | D | R1AB_SARS2 Non-structural protein 8[104 aa] | A | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7c2k | B | R1AB_SARS2 Non-structural protein 8[117 aa] | A | 100.0 /100.0 |
48 /48 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7c2k | D | R1AB_SARS2 Non-structural protein 8[139 aa] | A | 100.0 /100.0 |
13 /13 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7ctt | B | R1AB_SARS2 Non-structural protein 8[114 aa] | A | 100.0 /100.0 |
47 /47 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7cxm | B | R1AB_SARS2 Non-structural protein 8[187 aa] | A | 100.0 /99.9 |
37 /37 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7cxm | D | R1AB_SARS2 Non-structural protein 8[186 aa] | A | 100.0 /99.9 |
15 /15 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7cxn | B | R1AB_SARS2 Non-structural protein 8[187 aa] | A | 100.0 /99.9 |
35 /35 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7cxn | D | R1AB_SARS2 Non-structural protein 8[186 aa] | A | 100.0 /99.9 |
13 /13 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7cyq | B | R1AB_SARS2 Non-structural protein 8[187 aa] | A | 100.0 /100.0 |
42 /42 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7cyq | D | R1AB_SARS2 Non-structural protein 8[186 aa] | A | 100.0 /100.0 |
12 /12 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7d4f | A | R1AB_SARS2 Non-structural protein 8[114 aa] | D | 100.0 /100.0 |
48 /48 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7d4f | C | R1AB_SARS2 Non-structural protein 8[106 aa] | D | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7dfg | D | R1AB_SARS2 Non-structural protein 8[117 aa] | C | 100.0 /100.0 |
47 /47 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7dfg | F | R1AB_SARS2 Non-structural protein 8[106 aa] | C | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7dfh | B | R1AB_SARS2 Non-structural protein 8[114 aa] | A | 100.0 /100.0 |
48 /48 |
R1AB_SARS2 RNA-directed RNA polymeras | |
7dfh | D | R1AB_SARS2 Non-structural protein 8[106 aa] | A | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 RNA-directed RNA polymeras | |
7doi | B | R1AB_SARS2 Non-structural protein 8[114 aa] | A | 100.0 /100.0 |
49 /49 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7doi | F | R1AB_SARS2 Non-structural protein 8[106 aa] | A | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7dok | D | R1AB_SARS2 Non-structural protein 8[155 aa] | C | 100.0 /100.0 |
49 /49 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7dok | F | R1AB_SARS2 Non-structural protein 8[174 aa] | C | 100.0 /100.0 |
16 /16 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7dte | B | R1AB_SARS2 Non-structural protein 8[187 aa] | A | 100.0 /100.0 |
51 /51 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7dte | D | R1AB_SARS2 Non-structural protein 8[186 aa] | A | 100.0 /100.0 |
14 /14 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7ed5 | B | R1AB_SARS2 Non-structural protein 8[150 aa] | A | 100.0 /100.0 |
52 /52 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7ed5 | D | R1AB_SARS2 Non-structural protein 8[154 aa] | A | 100.0 /100.0 |
17 /17 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7egq | B | R1AB_SARS2 Non-structural protein 8[187 aa] | A | 100.0 /100.0 |
38 /38 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7egq | D | R1AB_SARS2 Non-structural protein 8[186 aa] | A | 100.0 /100.0 |
13 /13 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7egq | J | R1AB_SARS2 Non-structural protein 8[187 aa] | I | 100.0 /100.0 |
37 /37 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7egq | L | R1AB_SARS2 Non-structural protein 8[186 aa] | I | 100.0 /100.0 |
13 /13 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7eiz | B | R1AB_SARS2 Non-structural protein 8[187 aa] | A | 100.0 /100.0 |
38 /38 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7eiz | D | R1AB_SARS2 Non-structural protein 8[186 aa] | A | 100.0 /100.0 |
13 /13 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7krn | B | R1AB_SARS2 Non-structural protein 8[186 aa] | A | 100.0 /100.0 |
48 /48 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7krn | D | R1AB_SARS2 Non-structural protein 8[185 aa] | A | 100.0 /100.0 |
17 /17 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7kro | B | R1AB_SARS2 Non-structural protein 8[186 aa] | A | 100.0 /100.0 |
46 /46 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7kro | D | R1AB_SARS2 Non-structural protein 8[185 aa] | A | 100.0 /100.0 |
16 /16 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7krp | B | R1AB_SARS2 Non-structural protein 8[186 aa] | A | 100.0 /100.0 |
53 /53 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7krp | D | R1AB_SARS2 Non-structural protein 8[185 aa] | A | 100.0 /100.0 |
16 /16 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7l1f | B | R1AB_SARS2 Non-structural protein 8[114 aa] | A | 100.0 /100.0 |
40 /40 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7ozu | B | R1AB_SARS2 Non-structural protein 8[115 aa] | A | 100.0 /100.0 |
45 /45 |
R1AB_SARS2 Replicase polyprotein 1ab | |
7ozv | B | R1AB_SARS2 Non-structural protein 8[115 aa] | A | 100.0 /100.0 |
50 /50 |
R1AB_SARS2 Replicase polyprotein 1ab | |
7rdx | B | R1AB_SARS2 Non-structural protein 8[186 aa] | A | 100.0 /100.0 |
48 /48 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7rdx | D | R1AB_SARS2 Non-structural protein 8[185 aa] | A | 100.0 /100.0 |
18 /18 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7rdy | B | R1AB_SARS2 Non-structural protein 8[186 aa] | A | 100.0 /100.0 |
47 /47 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7rdy | D | R1AB_SARS2 Non-structural protein 8[185 aa] | A | 100.0 /100.0 |
17 /17 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7rdz | B | R1AB_SARS2 Non-structural protein 8[186 aa] | A | 100.0 /100.0 |
50 /50 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7rdz | D | R1AB_SARS2 Non-structural protein 8[185 aa] | A | 100.0 /100.0 |
16 /16 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7re0 | B | R1AB_SARS2 Non-structural protein 8[186 aa] | A | 100.0 /100.0 |
47 /47 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7re0 | D | R1AB_SARS2 Non-structural protein 8[185 aa] | A | 100.0 /100.0 |
10 /10 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7re1 | B | R1AB_SARS2 Non-structural protein 8[186 aa] | A | 100.0 /100.0 |
51 /51 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7re1 | D | R1AB_SARS2 Non-structural protein 8[185 aa] | A | 100.0 /100.0 |
19 /19 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7re2 | B | R1AB_SARS2 Non-structural protein 8[186 aa] | A | 100.0 /100.0 |
52 /52 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7re2 | D | R1AB_SARS2 Non-structural protein 8[185 aa] | A | 100.0 /100.0 |
16 /16 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7re3 | B | R1AB_SARS2 Non-structural protein 8[186 aa] | A | 100.0 /100.0 |
46 /46 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7re3 | D | R1AB_SARS2 Non-structural protein 8[185 aa] | A | 100.0 /100.0 |
13 /13 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7re3 | G | R1AB_SARS2 Non-structural protein 8[186 aa] | A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7re3 | B | R1AB_SARS2 Non-structural protein 8[186 aa] | J | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7re3 | G | R1AB_SARS2 Non-structural protein 8[186 aa] | J | 100.0 /100.0 |
47 /47 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7re3 | L | R1AB_SARS2 Non-structural protein 8[185 aa] | J | 100.0 /100.0 |
13 /13 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7thm | B | R1AB_SARS2 Non-structural protein 8[108 aa] | A | 100.0 /100.0 |
41 /41 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7uo4 | B | R1AB_SARS2 Non-structural protein 8[187 aa] | A | 100.0 /100.0 |
50 /50 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7uo4 | D | R1AB_SARS2 Non-structural protein 8[187 aa] | A | 100.0 /100.0 |
16 /16 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7uo7 | B | R1AB_SARS2 Non-structural protein 8[186 aa] | A | 100.0 /100.0 |
45 /45 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7uo7 | F | R1AB_SARS2 Non-structural protein 8[186 aa] | A | 100.0 /100.0 |
18 /18 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7uo9 | B | R1AB_SARS2 Non-structural protein 8[190 aa] | A | 100.0 /100.0 |
52 /52 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7uo9 | F | R1AB_SARS2 Non-structural protein 8[186 aa] | A | 100.0 /100.0 |
15 /15 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7uob | B | R1AB_SARS2 Non-structural protein 8[187 aa] | A | 100.0 /100.0 |
38 /38 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7uob | D | R1AB_SARS2 Non-structural protein 8[186 aa] | A | 100.0 /100.0 |
15 /15 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7uoe | B | R1AB_SARS2 Non-structural protein 8[188 aa] | A | 100.0 /100.0 |
50 /50 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7uoe | D | R1AB_SARS2 Non-structural protein 8[186 aa] | A | 100.0 /100.0 |
16 /16 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gw1 | B | R1AB_SARS2 Non-structural protein 8[187 aa] | A | 100.0 /99.9 |
40 /40 |
R1AB_SARS2 Replicase polyprotein 1ab | |
8gw1 | D | R1AB_SARS2 Non-structural protein 8[186 aa] | A | 100.0 /99.9 |
12 /12 |
R1AB_SARS2 Replicase polyprotein 1ab | |
8gwb | B | R1AB_SARS2 Non-structural protein 8[187 aa] | A | 100.0 /100.0 |
53 /53 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gwb | D | R1AB_SARS2 Non-structural protein 8[186 aa] | A | 100.0 /100.0 |
15 /15 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gwe | B | R1AB_SARS2 Non-structural protein 8[190 aa] | A | 100.0 /100.0 |
38 /38 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gwe | D | R1AB_SARS2 Non-structural protein 8[187 aa] | A | 100.0 /100.0 |
15 /15 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gwf | B | R1AB_SARS2 Non-structural protein 8[187 aa] | A | 100.0 /100.0 |
38 /38 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gwf | D | R1AB_SARS2 Non-structural protein 8[187 aa] | A | 100.0 /100.0 |
14 /14 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gwg | B | R1AB_SARS2 Non-structural protein 8[187 aa] | A | 100.0 /100.0 |
38 /38 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gwg | D | R1AB_SARS2 Non-structural protein 8[187 aa] | A | 100.0 /100.0 |
14 /14 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gwi | B | R1AB_SARS2 Non-structural protein 8[187 aa] | A | 100.0 /100.0 |
38 /38 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gwi | D | R1AB_SARS2 Non-structural protein 8[187 aa] | A | 100.0 /100.0 |
14 /14 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gwk | B | R1AB_SARS2 Non-structural protein 8[187 aa] | A | 100.0 /100.0 |
38 /38 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gwk | D | R1AB_SARS2 Non-structural protein 8[186 aa] | A | 100.0 /100.0 |
13 /13 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gwm | B | R1AB_SARS2 Non-structural protein 8[187 aa] | A | 100.0 /100.0 |
41 /41 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gwm | D | R1AB_SARS2 Non-structural protein 8[186 aa] | A | 100.0 /100.0 |
12 /12 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gwn | B | R1AB_SARS2 Non-structural protein 8[187 aa] | A | 100.0 /100.0 |
34 /34 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gwn | D | R1AB_SARS2 Non-structural protein 8[186 aa] | A | 100.0 /100.0 |
13 /13 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gwo | B | R1AB_SARS2 Non-structural protein 8[187 aa] | A | 100.0 /100.0 |
37 /37 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gwo | D | R1AB_SARS2 Non-structural protein 8[186 aa] | A | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gy6 | B | R1AB_SARS2 Non-structural protein 8[113 aa] | A | 100.0 /100.0 |
46 /46 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8sq9 | B | R1AB_SARS2 Non-structural protein 8[186 aa] | A | 100.0 /100.0 |
47 /47 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8sq9 | D | R1AB_SARS2 Non-structural protein 8[186 aa] | A | 100.0 /100.0 |
15 /15 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8sqj | B | R1AB_SARS2 Non-structural protein 8[187 aa] | A | 100.0 /100.0 |
40 /40 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8sqj | D | R1AB_SARS2 Non-structural protein 8[185 aa] | A | 100.0 /100.0 |
14 /14 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8sqk | B | R1AB_SARS2 Non-structural protein 8[187 aa] | A | 100.0 /100.0 |
42 /42 |
R1AB_SARS2 RNA-directed RNA polymerase nsp12 | |
8sqk | D | R1AB_SARS2 Non-structural protein 8[185 aa] | A | 100.0 /100.0 |
16 /16 |
R1AB_SARS2 RNA-directed RNA polymerase nsp12 | |
6xez | E | R1AB_SARS2 Helicase[596 aa] | A | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7cxm | I | R1AB_SARS2 Helicase[596 aa] | A | 100.0 /99.9 |
3 /3 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7cxn | H | R1AB_SARS2 Helicase[596 aa] | A | 100.0 /99.9 |
1 /1 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7cxn | I | R1AB_SARS2 Helicase[596 aa] | A | 100.0 /99.9 |
3 /3 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7cyq | G | R1AB_SARS2 Helicase[585 aa] | A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7egq | E | R1AB_SARS2 Helicase[588 aa] | A | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7egq | M | R1AB_SARS2 Helicase[588 aa] | I | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7eiz | K | R1AB_SARS2 Helicase[590 aa] | A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7krn | E | R1AB_SARS2 Helicase[590 aa] | A | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7kro | E | R1AB_SARS2 Helicase[590 aa] | A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7rdx | E | R1AB_SARS2 Helicase[590 aa] | A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7rdy | E | R1AB_SARS2 Helicase[590 aa] | A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7rdz | E | R1AB_SARS2 Helicase[590 aa] | A | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7re0 | E | R1AB_SARS2 Helicase[590 aa] | A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7re1 | E | R1AB_SARS2 Helicase[590 aa] | A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7re2 | E | R1AB_SARS2 Helicase[590 aa] | A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7re3 | E | R1AB_SARS2 Helicase[590 aa] | A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7re3 | N | R1AB_SARS2 Helicase[590 aa] | A | 100.0 /100.0 |
10 /10 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7re3 | F | R1AB_SARS2 Helicase[590 aa] | J | 100.0 /100.0 |
12 /12 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7re3 | M | R1AB_SARS2 Helicase[590 aa] | J | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gw1 | G | R1AB_SARS2 Helicase[585 aa] | A | 100.0 /99.9 |
3 /3 |
R1AB_SARS2 Replicase polyprotein 1ab | |
8gwb | E | R1AB_SARS2 Helicase[585 aa] | A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gwe | F | R1AB_SARS2 Helicase nsp13[586 aa] | A | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gwf | G | R1AB_SARS2 Helicase[586 aa] | A | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gwg | G | R1AB_SARS2 Helicase[586 aa] | A | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gwi | G | R1AB_SARS2 Helicase[586 aa] | A | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gwk | G | R1AB_SARS2 Helicase[585 aa] | A | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gwm | E | R1AB_SARS2 Helicase[585 aa] | A | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gwn | G | R1AB_SARS2 Helicase[585 aa] | A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gwo | G | R1AB_SARS2 Helicase[585 aa] | A | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 RNA-directed RNA polymerase | |
6xqb | D | R1AB_SARS2 Non-structural protein 8[31 aa] | A | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7aap | D | R1AB_SARS2 Non-structural protein 8[28 aa] | A | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 12 | |
7ctt | D | R1AB_SARS2 Non-structural protein 8[28 aa] | A | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7bv1 | D | R1AB_SARS2 Non-structural protein 8[99 aa] | A | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7cyq | I | R1AB_SARS2 Non-structural protein 9[113 aa] | A | 100.0 /100.0 |
19 /19 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7egq | F | R1AB_SARS2 Non-structural protein 9[113 aa] | A | 100.0 /100.0 |
21 /21 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7egq | N | R1AB_SARS2 Non-structural protein 9[113 aa] | I | 100.0 /100.0 |
20 /20 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7eiz | E | R1AB_SARS2 Non-structural protein 9[113 aa] | A | 100.0 /100.0 |
18 /18 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gw1 | I | R1AB_SARS2 Non-structural protein 9[113 aa] | A | 100.0 /99.9 |
17 /17 |
R1AB_SARS2 Replicase polyprotein 1ab | |
8gwb | G | R1AB_SARS2 Non-structural protein 9[113 aa] | A | 100.0 /100.0 |
20 /20 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gwe | G | R1AB_SARS2 Non-structural protein 9[113 aa] | A | 100.0 /100.0 |
19 /19 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gwf | I | R1AB_SARS2 Non-structural protein 9[113 aa] | A | 100.0 /100.0 |
20 /20 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gwg | I | R1AB_SARS2 Non-structural protein 9[113 aa] | A | 100.0 /100.0 |
20 /20 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gwi | I | R1AB_SARS2 Non-structural protein 9[113 aa] | A | 100.0 /100.0 |
20 /20 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gwk | I | R1AB_SARS2 Non-structural protein 9[113 aa] | A | 100.0 /100.0 |
22 /22 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gwm | G | R1AB_SARS2 Non-structural protein 9[113 aa] | A | 100.0 /100.0 |
20 /20 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gwn | I | R1AB_SARS2 Non-structural protein 9[113 aa] | A | 100.0 /100.0 |
18 /18 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gwo | I | R1AB_SARS2 Non-structural protein 9[113 aa] | A | 100.0 /100.0 |
22 /22 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8sqj | E | R1AB_SARS2 Non-structural protein 9[113 aa] | A | 100.0 /100.0 |
22 /22 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8sqk | E | R1AB_SARS2 Non-structural protein 9[113 aa] | A | 100.0 /100.0 |
17 /17 |
R1AB_SARS2 RNA-directed RNA polymerase nsp12 | |
7egq | H | R1AB_SARS2 Proofreading exoribonuclease[523 aa] | A | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7egq | P | R1AB_SARS2 Proofreading exoribonuclease[524 aa] | A | 100.0 /100.0 |
12 /12 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7egq | H | R1AB_SARS2 Proofreading exoribonuclease[523 aa] | I | 100.0 /100.0 |
12 /12 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7egq | P | R1AB_SARS2 Proofreading exoribonuclease[524 aa] | I | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7eiz | I | R1AB_SARS2 Proofreading exoribonuclease[523 aa] | A | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7oyg | B | R1AB_SARS2 SARS-CoV-2 nsp8[81 aa] | A | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 SARS-CoV-2 RNA-dependent RNA polymerase (nsp12) | |
7oyg | G | R1AB_SARS2 SARS-CoV-2 nsp8[81 aa] | F | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 SARS-CoV-2 RNA-dependent RNA polymerase (nsp12) | |
7thm | C | R1AB_SARS2 Non-structural protein 7[37 aa] | A | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7thm | E | R1AB_SARS2 Non-structural protein 9[74 aa] | A | 100.0 /100.0 |
16 /16 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8sq9 | E | R1AB_SARS2 Non-structural protein 9[98 aa] | A | 100.0 /100.0 |
20 /20 |
R1AB_SARS2 RNA-directed RNA polymerase | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
NUCLEOTIDE | |||||||
932 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
6xez | G | Product RNA | A | 100.0 /100.0 |
16 /16 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7rdx | G | Product RNA | A | 100.0 /100.0 |
15 /15 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7rdy | G | Product RNA | A | 100.0 /100.0 |
15 /15 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7rdz | G | Product RNA | A | 100.0 /100.0 |
17 /17 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7re0 | G | Product RNA | A | 100.0 /100.0 |
15 /15 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7re1 | G | Product RNA | A | 100.0 /100.0 |
16 /16 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7re2 | F | Product RNA | A | 100.0 /100.0 |
17 /17 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7re3 | H | Product RNA | A | 100.0 /100.0 |
16 /16 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7re3 | O | Product RNA | J | 100.0 /100.0 |
16 /16 |
R1AB_SARS2 RNA-directed RNA polymerase | |
6xez | H | Template RNA | A | 100.0 /100.0 |
21 /21 |
R1AB_SARS2 RNA-directed RNA polymerase | |
6xqb | E | RNA (5'-R(*GP*UP*GP*GP*GP*CP*CP*CP*A)-3') | A | 100.0 /100.0 |
15 /15 |
R1AB_SARS2 RNA-directed RNA polymerase | |
6xqb | F | RNA (5'-R(*GP*UP*GP*GP*GP*CP*CP*CP*A)-3') | A | 100.0 /100.0 |
19 /19 |
R1AB_SARS2 RNA-directed RNA polymerase | |
6yyt | E | RNA product | A | 100.0 /100.0 |
14 /14 |
R1AB_SARS2 nsp12 | |
6yyt | G | RNA product | A | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 nsp12 | |
7aap | E | RNA (5'-R(P*UP*UP*AP*AP*GP*UP*UP*AP*U)-3') | A | 100.0 /100.0 |
16 /16 |
R1AB_SARS2 Non-structural protein 12 | |
7aap | F | RNA (5'-R(P*UP*UP*CP*AP*UP*AP*AP*CP*UP*UP*AP*A)-3'.. | A | 100.0 /100.0 |
23 /23 |
R1AB_SARS2 Non-structural protein 12 | |
7b3b | D | DNA/RNA (5'-R(P*CP*UP*AP*CP*GP*CP*G)-D(P*(RMP))-R(.. | A | 100.0 /100.0 |
14 /14 |
R1AB_SARS2 RNA-directed RNA polymerase nsp12 | |
7b3b | E | RNA (5'-R(P*UP*GP*CP*AP*UP*CP*GP*CP*GP*UP*AP*G)-3'.. | A | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 RNA-directed RNA polymerase nsp12 | |
7b3c | D | DNA/RNA (5'-R(P*CP*UP*AP*CP*GP*CP*A)-D(P*(RMP))-R(.. | A | 100.0 /100.0 |
16 /16 |
R1AB_SARS2 RNA-directed RNA polymerase nsp12 | |
7b3c | E | RNA (5'-R(P*UP*CP*AP*CP*UP*UP*GP*CP*GP*UP*AP*G)-3'.. | A | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 RNA-directed RNA polymerase nsp12 | |
7b3d | D | RNA (5'-R(P*CP*UP*AP*CP*GP*CP*AP*GP*UP*G)-3') | A | 100.0 /100.0 |
14 /14 |
R1AB_SARS2 SARS-CoV-2 RNA-dependent RNA polymerase nsp12 | |
7oyg | D | RNA (5'-R(P*CP*UP*AP*CP*GP*CP*AP*GP*UP*G)-3') | A | 100.0 /100.0 |
14 /14 |
R1AB_SARS2 SARS-CoV-2 RNA-dependent RNA polymerase (nsp12) | |
7oyg | I | RNA (5'-R(P*CP*UP*AP*CP*GP*CP*AP*GP*UP*G)-3') | F | 100.0 /100.0 |
14 /14 |
R1AB_SARS2 SARS-CoV-2 RNA-dependent RNA polymerase (nsp12) | |
7b3d | E | RNA (5'-R(P*UP*GP*CP*AP*CP*UP*GP*CP*GP*UP*AP*G)-3'.. | A | 100.0 /100.0 |
29 /29 |
R1AB_SARS2 SARS-CoV-2 RNA-dependent RNA polymerase nsp12 | |
7oyg | E | RNA (5'-R(P*UP*GP*CP*AP*CP*UP*GP*CP*GP*UP*AP*G)-3'.. | A | 100.0 /100.0 |
29 /29 |
R1AB_SARS2 SARS-CoV-2 RNA-dependent RNA polymerase (nsp12) | |
7oyg | J | RNA (5'-R(P*UP*GP*CP*AP*CP*UP*GP*CP*GP*UP*AP*G)-3'.. | F | 100.0 /100.0 |
29 /29 |
R1AB_SARS2 SARS-CoV-2 RNA-dependent RNA polymerase (nsp12) | |
7bv2 | D | Primer | A | 100.0 /100.0 |
15 /15 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7bv2 | E | Templete | A | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7bzf | E | RNA (31-MER) | A | 100.0 /100.0 |
25 /25 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7bzf | F | RNA (5'-R(*UP*GP*UP*UP*CP*GP*AP*CP*GP*AP*CP*AP*CP*.. | A | 100.0 /100.0 |
13 /13 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7c2k | E | RNA (29-MER) | A | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7c2k | F | RNA (5'-R(*UP*GP*UP*UP*CP*GP*AP*CP*GP*AP*CP*AP*CP*.. | A | 100.0 /100.0 |
17 /17 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7ctt | E | Primer-RNA (5'-R(P*UP*UP*CP*UP*CP*CP*UP*AP*AP*GP*A.. | A | 100.0 /100.0 |
18 /18 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7ctt | F | Template-RNA (5'-R(P*AP*CP*UP*AP*GP*CP*UP*UP*CP*UP.. | A | 100.0 /100.0 |
25 /25 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7cxm | E | RNA (25-MER) | A | 100.0 /99.9 |
10 /10 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7cxn | E | Primer RNA | A | 100.0 /99.9 |
9 /9 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7egq | S | primer RNA | A | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7egq | U | primer RNA | I | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7eiz | G | primer | A | 100.0 /100.0 |
11 /11 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gw1 | E | RNA (25-MER) | A | 100.0 /99.9 |
16 /16 |
R1AB_SARS2 Replicase polyprotein 1ab | |
8gwb | I | primer | A | 100.0 /100.0 |
16 /16 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gwe | I | primer | A | 100.0 /100.0 |
14 /14 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gwf | E | primer | A | 100.0 /100.0 |
13 /13 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gwg | E | primer | A | 100.0 /100.0 |
13 /13 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gwi | E | primer | A | 100.0 /100.0 |
13 /13 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gwk | E | primer | A | 100.0 /100.0 |
12 /12 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gwm | H | RNA (25-MER) | A | 100.0 /100.0 |
11 /11 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gwn | E | primer | A | 100.0 /100.0 |
11 /11 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gwo | E | RNA (25-MER) | A | 100.0 /100.0 |
11 /11 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7cyq | E | Primer | A | 100.0 /100.0 |
16 /16 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7cyq | F | Template | A | 100.0 /100.0 |
30 /30 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7dfg | A | RNA (5'-R(P*AP*GP*AP*UP*UP*AP*AP*GP*UP*UP*AP*U)-3'.. | C | 100.0 /100.0 |
14 /14 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7doi | D | RNA (5'-R(P*AP*GP*AP*UP*UP*AP*AP*GP*UP*UP*AP*U)-3'.. | A | 100.0 /100.0 |
15 /15 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7dfg | B | RNA (5'-R(P*CP*CP*CP*UP*AP*UP*AP*AP*CP*UP*UP*AP*AP.. | C | 100.0 /100.0 |
30 /30 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7dfh | E | RNA (5'-R(P*GP*CP*UP*AP*UP*GP*UP*G*(LIG))-3') | A | 100.0 /100.0 |
13 /13 |
R1AB_SARS2 RNA-directed RNA polymeras | |
7dfh | F | RNA (5'-R(P*CP*CP*CP*CP*CP*AP*CP*AP*UP*AP*GP*C)-3'.. | A | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 RNA-directed RNA polymeras | |
7doi | E | RNA (5'-R(P*CP*CP*UP*AP*UP*AP*AP*CP*UP*UP*AP*AP*UP.. | A | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7dok | A | RNA (5'-R(P*GP*CP*UP*AP*UP*GP*UP*GP*AP*GP*AP*UP*UP.. | C | 100.0 /100.0 |
14 /14 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7ed5 | E | RNA (5'-R(P*GP*CP*UP*AP*UP*GP*UP*GP*AP*GP*AP*UP*UP.. | A | 100.0 /100.0 |
12 /12 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7dok | B | RNA (5'-R(P*CP*CP*CP*UP*AP*UP*AP*AP*CP*UP*UP*AP*AP.. | C | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7dte | E | RNA (57-MER) | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7dte | F | RNA (33-MER) | A | 100.0 /100.0 |
15 /15 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7ed5 | F | RNA (5'-R(P*CP*CP*CP*CP*AP*UP*AP*AP*CP*UP*UP*AP*AP.. | A | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7egq | T | Template RNA | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7egq | V | Template RNA | I | 100.0 /100.0 |
23 /23 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7eiz | H | template | A | 100.0 /100.0 |
21 /21 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gwe | J | template | A | 100.0 /100.0 |
22 /22 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7krn | F | RNA (37-MER) | A | 100.0 /100.0 |
20 /20 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7kro | G | RNA (37-MER) | A | 100.0 /100.0 |
21 /21 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7krp | E | RNA (37-MER) | A | 100.0 /100.0 |
20 /20 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7krn | G | RNA (43-MER) | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7kro | H | RNA (43-MER) | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7krp | F | RNA (36-MER) | A | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7l1f | D | RNA (5'-R(P*CP*UP*AP*AP*GP*AP*AP*GP*CP*UP*AP*UP*U*.. | A | 100.0 /100.0 |
17 /17 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7l1f | E | RNA (5'-R(P*AP*UP*UP*UP*UP*AP*AP*UP*AP*GP*CP*UP*UP.. | A | 100.0 /100.0 |
14 /14 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7ozu | D | Product RNA | A | 100.0 /100.0 |
14 /14 |
R1AB_SARS2 Replicase polyprotein 1ab | |
7ozu | E | Template RNA | A | 100.0 /100.0 |
30 /30 |
R1AB_SARS2 Replicase polyprotein 1ab | |
7ozv | E | Template RNA | A | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Replicase polyprotein 1ab | |
7ozv | D | Product RNA | A | 100.0 /100.0 |
12 /12 |
R1AB_SARS2 Replicase polyprotein 1ab | |
7rdx | H | Template RNA | A | 100.0 /100.0 |
34 /34 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7rdy | H | Template RNA | A | 100.0 /100.0 |
32 /32 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7rdz | H | Template RNA | A | 100.0 /100.0 |
31 /31 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7re0 | H | Template RNA | A | 100.0 /100.0 |
31 /31 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7re1 | H | Template RNA | A | 100.0 /100.0 |
30 /30 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7re2 | G | Template RNA | A | 100.0 /100.0 |
31 /31 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7re3 | I | Template RNA | A | 100.0 /100.0 |
32 /32 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7re3 | P | Template RNA | J | 100.0 /100.0 |
32 /32 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7uo4 | E | Product RNA (35-MER) | A | 100.0 /100.0 |
16 /16 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7uo4 | F | Template RNA (55-MER) | A | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7uo7 | D | Product RNA (35-MER) | A | 100.0 /100.0 |
17 /17 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7uo7 | E | Template RNA (55-MER) | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7uo9 | D | Product RNA (35-MER) | A | 100.0 /100.0 |
13 /13 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7uo9 | E | Template RNA (55-MER) | A | 100.0 /100.0 |
34 /34 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8sq9 | G | Template RNA | A | 100.0 /100.0 |
31 /31 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7uob | E | Product RNA (35-MER) | A | 100.0 /100.0 |
10 /10 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7uoe | E | Product RNA (35-MER) | A | 100.0 /100.0 |
12 /12 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7uob | F | Template RNA (55-MER) | A | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7uoe | F | Template RNA (55-MER) | A | 100.0 /100.0 |
30 /30 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gw1 | F | Template | A | 100.0 /99.9 |
23 /23 |
R1AB_SARS2 Replicase polyprotein 1ab | |
8gwk | F | template | A | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gwm | I | RNA (26-MER) | A | 100.0 /100.0 |
22 /22 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gwb | H | RNA (5'-R(P*AP*U)-3') | A | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gwb | J | template | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gwf | F | template | A | 100.0 /100.0 |
22 /22 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gwg | F | Template | A | 100.0 /100.0 |
22 /22 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gwi | F | RNA (27-MER) | A | 100.0 /100.0 |
22 /22 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gwn | F | template | A | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gwo | F | template | A | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gwe | H | RNA (5'-R(P*AP*UP*UP*A)-3') | A | 100.0 /100.0 |
15 /15 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8sq9 | F | Primer RNA | A | 100.0 /100.0 |
14 /14 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8sqj | F | Primer RNA | A | 100.0 /100.0 |
12 /12 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8sqj | G | Template RNA | A | 100.0 /100.0 |
23 /23 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8sqj | H | SARS-CoV-2 5' UTR | A | 100.0 /100.0 |
18 /18 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8sqk | F | Primer RNA | A | 100.0 /100.0 |
12 /12 |
R1AB_SARS2 RNA-directed RNA polymerase nsp12 | |
8sqk | G | Template RNA | A | 100.0 /100.0 |
23 /23 |
R1AB_SARS2 RNA-directed RNA polymerase nsp12 | |
8sqk | H | SARS-CoV-2 5' UTR | A | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 RNA-directed RNA polymerase nsp12 | |
7cxm | F | RNA (26-MER) | A | 100.0 /99.9 |
23 /23 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7cxn | F | Template RNA | A | 100.0 /99.9 |
20 /20 |
R1AB_SARS2 RNA-directed RNA polymerase | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
COMPOUND | |||||||
932 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
6xez | L |
ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms] |
A | 100.0 /100.0 |
11 /11 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7krn | K |
ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms] |
A | 100.0 /100.0 |
12 /12 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7kro | L |
ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms] |
A | 100.0 /100.0 |
11 /11 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7krp | J |
ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms] |
A | 100.0 /100.0 |
11 /11 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7rdx | L |
ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms] |
A | 100.0 /100.0 |
12 /12 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7rdy | L |
ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms] |
A | 100.0 /100.0 |
11 /11 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7rdz | L |
ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms] |
A | 100.0 /100.0 |
11 /11 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7re0 | L |
ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms] |
A | 100.0 /100.0 |
12 /12 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7re1 | L |
ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms] |
A | 100.0 /100.0 |
12 /12 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7re2 | K |
ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms] |
A | 100.0 /100.0 |
13 /13 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7re3 | T |
ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms] |
A | 100.0 /100.0 |
12 /12 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7re3 | KA |
ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms] |
J | 100.0 /100.0 |
12 /12 |
R1AB_SARS2 RNA-directed RNA polymerase | |
6xez | M |
1N7
CHAPSO[35 atoms] |
A | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 RNA-directed RNA polymerase | |
6xez | N |
1N7
CHAPSO[26 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 RNA-directed RNA polymerase | |
6xez | U |
1N7
CHAPSO[36 atoms] |
A | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7krn | L |
1N7
CHAPSO[35 atoms] |
A | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7krn | M |
1N7
CHAPSO[26 atoms] |
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7krn | T |
1N7
CHAPSO[36 atoms] |
A | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7kro | M |
1N7
CHAPSO[35 atoms] |
A | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7kro | N |
1N7
CHAPSO[26 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7kro | U |
1N7
CHAPSO[36 atoms] |
A | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7krp | K |
1N7
CHAPSO[35 atoms] |
A | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7krp | L |
1N7
CHAPSO[26 atoms] |
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7krp | M |
1N7
CHAPSO[36 atoms] |
A | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7rdx | M |
1N7
CHAPSO[35 atoms] |
A | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7rdx | N |
1N7
CHAPSO[26 atoms] |
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7rdx | U |
1N7
CHAPSO[36 atoms] |
A | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7rdy | M |
1N7
CHAPSO[35 atoms] |
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7rdy | N |
1N7
CHAPSO[26 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7rdy | O |
1N7
CHAPSO[36 atoms] |
A | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7re1 | M |
1N7
CHAPSO[35 atoms] |
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7re1 | N |
1N7
CHAPSO[26 atoms] |
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7re1 | U |
1N7
CHAPSO[36 atoms] |
A | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7re2 | L |
1N7
CHAPSO[35 atoms] |
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7re2 | M |
1N7
CHAPSO[26 atoms] |
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7re2 | T |
1N7
CHAPSO[36 atoms] |
A | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7re3 | AA |
1N7
CHAPSO[36 atoms] |
A | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7re3 | RA |
1N7
CHAPSO[36 atoms] |
J | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7aap | M |
GE6
[[(2~{R},3~{S},4~{R},5~{R})-5-(3-aminocarbonyl-5-f.. |
A | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Non-structural protein 12 | |
7ctt | J |
GE6
[[(2~{R},3~{S},4~{R},5~{R})-5-(3-aminocarbonyl-5-f.. |
A | 100.0 /100.0 |
13 /13 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7bv2 | K |
F86
[(2~{R},3~{S},4~{R},5~{R})-5-(4-azanylpyrrolo[2,1-.. |
A | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gwk | T |
F86
[(2~{R},3~{S},4~{R},5~{R})-5-(4-azanylpyrrolo[2,1-.. |
A | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7cyq | L |
GDP
GUANOSINE-5'-DIPHOSPHATE[28 atoms] |
A | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7d4f | G |
H3U
8-(3-(3-aminobenzamido)-4-methylbenzamido)naphthal.. |
D | 100.0 /100.0 |
12 /12 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7d4f | H |
H3U
8-(3-(3-aminobenzamido)-4-methylbenzamido)naphthal.. |
D | 100.0 /100.0 |
12 /12 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7dfg | G |
1RP
6-fluoro-3-oxo-4-(5-O-phosphono-beta-D-ribofuranos.. |
C | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7dfh | N |
RVP
RIBAVIRIN MONOPHOSPHATE[20 atoms] |
A | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 RNA-directed RNA polymeras | |
7doi | O |
HCU
[(2R)-4-(2-azanyl-6-oxidanylidene-3H-purin-9-yl)-2.. |
A | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7dok | G |
HCU
[(2R)-4-(2-azanyl-6-oxidanylidene-3H-purin-9-yl)-2.. |
C | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7ed5 | J |
AT9
[[(2R,3R,4R,5R)-5-(2-azanyl-6-oxidanylidene-1H-pur.. |
A | 100.0 /100.0 |
16 /16 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7ed5 | K |
AT9
[[(2R,3R,4R,5R)-5-(2-azanyl-6-oxidanylidene-1H-pur.. |
A | 100.0 /100.0 |
11 /11 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7ed5 | N |
AT9
[[(2R,3R,4R,5R)-5-(2-azanyl-6-oxidanylidene-1H-pur.. |
A | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7uo4 | G |
NWX
[[(2~{R},3~{S},4~{R},5~{R})-5-(4-azanylpyrrolo[2,1.. |
A | 100.0 /100.0 |
17 /17 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7uo7 | G |
ATP
ADENOSINE-5'-TRIPHOSPHATE[31 atoms] |
A | 100.0 /100.0 |
14 /14 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7uo9 | J |
UTP
URIDINE 5'-TRIPHOSPHATE [29 atoms] |
A | 100.0 /100.0 |
12 /12 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7uob | L |
GTP
GUANOSINE-5'-TRIPHOSPHATE[32 atoms] |
A | 100.0 /100.0 |
16 /16 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7uob | M |
GTP
GUANOSINE-5'-TRIPHOSPHATE[32 atoms] |
A | 100.0 /100.0 |
19 /19 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gwf | L |
GTP
GUANOSINE-5'-TRIPHOSPHATE[32 atoms] |
A | 100.0 /100.0 |
14 /14 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gwg | L |
GTP
GUANOSINE-5'-TRIPHOSPHATE[32 atoms] |
A | 100.0 /100.0 |
14 /14 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gwi | L |
GTP
GUANOSINE-5'-TRIPHOSPHATE[32 atoms] |
A | 100.0 /100.0 |
14 /14 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7uob | N |
L2B
3'-DEOXYURIDINE-5'-MONOPHOSPHATE[19 atoms] |
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7uoe | L |
L2B
3'-DEOXYURIDINE-5'-MONOPHOSPHATE[19 atoms] |
A | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7uoe | K |
CTP
CYTIDINE-5'-TRIPHOSPHATE[29 atoms] |
A | 100.0 /100.0 |
14 /14 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gw1 | T |
U5P
URIDINE-5'-MONOPHOSPHATE[20 atoms] |
A | 100.0 /99.9 |
8 /8 |
R1AB_SARS2 Replicase polyprotein 1ab | |
8gwo | S |
U5P
URIDINE-5'-MONOPHOSPHATE[20 atoms] |
A | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gwe | M |
GNP
PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER[32 ato.. |
A | 100.0 /100.0 |
13 /13 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gwk | L |
GNP
PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER[32 ato.. |
A | 100.0 /100.0 |
17 /17 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gwm | L |
GNP
PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER[32 ato.. |
A | 100.0 /100.0 |
16 /16 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gwn | L |
GNP
PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER[32 ato.. |
A | 100.0 /100.0 |
16 /16 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gwo | L |
GNP
PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER[32 ato.. |
A | 100.0 /100.0 |
18 /18 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gwm | S |
6GS
2'-deoxy-2'-fluoro-2'-methyluridine 5'-(trihydroge.. |
A | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gy6 | E |
GO3
Gossypol[38 atoms] |
A | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gy6 | F |
GO3
Gossypol[38 atoms] |
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8sq9 | L |
WSB
5'-O-[(S)-hydroxy{[(S)-hydroxy(phosphonooxy)phosph.. |
A | 100.0 /100.0 |
15 /15 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8sq9 | O |
WSB
5'-O-[(S)-hydroxy{[(S)-hydroxy(phosphonooxy)phosph.. |
A | 100.0 /100.0 |
12 /12 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8sqj | I |
VSN
5'-O-[(R)-hydroxy(thiophosphonooxy)phosphoryl]guan.. |
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8sqk | I |
VSN
5'-O-[(R)-hydroxy(thiophosphonooxy)phosphoryl]guan.. |
A | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 RNA-directed RNA polymerase nsp12 | |
8sqk | J |
VSN
5'-O-[(R)-hydroxy(thiophosphonooxy)phosphoryl]guan.. |
A | 100.0 /100.0 |
17 /17 |
R1AB_SARS2 RNA-directed RNA polymerase nsp12 | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
METAL | |||||||
932 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
6nur | E |
ZN
ZINC ION[1 atoms] |
A | 100.0 /97.0 |
4 /4 |
R1AB_CVHSA NSP12 | |
6nur | F |
ZN
ZINC ION[1 atoms] |
A | 100.0 /97.0 |
4 /4 |
R1AB_CVHSA NSP12 | |
6nus | C |
ZN
ZINC ION[1 atoms] |
A | 100.0 /96.6 |
4 /4 |
R1AB_CVHSA NSP12 | |
6nus | D |
ZN
ZINC ION[1 atoms] |
A | 100.0 /96.6 |
4 /4 |
R1AB_CVHSA NSP12 | |
6xez | I |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 RNA-directed RNA polymerase | |
6xez | J |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 RNA-directed RNA polymerase | |
6xqb | G |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 RNA-directed RNA polymerase | |
6xqb | H |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 RNA-directed RNA polymerase | |
6yyt | I |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 nsp12 | |
6yyt | J |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 nsp12 | |
7aap | G |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 12 | |
7aap | H |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 12 | |
7b3b | F |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 RNA-directed RNA polymerase nsp12 | |
7b3b | G |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 RNA-directed RNA polymerase nsp12 | |
7b3c | F |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 RNA-directed RNA polymerase nsp12 | |
7b3c | G |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 RNA-directed RNA polymerase nsp12 | |
7b3d | F |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 SARS-CoV-2 RNA-dependent RNA polymerase nsp12 | |
7b3d | G |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 SARS-CoV-2 RNA-dependent RNA polymerase nsp12 | |
7btf | E |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7btf | F |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7bv1 | E |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7bv1 | F |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7bv2 | F |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7bv2 | G |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7bw4 | E |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7bw4 | F |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7bzf | G |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7bzf | H |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7c2k | G |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7c2k | H |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7ctt | G |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7ctt | H |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7cxm | J |
ZN
ZINC ION[1 atoms] |
A | 100.0 /99.9 |
4 /4 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7cxm | K |
ZN
ZINC ION[1 atoms] |
A | 100.0 /99.9 |
5 /5 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7cxn | J |
ZN
ZINC ION[1 atoms] |
A | 100.0 /99.9 |
4 /4 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7cxn | K |
ZN
ZINC ION[1 atoms] |
A | 100.0 /99.9 |
6 /6 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7cyq | J |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7cyq | K |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7d4f | E |
ZN
ZINC ION[1 atoms] |
D | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7d4f | F |
ZN
ZINC ION[1 atoms] |
D | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7dfg | H |
ZN
ZINC ION[1 atoms] |
C | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7dfg | I |
ZN
ZINC ION[1 atoms] |
C | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7dfh | G |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 RNA-directed RNA polymeras | |
7dfh | H |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 RNA-directed RNA polymeras | |
7doi | G |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7doi | H |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7dok | I |
ZN
ZINC ION[1 atoms] |
C | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7dok | J |
ZN
ZINC ION[1 atoms] |
C | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7dte | G |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7dte | H |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7ed5 | G |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7ed5 | H |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7egq | W |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7egq | X |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7egq | IA |
ZN
ZINC ION[1 atoms] |
I | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7egq | JA |
ZN
ZINC ION[1 atoms] |
I | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7eiz | L |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7eiz | M |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7krn | H |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7krn | I |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7kro | I |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7kro | J |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7krp | G |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7krp | H |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7oyg | K |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 SARS-CoV-2 RNA-dependent RNA polymerase (nsp12) | |
7oyg | L |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 SARS-CoV-2 RNA-dependent RNA polymerase (nsp12) | |
7oyg | M |
ZN
ZINC ION[1 atoms] |
F | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 SARS-CoV-2 RNA-dependent RNA polymerase (nsp12) | |
7oyg | N |
ZN
ZINC ION[1 atoms] |
F | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 SARS-CoV-2 RNA-dependent RNA polymerase (nsp12) | |
7ozu | F |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Replicase polyprotein 1ab | |
7ozu | G |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Replicase polyprotein 1ab | |
7ozv | F |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Replicase polyprotein 1ab | |
7ozv | G |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Replicase polyprotein 1ab | |
7rdx | I |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7rdx | J |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7rdy | I |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7rdy | J |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7rdz | I |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7rdz | J |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7re0 | I |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7re0 | J |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7re1 | I |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7re1 | J |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7re2 | H |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7re2 | I |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7re3 | Q |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7re3 | R |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7re3 | HA |
ZN
ZINC ION[1 atoms] |
J | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7re3 | IA |
ZN
ZINC ION[1 atoms] |
J | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7thm | F |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7thm | G |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7uo4 | I |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7uo4 | J |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7uo7 | I |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7uo7 | J |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7uo9 | G |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7uo9 | H |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7uob | G |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7uob | H |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7uoe | G |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7uoe | H |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gw1 | J |
ZN
ZINC ION[1 atoms] |
A | 100.0 /99.9 |
4 /4 |
R1AB_SARS2 Replicase polyprotein 1ab | |
8gw1 | K |
ZN
ZINC ION[1 atoms] |
A | 100.0 /99.9 |
5 /5 |
R1AB_SARS2 Replicase polyprotein 1ab | |
8gwb | K |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gwb | L |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gwe | K |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gwe | L |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gwf | J |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gwf | K |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gwg | J |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gwg | K |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gwi | J |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gwi | K |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gwk | J |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gwk | K |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gwm | J |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gwm | K |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gwn | J |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gwn | K |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gwo | J |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gwo | K |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8sq9 | H |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8sq9 | I |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8sqj | K |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8sqj | L |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8sqk | K |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 RNA-directed RNA polymerase nsp12 | |
8sqk | L |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 RNA-directed RNA polymerase nsp12 | |
6xez | K |
MG
MAGNESIUM ION[1 atoms] |
A | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 RNA-directed RNA polymerase | |
6xqb | I |
MG
MAGNESIUM ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7aap | I |
MG
MAGNESIUM ION[1 atoms] |
A | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 12 | |
7aap | J |
MG
MAGNESIUM ION[1 atoms] |
A | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 12 | |
7bv2 | I |
MG
MAGNESIUM ION[1 atoms] |
A | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7bv2 | J |
MG
MAGNESIUM ION[1 atoms] |
A | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7ctt | I |
MG
MAGNESIUM ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7cyq | M |
MG
MAGNESIUM ION[1 atoms] |
A | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7dfg | K |
MG
MAGNESIUM ION[1 atoms] |
C | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7dfg | L |
MG
MAGNESIUM ION[1 atoms] |
C | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7dfg | N |
MG
MAGNESIUM ION[1 atoms] |
C | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7dfg | O |
MG
MAGNESIUM ION[1 atoms] |
C | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7dfh | I |
MG
MAGNESIUM ION[1 atoms] |
A | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 RNA-directed RNA polymeras | |
7dfh | J |
MG
MAGNESIUM ION[1 atoms] |
A | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 RNA-directed RNA polymeras | |
7dfh | K |
MG
MAGNESIUM ION[1 atoms] |
A | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 RNA-directed RNA polymeras | |
7doi | J |
MG
MAGNESIUM ION[1 atoms] |
A | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7doi | K |
MG
MAGNESIUM ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7doi | L |
MG
MAGNESIUM ION[1 atoms] |
A | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7doi | M |
MG
MAGNESIUM ION[1 atoms] |
A | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7dok | H |
MG
MAGNESIUM ION[1 atoms] |
C | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7dok | L |
MG
MAGNESIUM ION[1 atoms] |
C | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7dok | M |
MG
MAGNESIUM ION[1 atoms] |
C | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7dok | N |
MG
MAGNESIUM ION[1 atoms] |
C | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7ed5 | I |
MG
MAGNESIUM ION[1 atoms] |
A | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7ed5 | L |
MG
MAGNESIUM ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7ed5 | M |
MG
MAGNESIUM ION[1 atoms] |
A | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7krn | J |
MG
MAGNESIUM ION[1 atoms] |
A | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7kro | K |
MG
MAGNESIUM ION[1 atoms] |
A | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7krp | I |
MG
MAGNESIUM ION[1 atoms] |
A | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7rdx | K |
MG
MAGNESIUM ION[1 atoms] |
A | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7rdy | K |
MG
MAGNESIUM ION[1 atoms] |
A | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7rdz | K |
MG
MAGNESIUM ION[1 atoms] |
A | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7re0 | K |
MG
MAGNESIUM ION[1 atoms] |
A | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7re1 | K |
MG
MAGNESIUM ION[1 atoms] |
A | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7re2 | J |
MG
MAGNESIUM ION[1 atoms] |
A | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7re3 | S |
MG
MAGNESIUM ION[1 atoms] |
A | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7re3 | JA |
MG
MAGNESIUM ION[1 atoms] |
J | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7uo4 | H |
MG
MAGNESIUM ION[1 atoms] |
A | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7uo7 | H |
MG
MAGNESIUM ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7uo9 | I |
MG
MAGNESIUM ION[1 atoms] |
A | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7uob | I |
MG
MAGNESIUM ION[1 atoms] |
A | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7uob | J |
MG
MAGNESIUM ION[1 atoms] |
A | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7uob | K |
MG
MAGNESIUM ION[1 atoms] |
A | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7uoe | I |
MG
MAGNESIUM ION[1 atoms] |
A | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7uoe | J |
MG
MAGNESIUM ION[1 atoms] |
A | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gwe | N |
MG
MAGNESIUM ION[1 atoms] |
A | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gwk | M |
MG
MAGNESIUM ION[1 atoms] |
A | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8sq9 | J |
MG
MAGNESIUM ION[1 atoms] |
A | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8sq9 | K |
MG
MAGNESIUM ION[1 atoms] |
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8sq9 | M |
MG
MAGNESIUM ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8sq9 | N |
MG
MAGNESIUM ION[1 atoms] |
A | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8sqj | J |
MG
MAGNESIUM ION[1 atoms] |
A | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8sqk | M |
MG
MAGNESIUM ION[1 atoms] |
A | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 RNA-directed RNA polymerase nsp12 | |
7thm | H |
MN
MANGANESE (II) ION[1 atoms] |
A | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gw1 | L |
MN
MANGANESE (II) ION[1 atoms] |
A | 100.0 /99.9 |
2 /2 |
R1AB_SARS2 Replicase polyprotein 1ab | |
8gw1 | M |
MN
MANGANESE (II) ION[1 atoms] |
A | 100.0 /99.9 |
3 /3 |
R1AB_SARS2 Replicase polyprotein 1ab | |
8gwb | M |
MN
MANGANESE (II) ION[1 atoms] |
A | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 RNA-directed RNA polymerase | |
8gwb | N |
MN
MANGANESE (II) ION[1 atoms] |
A | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 RNA-directed RNA polymerase | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
HOMO | |||||||
932 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
7egq | I | R1AB_SARS2 RNA-directed RNA polymerase[926 aa] | A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7egq | A | R1AB_SARS2 RNA-directed RNA polymerase[926 aa] | I | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7re3 | J | R1AB_SARS2 RNA-directed RNA polymerase[927 aa] | A | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7re3 | A | R1AB_SARS2 RNA-directed RNA polymerase[927 aa] | J | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 RNA-directed RNA polymerase | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
PRECIPITANT | |||||||
932 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
7aap | K |
POP
PYROPHOSPHATE 2-[9 atoms] |
A | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Non-structural protein 12 | |
7bv2 | H |
POP
PYROPHOSPHATE 2-[9 atoms] |
A | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7dfg | J |
POP
PYROPHOSPHATE 2-[9 atoms] |
C | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7dfg | M |
POP
PYROPHOSPHATE 2-[9 atoms] |
C | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7dfh | L |
POP
PYROPHOSPHATE 2-[9 atoms] |
A | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 RNA-directed RNA polymeras | |
7dfh | M |
POP
PYROPHOSPHATE 2-[9 atoms] |
A | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 RNA-directed RNA polymeras | |
7doi | I |
POP
PYROPHOSPHATE 2-[9 atoms] |
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7doi | N |
POP
PYROPHOSPHATE 2-[9 atoms] |
A | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7dok | K |
POP
PYROPHOSPHATE 2-[9 atoms] |
C | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7dok | O |
POP
PYROPHOSPHATE 2-[9 atoms] |
C | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 RNA-directed RNA polymerase | |
7thm | I |
POP
PYROPHOSPHATE 2-[9 atoms] |
A | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 RNA-directed RNA polymerase | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. |