HOMCOS(prot_sch_conbars.cgi):

		Contact Molecules for Homologous Proteins
[Full Bars]	[SiteTable]	Summary Bars[0.0 %]	[Back to Search Page]	[Back to HOMCOS]
[SupCon3D]	[help]	seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]	[show] [download] [help]

PID

QueryLength

Homolgous Sequence in PDB

UniProt Query

TITLE

3177296

425

P84022(SMAD3_HUMAN)

RecName: Full=Mothers against decapentaplegic homolog 3; Short=MAD homolog 3; Short=Mad3; Short=Mothers against DPP homolog 3; Short=hMAD-3;AltName: Full=JV15-2;AltName: Full=SMAD family member 3; Short=SMAD 3; Short=Smad3; Short=hSMAD3;

QUERYSEQ

MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEVCVNPYHYQRVETPVLPPVLVPRHTEIPAEF
PPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIG
GEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIRCSSVS

[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [P84022(SMAD3_HUMAN)]

425
	region	name	description
	2-425	CHAIN	/note="Mothers against decapentaplegic homolog 3" /id="PRO_0000090856"
	10-136	DOMAIN	/note="MH1"
	232-425	DOMAIN	/note="MH2"
	137-231	REGION	/note="Linker"
	165-208	REGION	/note="Disordered"
	271-324	REGION	/note="Sufficient for interaction with XPO4"
	64-64	BINDING	/ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105"
	109-109	BINDING	/ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105"
	121-121	BINDING	/ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105"
	126-126	BINDING	/ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105"
	1-425	DISORDER	predicted by DISOPRED

MONOMER

425

pdb_id a¹ identity[%]² description

1mk2 A 100.0 SMAD3_HUMAN SMAD 3

1ozj C 100.0 SMAD3_HUMAN SMAD 3

1.a¹:asym_id for the homologue. 2.identity[%]²:sequence identity between the query and the homologue.

HETERO

425 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

1dev[4] B ZFYV9_HUMAN Smad anchor for receptor activation[41 aa] A 100.0
/97.4 31
/31 SMAD2_HUMAN MAD (mothers against decapentaplegic, Drosophila) ..

5xoc[3] B THIO_ECOLI FOXH1_HUMAN Thioredoxin 1,Forkhead box protein H1[133 aa] A 100.0
/100.0 26
/26 SMAD3_HUMAN Mothers against decapentaplegic homolog 3

5zoj[1] E MAN1_HUMAN Inner nuclear membrane protein Man1[116 aa] B 100.0
/97.8 15
/15 SMAD2_HUMAN Mothers against decapentaplegic homolog 2

6m64[2] B CBP[19 aa] A 100.0
/96.0 11
/11 SMAD2_HUMAN Mothers against decapentaplegic homolog 2

6m64[1] F CBP[27 aa] E 100.0
/97.4 16
/16 SMAD2_HUMAN Mothers against decapentaplegic homolog 2

7co1[2] B CBP_HUMAN CREB-binding protein[20 aa] A 100.0
/97.4 12
/12 SMAD2_HUMAN Mothers against decapentaplegic homolog 2

7co1[1] F CBP_HUMAN CREB-binding protein[18 aa] E 100.0
/97.4 14
/14 SMAD2_HUMAN Mothers against decapentaplegic homolog 2

1u7f[2] B SMAD4_HUMAN Mothers against decapentaplegic homolog 4[193 aa] A 96.3
/100.0 27
/28 SMAD3_HUMAN Mothers against decapentaplegic homolog 3

1u7f[2] B SMAD4_HUMAN Mothers against decapentaplegic homolog 4[193 aa] C 100.0
/100.0 20
/20 SMAD3_HUMAN Mothers against decapentaplegic homolog 3

5xod[3] B SKI_HUMAN Ski oncogene[22 aa] A 100.0
/97.4 20
/20 SMAD2_HUMAN Mothers against decapentaplegic homolog 2

6zvq[3] B SKI_HUMAN Ski oncogene[27 aa] A 95.0
/96.5 20
/20 SMAD2_HUMAN Mothers against decapentaplegic homolog 2

5zoj[7] D MAN1_HUMAN Inner nuclear membrane protein Man1[127 aa] A 100.0
/97.9 12
/12 SMAD2_HUMAN Mothers against decapentaplegic homolog 2

5c4v[3] D SKIL_HUMAN Ski-like protein[96 aa] A 46.7
/53.3 15
/16 SMAD4_HUMAN Mothers against decapentaplegic homolog 4

1mr1[2] D SKI_HUMAN Ski oncogene[96 aa] A 35.3
/53.2 17
/17 SMAD4_HUMAN Mothers against decapentaplegic homolog 4

1u7f[2] A SMAD3_HUMAN Mothers against decapentaplegic homolog 3[198 aa] B 68.0
/53.3 25
/25 SMAD4_HUMAN Mothers against decapentaplegic homolog 4

1u7f[2] C SMAD3_HUMAN Mothers against decapentaplegic homolog 3[196 aa] B 60.0
/53.3 20
/23 SMAD4_HUMAN Mothers against decapentaplegic homolog 4

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

NUCLEOTIDE

425 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

1mhd[2] A DNA C 100.0
/100.0 9
/9 SMAD3_HUMAN SMAD3

1mhd[1] B DNA C 100.0
/100.0 4
/4 SMAD3_HUMAN SMAD3

1mhd[1] B DNA D 100.0
/100.0 7
/7 SMAD3_HUMAN SMAD3

1ozj[2] A Smad binding element C 100.0
/100.0 10
/10 SMAD3_HUMAN SMAD 3

5odg[4] C DNA (5'-D(P*CP*AP*GP*GP*CP*TP*AP*GP*CP*CP*TP*GP*CP.. A 100.0
/100.0 8
/8 SMAD3_HUMAN Mothers against decapentaplegic homolog 3

5odg[4] D DNA (5'-D(P*CP*AP*GP*GP*CP*TP*AP*GP*CP*CP*TP*GP*CP.. A 100.0
/100.0 5
/5 SMAD3_HUMAN Mothers against decapentaplegic homolog 3

5od6[2] C DNA (5'-D(P*TP*GP*CP*AP*GP*GP*CP*GP*CP*GP*CP*CP*TP.. A 100.0
/100.0 5
/5 SMAD3_HUMAN Mothers against decapentaplegic homolog 3

5od6[8] D DNA (5'-D(P*TP*GP*CP*AP*GP*GP*CP*GP*CP*GP*CP*CP*TP.. A 100.0
/100.0 9
/9 SMAD3_HUMAN Mothers against decapentaplegic homolog 3

6fzs[2] D DNA (5'-D(P*TP*GP*CP*AP*GP*GP*CP*GP*CP*GP*CP*CP*TP.. A 100.0
/71.0 4
/4 SMAD5_HUMAN Mothers against decapentaplegic homolog 5

6fzt[4] C DNA (5'-D(P*TP*GP*CP*AP*GP*GP*CP*GP*CP*GP*CP*CP*TP.. A 100.0
/73.8 8
/8 SMAD9_HUMAN Mothers against decapentaplegic homolog 9

6h3r[4] C DNA (5'-D(P*GP*AP*GP*TP*GP*TP*CP*TP*GP*CP*AP*GP*AP.. A 100.0
/89.3 8
/8 B7Z5N5_HUMAN Mothers against decapentaplegic homolog

6tce[4] B DNA (5'-D(P*TP*GP*CP*AP*GP*GP*CP*TP*AP*GP*CP*CP*TP.. A 85.7
/71.9 7
/7 SMAD5_HUMAN Mothers against decapentaplegic homolog 5

5x6h[2] B DNA (5'-D(P*GP*TP*AP*TP*GP*GP*CP*GP*CP*CP*AP*TP*AP.. A 100.0
/71.7 9
/9 SMAD5_MOUSE Mothers against decapentaplegic homolog 5

5x6h[2] B DNA (5'-D(P*GP*TP*AP*TP*GP*GP*CP*GP*CP*CP*AP*TP*AP.. A 100.0
/71.7 4
/4 SMAD5_MOUSE Mothers against decapentaplegic homolog 5

5x6m[4] B DNA (5'-D(P*AP*TP*CP*AP*GP*AP*CP*TP*GP*CP*CP*GP*GP.. A 100.0
/71.1 4
/4 SMAD5_MOUSE Mothers against decapentaplegic homolog 5

5x6m[2] C DNA (5'-D(P*TP*TP*AP*TP*AP*GP*AP*CP*TP*GP*CP*CP*GP.. A 100.0
/71.1 10
/10 SMAD5_MOUSE Mothers against decapentaplegic homolog 5

5x6m[2] C DNA (5'-D(P*TP*TP*AP*TP*AP*GP*AP*CP*TP*GP*CP*CP*GP.. D 100.0
/70.8 4
/4 SMAD5_MOUSE Mothers against decapentaplegic homolog 5

1ozj[2] B Smad binding element C 100.0
/100.0 6
/6 SMAD3_HUMAN SMAD 3

3kmp[2] D 5'-D(P*GP*TP*AP*TP*GP*TP*CP*TP*AP*GP*AP*CP*TP*GP*A.. A 100.0
/70.7 4
/4 Q8CC31_MOUSE SMAD1-MH1

3kmp[1] C 5'-D(P*AP*TP*CP*AP*GP*TP*CP*TP*AP*GP*AP*CP*AP*TP*A.. A 87.5
/70.7 8
/8 Q8CC31_MOUSE SMAD1-MH1

3kmp[1] C 5'-D(P*AP*TP*CP*AP*GP*TP*CP*TP*AP*GP*AP*CP*AP*TP*A.. B 100.0
/70.5 5
/5 Q8CC31_MOUSE SMAD1-MH1

5x6g[1] C DNA (5'-D(P*AP*TP*CP*AP*GP*TP*CP*TP*AP*GP*AP*CP*AP.. A 87.5
/71.1 8
/8 SMAD5_MOUSE Mothers against decapentaplegic homolog 5

5x6g[1] C DNA (5'-D(P*AP*TP*CP*AP*GP*TP*CP*TP*AP*GP*AP*CP*AP.. B 100.0
/70.5 5
/5 SMAD5_MOUSE Mothers against decapentaplegic homolog 5

5x6g[2] D DNA (5'-D(P*GP*TP*AP*TP*GP*TP*CP*TP*AP*GP*AP*CP*TP.. A 100.0
/71.1 3
/3 SMAD5_MOUSE Mothers against decapentaplegic homolog 5

5mey[10] B DNA (5'-D(P*AP*TP*GP*CP*GP*GP*GP*CP*GP*CP*GP*CP*CP.. A 62.5
/57.4 8
/8 SMAD4_HUMAN MH1 domain of human Smad4

5mey[2] B DNA (5'-D(P*AP*TP*GP*CP*GP*GP*GP*CP*GP*CP*GP*CP*CP.. A 100.0
/57.4 3
/3 SMAD4_HUMAN MH1 domain of human Smad4

3qsv[8] E DNA (5'-D(P*TP*GP*CP*AP*GP*TP*CP*TP*AP*GP*AP*CP*TP.. A 70.0
/57.4 10
/10 SMAD4_MOUSE Mothers against decapentaplegic homolog 4

5mf0[4] C DNA (5'-D(P*AP*CP*GP*GP*GP*CP*CP*GP*CP*GP*GP*CP*CP.. A 72.7
/57.4 11
/11 SMAD4_HUMAN MH1 domain of human Smad4

5mez[2] C DNA (5'-D(P*GP*CP*AP*GP*GP*CP*TP*AP*GP*CP*CP*TP*GP.. A 57.1
/56.8 7
/7 SMAD4_HUMAN MH1 domain of human Smad4

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

COMPOUND

425 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

6zvq[3] I TAR
D(-)-TARTARIC ACID[10 atoms] A 100.0
/96.5 2
/2 SMAD2_HUMAN Mothers against decapentaplegic homolog 2

6zvq[3] J TAR
D(-)-TARTARIC ACID[10 atoms] A 100.0
/96.5 4
/4 SMAD2_HUMAN Mothers against decapentaplegic homolog 2

6zvq[3] J TAR
D(-)-TARTARIC ACID[10 atoms] A 100.0
/96.5 6
/6 SMAD2_HUMAN Mothers against decapentaplegic homolog 2

6zvq[3] O TAR
D(-)-TARTARIC ACID[10 atoms] A 100.0
/96.5 4
/4 SMAD2_HUMAN Mothers against decapentaplegic homolog 2

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

METAL

425 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

1ozj[2] E ZN
ZINC ION[1 atoms] C 100.0
/100.0 4
/4 SMAD3_HUMAN SMAD 3

3kmp[2] E ZN
ZINC ION[1 atoms] A 100.0
/70.7 4
/4 Q8CC31_MOUSE SMAD1-MH1

3qsv[4] I ZN
ZINC ION[1 atoms] A 100.0
/57.4 4
/4 SMAD4_MOUSE Mothers against decapentaplegic homolog 4

5mey[14] C ZN
ZINC ION[1 atoms] A 100.0
/57.4 4
/4 SMAD4_HUMAN MH1 domain of human Smad4

5nm9[4] E ZN
ZINC ION[1 atoms] A 100.0
/59.8 4
/4 B3S7S5_TRIAD Mothers against decapentaplegic homolog

5od6[6] E ZN
ZINC ION[1 atoms] A 100.0
/100.0 4
/4 SMAD3_HUMAN Mothers against decapentaplegic homolog 3

6fzs[2] E ZN
ZINC ION[1 atoms] A 100.0
/71.0 4
/4 SMAD5_HUMAN Mothers against decapentaplegic homolog 5

6fzt[4] E ZN
ZINC ION[1 atoms] A 100.0
/73.8 4
/4 SMAD9_HUMAN Mothers against decapentaplegic homolog 9

6tbz[1] D ZN
ZINC ION[1 atoms] A 100.0
/73.6 4
/4 SMAD5_HUMAN Mothers against decapentaplegic homolog 5

6tce[2] C ZN
ZINC ION[1 atoms] A 100.0
/71.9 5
/5 SMAD5_HUMAN Mothers against decapentaplegic homolog 5

6zmn[2] G ZN
ZINC ION[1 atoms] A 100.0
/96.7 4
/4 SMAD3_HUMAN Mothers against decapentaplegic homolog 3

5mey[3] D CL
CHLORIDE ION[1 atoms] A 40.0
/57.4 5
/5 SMAD4_HUMAN MH1 domain of human Smad4

5mey[2] E CL
CHLORIDE ION[1 atoms] A 66.7
/57.4 3
/3 SMAD4_HUMAN MH1 domain of human Smad4

5mey[4] F CL
CHLORIDE ION[1 atoms] A 60.0
/57.4 5
/5 SMAD4_HUMAN MH1 domain of human Smad4

5mey[2] G CL
CHLORIDE ION[1 atoms] A 33.3
/57.4 3
/3 SMAD4_HUMAN MH1 domain of human Smad4

5odg[2] F CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 1
/1 SMAD3_HUMAN Mothers against decapentaplegic homolog 3

7cd1[1] G CL
CHLORIDE ION[1 atoms] A 50.0
/34.8 2
/2 SMAD7_MOUSE Mothers against decapentaplegic homolog 7

7cd1[2] H CL
CHLORIDE ION[1 atoms] A 100.0
/34.8 2
/2 SMAD7_MOUSE Mothers against decapentaplegic homolog 7

7cd1[1] R CL
CHLORIDE ION[1 atoms] D 66.7
/34.8 3
/3 SMAD7_MOUSE Mothers against decapentaplegic homolog 7

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

HOMO

425 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

1khx[6] A SMAD2_HUMAN Smad2[203 aa] A 96.3
/96.5 27
/27 SMAD2_HUMAN Smad2

1khx[6] A SMAD2_HUMAN Smad2[203 aa] A 86.7
/96.5 30
/31 SMAD2_HUMAN Smad2

1mk2[2] A SMAD3_HUMAN SMAD 3[197 aa] A 100.0
/100.0 12
/12 SMAD3_HUMAN SMAD 3

1u7f[17] C SMAD3_HUMAN Mothers against decapentaplegic homolog 3[196 aa] A 100.0
/100.0 23
/23 SMAD3_HUMAN Mothers against decapentaplegic homolog 3

1u7f[2] A SMAD3_HUMAN Mothers against decapentaplegic homolog 3[198 aa] C 95.7
/100.0 23
/24 SMAD3_HUMAN Mothers against decapentaplegic homolog 3

5xoc[12] A SMAD3_HUMAN Mothers against decapentaplegic homolog 3[194 aa] A 100.0
/100.0 17
/17 SMAD3_HUMAN Mothers against decapentaplegic homolog 3

5zoj[3] C SMAD2_HUMAN Mothers against decapentaplegic homolog 2[186 aa] A 100.0
/97.9 17
/17 SMAD2_HUMAN Mothers against decapentaplegic homolog 2

1ozj[2] D SMAD3_HUMAN SMAD 3[124 aa] C 100.0
/100.0 1
/1 SMAD3_HUMAN SMAD 3

5od6[2] B SMAD3_HUMAN Mothers against decapentaplegic homolog 3[126 aa] A 100.0
/100.0 5
/5 SMAD3_HUMAN Mothers against decapentaplegic homolog 3

6zmn[2] B SMAD3_HUMAN Mothers against decapentaplegic homolog 3[119 aa] A 88.5
/96.7 26
/26 SMAD3_HUMAN Mothers against decapentaplegic homolog 3

1khu[6] B SMAD1_HUMAN SMAD1[197 aa] A 91.3
/79.2 23
/23 SMAD1_HUMAN SMAD1

1khu[6] C SMAD1_HUMAN SMAD1[197 aa] A 78.3
/79.2 23
/23 SMAD1_HUMAN SMAD1

5zok[6] A SMAD1_HUMAN Mothers against decapentaplegic homolog 1[200 aa] A 88.5
/80.5 26
/26 SMAD1_HUMAN Mothers against decapentaplegic homolog 1

5zok[6] A SMAD1_HUMAN Mothers against decapentaplegic homolog 1[200 aa] A 85.0
/80.5 20
/26 SMAD1_HUMAN Mothers against decapentaplegic homolog 1

3gmj[6] A MAD_DROME Protein mothers against dpp[199 aa] A 80.8
/78.3 26
/26 MAD_DROME Protein mothers against dpp

3gmj[6] A MAD_DROME Protein mothers against dpp[199 aa] A 88.0
/78.3 25
/25 MAD_DROME Protein mothers against dpp

5x6h[2] A SMAD5_MOUSE Mothers against decapentaplegic homolog 5[115 aa] A 100.0
/71.7 3
/3 SMAD5_MOUSE Mothers against decapentaplegic homolog 5

5x6m[6] E SMAD5_MOUSE Mothers against decapentaplegic homolog 5[121 aa] A 76.5
/71.1 17
/17 SMAD5_MOUSE Mothers against decapentaplegic homolog 5

6fzs[2] B SMAD5_HUMAN Mothers against decapentaplegic homolog 5[127 aa] A 65.4
/71.0 26
/26 SMAD5_HUMAN Mothers against decapentaplegic homolog 5

5mez[2] B SMAD4_HUMAN MH1 domain of human Smad4[122 aa] A 30.0
/56.8 10
/10 SMAD4_HUMAN MH1 domain of human Smad4

1dd1[3] A SMAD4_HUMAN SMAD4[221 aa] B 47.1
/51.1 17
/18 SMAD4_HUMAN SMAD4

1dd1[3] A SMAD4_HUMAN SMAD4[221 aa] C 73.3
/51.1 15
/15 SMAD4_HUMAN SMAD4

1ygs[3] A SMA4_HUMAN SMAD4[190 aa] A 53.8
/53.2 13
/13 SMA4_HUMAN SMAD4

1ygs[3] A SMA4_HUMAN SMAD4[190 aa] A 75.0
/53.2 12
/12 SMA4_HUMAN SMAD4

1dd1[6] B SMAD4_HUMAN SMAD4[249 aa] A 73.7
/49.5 19
/19 SMAD4_HUMAN SMAD4

1dd1[6] C SMAD4_HUMAN SMAD4[241 aa] A 60.0
/49.5 15
/15 SMAD4_HUMAN SMAD4

1dd1[2] B SMAD4_HUMAN SMAD4[249 aa] B 12.5
/51.1 8
/16 SMAD4_HUMAN SMAD4

7cd1[4] C SMAD7_MOUSE Mothers against decapentaplegic homolog 7[180 aa] A 25.8
/34.8 31
/40 SMAD7_MOUSE Mothers against decapentaplegic homolog 7

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

PRECIPITANT

425 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

1mk2[4] C ACY
ACETIC ACID[4 atoms] A 100.0
/100.0 6
/6 SMAD3_HUMAN SMAD 3

1mk2[2] D ACY
ACETIC ACID[4 atoms] A 100.0
/100.0 6
/6 SMAD3_HUMAN SMAD 3

1mk2[2] E ACY
ACETIC ACID[4 atoms] A 100.0
/100.0 3
/3 SMAD3_HUMAN SMAD 3

1mk2[2] F ACY
ACETIC ACID[4 atoms] A 100.0
/100.0 4
/4 SMAD3_HUMAN SMAD 3

6zmn[1] E ACT
ACETATE ION[4 atoms] A 100.0
/96.7 3
/3 SMAD3_HUMAN Mothers against decapentaplegic homolog 3

6zmn[1] F EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/96.7 6
/6 SMAD3_HUMAN Mothers against decapentaplegic homolog 3

6zmn[1] H PGE
TRIETHYLENE GLYCOL[10 atoms] B 66.7
/96.6 3
/3 SMAD3_HUMAN Mothers against decapentaplegic homolog 3

3kmp[5] F GOL
GLYCEROL[6 atoms] A 83.3
/70.7 6
/6 Q8CC31_MOUSE SMAD1-MH1

5c4v[4] G GOL
GLYCEROL[6 atoms] A 80.0
/53.3 5
/5 SMAD4_HUMAN Mothers against decapentaplegic homolog 4

6fzt[2] F GOL
GLYCEROL[6 atoms] A 100.0
/73.8 4
/4 SMAD9_HUMAN Mothers against decapentaplegic homolog 9

6fzt[4] H GOL
GLYCEROL[6 atoms] B 100.0
/73.6 6
/6 SMAD9_HUMAN Mothers against decapentaplegic homolog 9

6zvq[3] F GOL
GLYCEROL[6 atoms] A 100.0
/96.5 1
/1 SMAD2_HUMAN Mothers against decapentaplegic homolog 2

6zvq[3] G GOL
GLYCEROL[6 atoms] A 100.0
/96.5 4
/4 SMAD2_HUMAN Mothers against decapentaplegic homolog 2

6zvq[3] H GOL
GLYCEROL[6 atoms] A 100.0
/96.5 3
/3 SMAD2_HUMAN Mothers against decapentaplegic homolog 2

6zvq[3] H GOL
GLYCEROL[6 atoms] A 0.0
/96.5 1
/1 SMAD2_HUMAN Mothers against decapentaplegic homolog 2

6zvq[3] L GOL
GLYCEROL[6 atoms] A 100.0
/96.5 4
/4 SMAD2_HUMAN Mothers against decapentaplegic homolog 2

6zvq[3] L GOL
GLYCEROL[6 atoms] A 80.0
/96.5 5
/5 SMAD2_HUMAN Mothers against decapentaplegic homolog 2

6zvq[3] M GOL
GLYCEROL[6 atoms] A 100.0
/96.5 3
/3 SMAD2_HUMAN Mothers against decapentaplegic homolog 2

6zvq[3] N GOL
GLYCEROL[6 atoms] A 100.0
/96.5 2
/2 SMAD2_HUMAN Mothers against decapentaplegic homolog 2

5mey[2] H PEG
DI(HYDROXYETHYL)ETHER[7 atoms] A 40.0
/57.4 5
/5 SMAD4_HUMAN MH1 domain of human Smad4

5mey[2] I PEG
DI(HYDROXYETHYL)ETHER[7 atoms] A 100.0
/57.4 1
/1 SMAD4_HUMAN MH1 domain of human Smad4

1dd1[8] D SO4
SULFATE ION[5 atoms] A 100.0
/49.5 2
/2 SMAD4_HUMAN SMAD4

1dd1[6] E SO4
SULFATE ION[5 atoms] A 75.0
/49.5 4
/4 SMAD4_HUMAN SMAD4

1dd1[4] H SO4
SULFATE ION[5 atoms] A 100.0
/49.5 2
/2 SMAD4_HUMAN SMAD4

1dd1[9] G SO4
SULFATE ION[5 atoms] B 0.0
/51.1 2
/4 SMAD4_HUMAN SMAD4

6zvq[3] D SO4
SULFATE ION[5 atoms] A 100.0
/96.5 5
/5 SMAD2_HUMAN Mothers against decapentaplegic homolog 2

7cd1[2] E SO4
SULFATE ION[5 atoms] A 66.7
/34.8 3
/3 SMAD7_MOUSE Mothers against decapentaplegic homolog 7

7cd1[2] I SO4
SULFATE ION[5 atoms] B 75.0
/34.8 4
/4 SMAD7_MOUSE Mothers against decapentaplegic homolog 7

7cd1[3] J SO4
SULFATE ION[5 atoms] B 75.0
/34.8 4
/4 SMAD7_MOUSE Mothers against decapentaplegic homolog 7

7cd1[1] L SO4
SULFATE ION[5 atoms] C 0.0
/34.8 2
/2 SMAD7_MOUSE Mothers against decapentaplegic homolog 7

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

MONOMER
425
	pdb_id	a¹	identity[%]²	description
	1mk2	A	100.0	SMAD3_HUMAN SMAD 3
	1ozj	C	100.0	SMAD3_HUMAN SMAD 3
	1.a¹:asym_id for the homologue. 2.identity[%]²:sequence identity between the query and the homologue.

HETERO
425	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	1dev[4]	B	ZFYV9_HUMAN Smad anchor for receptor activation[41 aa]	A	100.0 /97.4	31 /31	SMAD2_HUMAN MAD (mothers against decapentaplegic, Drosophila) ..
	5xoc[3]	B	THIO_ECOLI FOXH1_HUMAN Thioredoxin 1,Forkhead box protein H1[133 aa]	A	100.0 /100.0	26 /26	SMAD3_HUMAN Mothers against decapentaplegic homolog 3
	5zoj[1]	E	MAN1_HUMAN Inner nuclear membrane protein Man1[116 aa]	B	100.0 /97.8	15 /15	SMAD2_HUMAN Mothers against decapentaplegic homolog 2
	6m64[2]	B	CBP[19 aa]	A	100.0 /96.0	11 /11	SMAD2_HUMAN Mothers against decapentaplegic homolog 2
	6m64[1]	F	CBP[27 aa]	E	100.0 /97.4	16 /16	SMAD2_HUMAN Mothers against decapentaplegic homolog 2
	7co1[2]	B	CBP_HUMAN CREB-binding protein[20 aa]	A	100.0 /97.4	12 /12	SMAD2_HUMAN Mothers against decapentaplegic homolog 2
	7co1[1]	F	CBP_HUMAN CREB-binding protein[18 aa]	E	100.0 /97.4	14 /14	SMAD2_HUMAN Mothers against decapentaplegic homolog 2
	1u7f[2]	B	SMAD4_HUMAN Mothers against decapentaplegic homolog 4[193 aa]	A	96.3 /100.0	27 /28	SMAD3_HUMAN Mothers against decapentaplegic homolog 3
	1u7f[2]	B	SMAD4_HUMAN Mothers against decapentaplegic homolog 4[193 aa]	C	100.0 /100.0	20 /20	SMAD3_HUMAN Mothers against decapentaplegic homolog 3
	5xod[3]	B	SKI_HUMAN Ski oncogene[22 aa]	A	100.0 /97.4	20 /20	SMAD2_HUMAN Mothers against decapentaplegic homolog 2
	6zvq[3]	B	SKI_HUMAN Ski oncogene[27 aa]	A	95.0 /96.5	20 /20	SMAD2_HUMAN Mothers against decapentaplegic homolog 2
	5zoj[7]	D	MAN1_HUMAN Inner nuclear membrane protein Man1[127 aa]	A	100.0 /97.9	12 /12	SMAD2_HUMAN Mothers against decapentaplegic homolog 2
	5c4v[3]	D	SKIL_HUMAN Ski-like protein[96 aa]	A	46.7 /53.3	15 /16	SMAD4_HUMAN Mothers against decapentaplegic homolog 4
	1mr1[2]	D	SKI_HUMAN Ski oncogene[96 aa]	A	35.3 /53.2	17 /17	SMAD4_HUMAN Mothers against decapentaplegic homolog 4
	1u7f[2]	A	SMAD3_HUMAN Mothers against decapentaplegic homolog 3[198 aa]	B	68.0 /53.3	25 /25	SMAD4_HUMAN Mothers against decapentaplegic homolog 4
	1u7f[2]	C	SMAD3_HUMAN Mothers against decapentaplegic homolog 3[196 aa]	B	60.0 /53.3	20 /23	SMAD4_HUMAN Mothers against decapentaplegic homolog 4
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
NUCLEOTIDE
425	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	1mhd[2]	A	DNA	C	100.0 /100.0	9 /9	SMAD3_HUMAN SMAD3
	1mhd[1]	B	DNA	C	100.0 /100.0	4 /4	SMAD3_HUMAN SMAD3
	1mhd[1]	B	DNA	D	100.0 /100.0	7 /7	SMAD3_HUMAN SMAD3
	1ozj[2]	A	Smad binding element	C	100.0 /100.0	10 /10	SMAD3_HUMAN SMAD 3
	5odg[4]	C	DNA (5'-D(PCPAPGPGPCPTPAPGPCPCPTPGP*CP..	A	100.0 /100.0	8 /8	SMAD3_HUMAN Mothers against decapentaplegic homolog 3
	5odg[4]	D	DNA (5'-D(PCPAPGPGPCPTPAPGPCPCPTPGP*CP..	A	100.0 /100.0	5 /5	SMAD3_HUMAN Mothers against decapentaplegic homolog 3
	5od6[2]	C	DNA (5'-D(PTPGPCPAPGPGPCPGPCPGPCPCP*TP..	A	100.0 /100.0	5 /5	SMAD3_HUMAN Mothers against decapentaplegic homolog 3
	5od6[8]	D	DNA (5'-D(PTPGPCPAPGPGPCPGPCPGPCPCP*TP..	A	100.0 /100.0	9 /9	SMAD3_HUMAN Mothers against decapentaplegic homolog 3
	6fzs[2]	D	DNA (5'-D(PTPGPCPAPGPGPCPGPCPGPCPCP*TP..	A	100.0 /71.0	4 /4	SMAD5_HUMAN Mothers against decapentaplegic homolog 5
	6fzt[4]	C	DNA (5'-D(PTPGPCPAPGPGPCPGPCPGPCPCP*TP..	A	100.0 /73.8	8 /8	SMAD9_HUMAN Mothers against decapentaplegic homolog 9
	6h3r[4]	C	DNA (5'-D(PGPAPGPTPGPTPCPTPGPCPAPGP*AP..	A	100.0 /89.3	8 /8	B7Z5N5_HUMAN Mothers against decapentaplegic homolog
	6tce[4]	B	DNA (5'-D(PTPGPCPAPGPGPCPTPAPGPCPCP*TP..	A	85.7 /71.9	7 /7	SMAD5_HUMAN Mothers against decapentaplegic homolog 5
	5x6h[2]	B	DNA (5'-D(PGPTPAPTPGPGPCPGPCPCPAPTP*AP..	A	100.0 /71.7	9 /9	SMAD5_MOUSE Mothers against decapentaplegic homolog 5
	5x6h[2]	B	DNA (5'-D(PGPTPAPTPGPGPCPGPCPCPAPTP*AP..	A	100.0 /71.7	4 /4	SMAD5_MOUSE Mothers against decapentaplegic homolog 5
	5x6m[4]	B	DNA (5'-D(PAPTPCPAPGPAPCPTPGPCPCPGP*GP..	A	100.0 /71.1	4 /4	SMAD5_MOUSE Mothers against decapentaplegic homolog 5
	5x6m[2]	C	DNA (5'-D(PTPTPAPTPAPGPAPCPTPGPCPCP*GP..	A	100.0 /71.1	10 /10	SMAD5_MOUSE Mothers against decapentaplegic homolog 5
	5x6m[2]	C	DNA (5'-D(PTPTPAPTPAPGPAPCPTPGPCPCP*GP..	D	100.0 /70.8	4 /4	SMAD5_MOUSE Mothers against decapentaplegic homolog 5
	1ozj[2]	B	Smad binding element	C	100.0 /100.0	6 /6	SMAD3_HUMAN SMAD 3
	3kmp[2]	D	5'-D(PGPTPAPTPGPTPCPTPAPGPAPCPTPGP*A..	A	100.0 /70.7	4 /4	Q8CC31_MOUSE SMAD1-MH1
	3kmp[1]	C	5'-D(PAPTPCPAPGPTPCPTPAPGPAPCPAPTP*A..	A	87.5 /70.7	8 /8	Q8CC31_MOUSE SMAD1-MH1
	3kmp[1]	C	5'-D(PAPTPCPAPGPTPCPTPAPGPAPCPAPTP*A..	B	100.0 /70.5	5 /5	Q8CC31_MOUSE SMAD1-MH1
	5x6g[1]	C	DNA (5'-D(PAPTPCPAPGPTPCPTPAPGPAPCP*AP..	A	87.5 /71.1	8 /8	SMAD5_MOUSE Mothers against decapentaplegic homolog 5
	5x6g[1]	C	DNA (5'-D(PAPTPCPAPGPTPCPTPAPGPAPCP*AP..	B	100.0 /70.5	5 /5	SMAD5_MOUSE Mothers against decapentaplegic homolog 5
	5x6g[2]	D	DNA (5'-D(PGPTPAPTPGPTPCPTPAPGPAPCP*TP..	A	100.0 /71.1	3 /3	SMAD5_MOUSE Mothers against decapentaplegic homolog 5
	5mey[10]	B	DNA (5'-D(PAPTPGPCPGPGPGPCPGPCPGPCP*CP..	A	62.5 /57.4	8 /8	SMAD4_HUMAN MH1 domain of human Smad4
	5mey[2]	B	DNA (5'-D(PAPTPGPCPGPGPGPCPGPCPGPCP*CP..	A	100.0 /57.4	3 /3	SMAD4_HUMAN MH1 domain of human Smad4
	3qsv[8]	E	DNA (5'-D(PTPGPCPAPGPTPCPTPAPGPAPCP*TP..	A	70.0 /57.4	10 /10	SMAD4_MOUSE Mothers against decapentaplegic homolog 4
	5mf0[4]	C	DNA (5'-D(PAPCPGPGPGPCPCPGPCPGPGPCP*CP..	A	72.7 /57.4	11 /11	SMAD4_HUMAN MH1 domain of human Smad4
	5mez[2]	C	DNA (5'-D(PGPCPAPGPGPCPTPAPGPCPCPTP*GP..	A	57.1 /56.8	7 /7	SMAD4_HUMAN MH1 domain of human Smad4
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
COMPOUND
425	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	6zvq[3]	I	TAR D(-)-TARTARIC ACID[10 atoms]	A	100.0 /96.5	2 /2	SMAD2_HUMAN Mothers against decapentaplegic homolog 2
	6zvq[3]	J	TAR D(-)-TARTARIC ACID[10 atoms]	A	100.0 /96.5	4 /4	SMAD2_HUMAN Mothers against decapentaplegic homolog 2
	6zvq[3]	J	TAR D(-)-TARTARIC ACID[10 atoms]	A	100.0 /96.5	6 /6	SMAD2_HUMAN Mothers against decapentaplegic homolog 2
	6zvq[3]	O	TAR D(-)-TARTARIC ACID[10 atoms]	A	100.0 /96.5	4 /4	SMAD2_HUMAN Mothers against decapentaplegic homolog 2
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
METAL
425	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	1ozj[2]	E	ZN ZINC ION[1 atoms]	C	100.0 /100.0	4 /4	SMAD3_HUMAN SMAD 3
	3kmp[2]	E	ZN ZINC ION[1 atoms]	A	100.0 /70.7	4 /4	Q8CC31_MOUSE SMAD1-MH1
	3qsv[4]	I	ZN ZINC ION[1 atoms]	A	100.0 /57.4	4 /4	SMAD4_MOUSE Mothers against decapentaplegic homolog 4
	5mey[14]	C	ZN ZINC ION[1 atoms]	A	100.0 /57.4	4 /4	SMAD4_HUMAN MH1 domain of human Smad4
	5nm9[4]	E	ZN ZINC ION[1 atoms]	A	100.0 /59.8	4 /4	B3S7S5_TRIAD Mothers against decapentaplegic homolog
	5od6[6]	E	ZN ZINC ION[1 atoms]	A	100.0 /100.0	4 /4	SMAD3_HUMAN Mothers against decapentaplegic homolog 3
	6fzs[2]	E	ZN ZINC ION[1 atoms]	A	100.0 /71.0	4 /4	SMAD5_HUMAN Mothers against decapentaplegic homolog 5
	6fzt[4]	E	ZN ZINC ION[1 atoms]	A	100.0 /73.8	4 /4	SMAD9_HUMAN Mothers against decapentaplegic homolog 9
	6tbz[1]	D	ZN ZINC ION[1 atoms]	A	100.0 /73.6	4 /4	SMAD5_HUMAN Mothers against decapentaplegic homolog 5
	6tce[2]	C	ZN ZINC ION[1 atoms]	A	100.0 /71.9	5 /5	SMAD5_HUMAN Mothers against decapentaplegic homolog 5
	6zmn[2]	G	ZN ZINC ION[1 atoms]	A	100.0 /96.7	4 /4	SMAD3_HUMAN Mothers against decapentaplegic homolog 3
	5mey[3]	D	CL CHLORIDE ION[1 atoms]	A	40.0 /57.4	5 /5	SMAD4_HUMAN MH1 domain of human Smad4
	5mey[2]	E	CL CHLORIDE ION[1 atoms]	A	66.7 /57.4	3 /3	SMAD4_HUMAN MH1 domain of human Smad4
	5mey[4]	F	CL CHLORIDE ION[1 atoms]	A	60.0 /57.4	5 /5	SMAD4_HUMAN MH1 domain of human Smad4
	5mey[2]	G	CL CHLORIDE ION[1 atoms]	A	33.3 /57.4	3 /3	SMAD4_HUMAN MH1 domain of human Smad4
	5odg[2]	F	CL CHLORIDE ION[1 atoms]	A	100.0 /100.0	1 /1	SMAD3_HUMAN Mothers against decapentaplegic homolog 3
	7cd1[1]	G	CL CHLORIDE ION[1 atoms]	A	50.0 /34.8	2 /2	SMAD7_MOUSE Mothers against decapentaplegic homolog 7
	7cd1[2]	H	CL CHLORIDE ION[1 atoms]	A	100.0 /34.8	2 /2	SMAD7_MOUSE Mothers against decapentaplegic homolog 7
	7cd1[1]	R	CL CHLORIDE ION[1 atoms]	D	66.7 /34.8	3 /3	SMAD7_MOUSE Mothers against decapentaplegic homolog 7
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
HOMO
425	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	1khx[6]	A	SMAD2_HUMAN Smad2[203 aa]	A	96.3 /96.5	27 /27	SMAD2_HUMAN Smad2
	1khx[6]	A	SMAD2_HUMAN Smad2[203 aa]	A	86.7 /96.5	30 /31	SMAD2_HUMAN Smad2
	1mk2[2]	A	SMAD3_HUMAN SMAD 3[197 aa]	A	100.0 /100.0	12 /12	SMAD3_HUMAN SMAD 3
	1u7f[17]	C	SMAD3_HUMAN Mothers against decapentaplegic homolog 3[196 aa]	A	100.0 /100.0	23 /23	SMAD3_HUMAN Mothers against decapentaplegic homolog 3
	1u7f[2]	A	SMAD3_HUMAN Mothers against decapentaplegic homolog 3[198 aa]	C	95.7 /100.0	23 /24	SMAD3_HUMAN Mothers against decapentaplegic homolog 3
	5xoc[12]	A	SMAD3_HUMAN Mothers against decapentaplegic homolog 3[194 aa]	A	100.0 /100.0	17 /17	SMAD3_HUMAN Mothers against decapentaplegic homolog 3
	5zoj[3]	C	SMAD2_HUMAN Mothers against decapentaplegic homolog 2[186 aa]	A	100.0 /97.9	17 /17	SMAD2_HUMAN Mothers against decapentaplegic homolog 2
	1ozj[2]	D	SMAD3_HUMAN SMAD 3[124 aa]	C	100.0 /100.0	1 /1	SMAD3_HUMAN SMAD 3
	5od6[2]	B	SMAD3_HUMAN Mothers against decapentaplegic homolog 3[126 aa]	A	100.0 /100.0	5 /5	SMAD3_HUMAN Mothers against decapentaplegic homolog 3
	6zmn[2]	B	SMAD3_HUMAN Mothers against decapentaplegic homolog 3[119 aa]	A	88.5 /96.7	26 /26	SMAD3_HUMAN Mothers against decapentaplegic homolog 3
	1khu[6]	B	SMAD1_HUMAN SMAD1[197 aa]	A	91.3 /79.2	23 /23	SMAD1_HUMAN SMAD1
	1khu[6]	C	SMAD1_HUMAN SMAD1[197 aa]	A	78.3 /79.2	23 /23	SMAD1_HUMAN SMAD1
	5zok[6]	A	SMAD1_HUMAN Mothers against decapentaplegic homolog 1[200 aa]	A	88.5 /80.5	26 /26	SMAD1_HUMAN Mothers against decapentaplegic homolog 1
	5zok[6]	A	SMAD1_HUMAN Mothers against decapentaplegic homolog 1[200 aa]	A	85.0 /80.5	20 /26	SMAD1_HUMAN Mothers against decapentaplegic homolog 1
	3gmj[6]	A	MAD_DROME Protein mothers against dpp[199 aa]	A	80.8 /78.3	26 /26	MAD_DROME Protein mothers against dpp
	3gmj[6]	A	MAD_DROME Protein mothers against dpp[199 aa]	A	88.0 /78.3	25 /25	MAD_DROME Protein mothers against dpp
	5x6h[2]	A	SMAD5_MOUSE Mothers against decapentaplegic homolog 5[115 aa]	A	100.0 /71.7	3 /3	SMAD5_MOUSE Mothers against decapentaplegic homolog 5
	5x6m[6]	E	SMAD5_MOUSE Mothers against decapentaplegic homolog 5[121 aa]	A	76.5 /71.1	17 /17	SMAD5_MOUSE Mothers against decapentaplegic homolog 5
	6fzs[2]	B	SMAD5_HUMAN Mothers against decapentaplegic homolog 5[127 aa]	A	65.4 /71.0	26 /26	SMAD5_HUMAN Mothers against decapentaplegic homolog 5
	5mez[2]	B	SMAD4_HUMAN MH1 domain of human Smad4[122 aa]	A	30.0 /56.8	10 /10	SMAD4_HUMAN MH1 domain of human Smad4
	1dd1[3]	A	SMAD4_HUMAN SMAD4[221 aa]	B	47.1 /51.1	17 /18	SMAD4_HUMAN SMAD4
	1dd1[3]	A	SMAD4_HUMAN SMAD4[221 aa]	C	73.3 /51.1	15 /15	SMAD4_HUMAN SMAD4
	1ygs[3]	A	SMA4_HUMAN SMAD4[190 aa]	A	53.8 /53.2	13 /13	SMA4_HUMAN SMAD4
	1ygs[3]	A	SMA4_HUMAN SMAD4[190 aa]	A	75.0 /53.2	12 /12	SMA4_HUMAN SMAD4
	1dd1[6]	B	SMAD4_HUMAN SMAD4[249 aa]	A	73.7 /49.5	19 /19	SMAD4_HUMAN SMAD4
	1dd1[6]	C	SMAD4_HUMAN SMAD4[241 aa]	A	60.0 /49.5	15 /15	SMAD4_HUMAN SMAD4
	1dd1[2]	B	SMAD4_HUMAN SMAD4[249 aa]	B	12.5 /51.1	8 /16	SMAD4_HUMAN SMAD4
	7cd1[4]	C	SMAD7_MOUSE Mothers against decapentaplegic homolog 7[180 aa]	A	25.8 /34.8	31 /40	SMAD7_MOUSE Mothers against decapentaplegic homolog 7
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
425	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	1mk2[4]	C	ACY ACETIC ACID[4 atoms]	A	100.0 /100.0	6 /6	SMAD3_HUMAN SMAD 3
	1mk2[2]	D	ACY ACETIC ACID[4 atoms]	A	100.0 /100.0	6 /6	SMAD3_HUMAN SMAD 3
	1mk2[2]	E	ACY ACETIC ACID[4 atoms]	A	100.0 /100.0	3 /3	SMAD3_HUMAN SMAD 3
	1mk2[2]	F	ACY ACETIC ACID[4 atoms]	A	100.0 /100.0	4 /4	SMAD3_HUMAN SMAD 3
	6zmn[1]	E	ACT ACETATE ION[4 atoms]	A	100.0 /96.7	3 /3	SMAD3_HUMAN Mothers against decapentaplegic homolog 3
	6zmn[1]	F	EDO 1,2-ETHANEDIOL[4 atoms]	A	100.0 /96.7	6 /6	SMAD3_HUMAN Mothers against decapentaplegic homolog 3
	6zmn[1]	H	PGE TRIETHYLENE GLYCOL[10 atoms]	B	66.7 /96.6	3 /3	SMAD3_HUMAN Mothers against decapentaplegic homolog 3
	3kmp[5]	F	GOL GLYCEROL[6 atoms]	A	83.3 /70.7	6 /6	Q8CC31_MOUSE SMAD1-MH1
	5c4v[4]	G	GOL GLYCEROL[6 atoms]	A	80.0 /53.3	5 /5	SMAD4_HUMAN Mothers against decapentaplegic homolog 4
	6fzt[2]	F	GOL GLYCEROL[6 atoms]	A	100.0 /73.8	4 /4	SMAD9_HUMAN Mothers against decapentaplegic homolog 9
	6fzt[4]	H	GOL GLYCEROL[6 atoms]	B	100.0 /73.6	6 /6	SMAD9_HUMAN Mothers against decapentaplegic homolog 9
	6zvq[3]	F	GOL GLYCEROL[6 atoms]	A	100.0 /96.5	1 /1	SMAD2_HUMAN Mothers against decapentaplegic homolog 2
	6zvq[3]	G	GOL GLYCEROL[6 atoms]	A	100.0 /96.5	4 /4	SMAD2_HUMAN Mothers against decapentaplegic homolog 2
	6zvq[3]	H	GOL GLYCEROL[6 atoms]	A	100.0 /96.5	3 /3	SMAD2_HUMAN Mothers against decapentaplegic homolog 2
	6zvq[3]	H	GOL GLYCEROL[6 atoms]	A	0.0 /96.5	1 /1	SMAD2_HUMAN Mothers against decapentaplegic homolog 2
	6zvq[3]	L	GOL GLYCEROL[6 atoms]	A	100.0 /96.5	4 /4	SMAD2_HUMAN Mothers against decapentaplegic homolog 2
	6zvq[3]	L	GOL GLYCEROL[6 atoms]	A	80.0 /96.5	5 /5	SMAD2_HUMAN Mothers against decapentaplegic homolog 2
	6zvq[3]	M	GOL GLYCEROL[6 atoms]	A	100.0 /96.5	3 /3	SMAD2_HUMAN Mothers against decapentaplegic homolog 2
	6zvq[3]	N	GOL GLYCEROL[6 atoms]	A	100.0 /96.5	2 /2	SMAD2_HUMAN Mothers against decapentaplegic homolog 2
	5mey[2]	H	PEG DI(HYDROXYETHYL)ETHER[7 atoms]	A	40.0 /57.4	5 /5	SMAD4_HUMAN MH1 domain of human Smad4
	5mey[2]	I	PEG DI(HYDROXYETHYL)ETHER[7 atoms]	A	100.0 /57.4	1 /1	SMAD4_HUMAN MH1 domain of human Smad4
	1dd1[8]	D	SO4 SULFATE ION[5 atoms]	A	100.0 /49.5	2 /2	SMAD4_HUMAN SMAD4
	1dd1[6]	E	SO4 SULFATE ION[5 atoms]	A	75.0 /49.5	4 /4	SMAD4_HUMAN SMAD4
	1dd1[4]	H	SO4 SULFATE ION[5 atoms]	A	100.0 /49.5	2 /2	SMAD4_HUMAN SMAD4
	1dd1[9]	G	SO4 SULFATE ION[5 atoms]	B	0.0 /51.1	2 /4	SMAD4_HUMAN SMAD4
	6zvq[3]	D	SO4 SULFATE ION[5 atoms]	A	100.0 /96.5	5 /5	SMAD2_HUMAN Mothers against decapentaplegic homolog 2
	7cd1[2]	E	SO4 SULFATE ION[5 atoms]	A	66.7 /34.8	3 /3	SMAD7_MOUSE Mothers against decapentaplegic homolog 7
	7cd1[2]	I	SO4 SULFATE ION[5 atoms]	B	75.0 /34.8	4 /4	SMAD7_MOUSE Mothers against decapentaplegic homolog 7
	7cd1[3]	J	SO4 SULFATE ION[5 atoms]	B	75.0 /34.8	4 /4	SMAD7_MOUSE Mothers against decapentaplegic homolog 7
	7cd1[1]	L	SO4 SULFATE ION[5 atoms]	C	0.0 /34.8	2 /2	SMAD7_MOUSE Mothers against decapentaplegic homolog 7
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

Contact Molecules for Homologous Proteins

Summary Bars[0.0 %]

UniProt Feature Tables [P84022(SMAD3_HUMAN)]