Contact Molecules for Homologous Proteins
[Full Bars]	[SiteTable]	Summary Bars[0.0 %]	[Back to Search Page]	[Back to HOMCOS]
[SupCon3D]	[help]	seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]	[show] [download] [help]

PID	QueryLength	Homolgous Sequence in PDB	UniProt Query	TITLE
3177205	121	9	P0DTC8(NS8_SARS2)	RecName: Full=ORF8 protein; Short=ORF8;AltName: Full=Non-structural protein 8; Short=ns8;Flags: Precursor;
QUERYSEQ	MKFLVFLGIITTVAAFHQECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEAGSKSPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI

UniProt Feature Tables [P0DTC8(NS8_SARS2)]

121
	region	name	description
	1-15	SIGNAL
	16-121	CHAIN	/note="ORF8 protein" /id="PRO_0000449655"
	19-121	DOMAIN	/note="SARS ORF8 Ig-like"
	1-9	DISORDER	predicted by DISOPRED

MONOMER
121
	pdb_id	a1	identity[%]2	description
	7jx6	A	100.0	NS8_SARS2 ORF8 protein
	1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.

HETERO
121	pdb_id	contact mol		homologue
		a3	description	a4	identity[%]5	Ncon6	description
	7xmn[2]	A	A0A376KDN7_ECOLX Maltodextrin-binding protein[367 aa]	B	100.0 /100.0	9 /9	NS8_SARS2 ORF8 protein
	7xmn[2]	A	A0A376KDN7_ECOLX Maltodextrin-binding protein[367 aa]	B	100.0 /100.0	17 /17	NS8_SARS2 ORF8 protein
	3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
COMPOUND
121	pdb_id	contact mol		homologue
		a3	description	a4	identity[%]5	Ncon6	description
	7xmn[2]	H	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..	B	100.0 /100.0	4 /4	NS8_SARS2 ORF8 protein
	7xmn[2]	I	NNH NOR-N-OMEGA-HYDROXY-L-ARGININE[12 atoms]	B	100.0 /100.0	4 /4	NS8_SARS2 ORF8 protein
	3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
METAL
121	pdb_id	contact mol		homologue
		a3	description	a4	identity[%]5	Ncon6	description
	7jtl[1]	C	NA SODIUM ION[1 atoms]	A	100.0 /100.0	2 /2	NS8_SARS2 ORF8 protein
	7jx6[2]	C	NA SODIUM ION[1 atoms]	A	100.0 /100.0	4 /4	NS8_SARS2 ORF8 protein
	7jx6[2]	C	NA SODIUM ION[1 atoms]	A	100.0 /100.0	1 /1	NS8_SARS2 ORF8 protein
	7jx6[2]	D	NA SODIUM ION[1 atoms]	A	100.0 /100.0	2 /2	NS8_SARS2 ORF8 protein
	7jx6[2]	E	NA SODIUM ION[1 atoms]	A	100.0 /100.0	2 /2	NS8_SARS2 ORF8 protein
	7jx6[2]	F	NA SODIUM ION[1 atoms]	B	100.0 /100.0	4 /4	NS8_SARS2 ORF8 protein
	7f5f[1]	B	CA CALCIUM ION[1 atoms]	A	100.0 /99.0	2 /2	A0A6B9VKN0_SARS2 ORF8 protein
	7f8l[4]	C	CA CALCIUM ION[1 atoms]	A	100.0 /97.1	2 /2	A0A6B9WE90_SARS Nonstructural protein NS8
	3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
HOMO
121	pdb_id	contact mol		homologue
		a3	description	a4	identity[%]5	Ncon6	description
	7f8l[10]	B	A0A6B9WE90_SARS Nonstructural protein NS8[104 aa]	A	100.0 /97.1	15 /15	A0A6B9WE90_SARS Nonstructural protein NS8
	7xmn[2]	B	NS8_SARS2 ORF8 protein[102 aa]	B	100.0 /100.0	4 /4	NS8_SARS2 ORF8 protein
	7jx6[2]	B	NS8_SARS2 ORF8 protein[88 aa]	A	100.0 /100.0	17 /17	NS8_SARS2 ORF8 protein
	7jx6[2]	B	NS8_SARS2 ORF8 protein[88 aa]	A	100.0 /100.0	4 /4	NS8_SARS2 ORF8 protein
	7mx9[2]	A	NS8_SARS2 ORF8 protein[88 aa]	A	100.0 /98.9	13 /13	NS8_SARS2 ORF8 protein
	3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
121	pdb_id	contact mol		homologue
		a3	description	a4	identity[%]5	Ncon6	description
	7xmn[2]	E	SO4 SULFATE ION[5 atoms]	B	100.0 /100.0	3 /3	NS8_SARS2 ORF8 protein
	7xmn[2]	J	SO4 SULFATE ION[5 atoms]	B	100.0 /100.0	2 /2	NS8_SARS2 ORF8 protein
	7xmn[2]	K	SO4 SULFATE ION[5 atoms]	B	100.0 /100.0	5 /5	NS8_SARS2 ORF8 protein
	3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.