HOMCOS(prot_sch_conbars.cgi):

		Contact Molecules for Homologous Proteins
[Full Bars]	[SiteTable]	Summary Bars[0.0 %]	[Back to Search Page]	[Back to HOMCOS]
[SupCon3D]	[help]	seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]	[show] [download] [help]

PID

QueryLength

Homolgous Sequence in PDB

UniProt Query

TITLE

3177154

468

115

P08887(IL6RA_HUMAN)

RecName: Full=Interleukin-6 receptor subunit alpha ; Short=IL-6 receptor subunit alpha; Short=IL-6R subunit alpha; Short=IL-6R-alpha; Short=IL-6RA;AltName: Full=IL-6R 1;AltName: Full=Membrane glycoprotein 80; Short=gp80;AltName: CD_antigen=CD126;Contains: RecName: Full=Soluble interleukin-6 receptor subunit alpha ; Short=sIL6R ;Flags: Precursor;

QUERYSEQ

MLAVGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLV
RKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQ
GEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPRPTPVLVPLISPPVSPSSLGSDNTSSHNRPDA
RDPRSPYDISNTDYFFPR

[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [P08887(IL6RA_HUMAN)]

468
	region	name	description
	1-19	SIGNAL
	20-468	CHAIN	/note="Interleukin-6 receptor subunit alpha" /id="PRO_0000010895"
	20-355	CHAIN	/note="Soluble interleukin-6 receptor subunit alpha" /id="PRO_0000450730"
	20-365	TOPO_DOM	/note="Extracellular"
	366-386	TRANSMEM	/note="Helical"
	387-468	TOPO_DOM	/note="Cytoplasmic"
	26-112	DOMAIN	/note="Ig-like C2-type"
	113-217	DOMAIN	/note="Fibronectin type-III 1"
	218-316	DOMAIN	/note="Fibronectin type-III 2"
	303-328	REGION	/note="Disordered"
	421-468	REGION	/note="Disordered"
	311-328	COMPBIAS	/note="Polar residues"
	1-468	DISORDER	predicted by DISOPRED

MONOMER

468

pdb_id a¹ identity[%]² description

1n26 A 100.0 IL6A_HUMAN IL-6 Receptor alpha chain

1.a¹:asym_id for the homologue. 2.identity[%]²:sequence identity between the query and the homologue.

HETERO

468 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

3hmx[1] C USTEKINUMAB FAB LIGHT CHAIN[214 aa] A 14.3
/29.0 7
/9 IL12B_HUMAN Interleukin-12 subunit beta

4i18[1] C antibody light chain[215 aa] E 60.0
/24.9 5
/5 PRLR_HUMAN Prolactin receptor

8iow[2] C Light chain of Sarilumab Fab[212 aa] A 100.0
/100.0 6
/6 IL6RA_HUMAN Interleukin-6 receptor subunit alpha

8d82[2] C IL6RB_HUMAN Interleukin-6 receptor subunit beta[589 aa] A 100.0
/100.0 11
/11 IL6RA_HUMAN Soluble interleukin-6 receptor subunit alpha

8d82[2] F IL6RB_HUMAN Interleukin-6 receptor subunit beta[589 aa] A 100.0
/100.0 6
/6 IL6RA_HUMAN Soluble interleukin-6 receptor subunit alpha

8iow[1] D Heavy chain of Sarilumab Fab[207 aa] A 100.0
/100.0 12
/12 IL6RA_HUMAN Interleukin-6 receptor subunit alpha

8j6f[1] A Heavy chain of Tocilizumab Fab[211 aa] C 100.0
/100.0 14
/14 IL6RA_HUMAN Interleukin-6 receptor subunit alpha

8j6f[1] D IL6RA_HUMAN IL6R-D2 peptide[10 aa] C 100.0
/100.0 6
/6 IL6RA_HUMAN Interleukin-6 receptor subunit alpha

8qy4[6] B IL6RB_MOUSE Interleukin-6 receptor subunit beta[583 aa] E 41.7
/31.7 12
/12 I11RA_HUMAN Interleukin-11 receptor subunit alpha

8qy4[6] D IL6RB_MOUSE Interleukin-6 receptor subunit beta[583 aa] E 0.0
/31.7 6
/6 I11RA_HUMAN Interleukin-11 receptor subunit alpha

7dc8[2] A Switch Ab Fab light chain[212 aa] C 100.0
/99.5 5
/5 IL6RA_HUMAN Interleukin-6 receptor subunit alpha

7dc8[2] B Switch Ab Fab heavy chain[209 aa] C 100.0
/99.5 9
/9 IL6RA_HUMAN Interleukin-6 receptor subunit alpha

5fuc[1] E VHH6[110 aa] C 100.0
/99.0 10
/10 D6R9R8_HUMAN IL6RA_HUMAN INTERLEUKIN-6 RECEPTOR SUBUNIT ALPHA, INTERLEUKIN-..

5fuc[1] A IL6_HUMAN INTERLEUKIN-6[152 aa] D 100.0
/99.0 12
/12 D6R9R8_HUMAN IL6RA_HUMAN INTERLEUKIN-6 RECEPTOR SUBUNIT ALPHA, INTERLEUKIN-..

5fuc[1] F VHH6[124 aa] D 100.0
/99.0 10
/10 D6R9R8_HUMAN IL6RA_HUMAN INTERLEUKIN-6 RECEPTOR SUBUNIT ALPHA, INTERLEUKIN-..

1p9m[2] A IL6RB_HUMAN Interleukin-6 receptor beta chain[298 aa] C 100.0
/100.0 12
/12 IL6RA_HUMAN Interleukin-6 receptor alpha chain

1p9m[2] A IL6RB_HUMAN Interleukin-6 receptor beta chain[298 aa] C 100.0
/100.0 8
/8 IL6RA_HUMAN Interleukin-6 receptor alpha chain

7u7n[1] B IL6RB_HUMAN Interleukin-6 receptor subunit beta[298 aa] C 33.3
/26.7 3
/3 IL27B_HUMAN Interleukin-27 subunit beta

8d85[1] D IL6RB_HUMAN Interleukin-6 receptor subunit beta[296 aa] A 0.0
/26.7 2
/3 IL27B_HUMAN Interleukin-27 subunit beta

8dps[8] A IL6RB_HUMAN Interleukin-6 receptor subunit beta[297 aa] C 36.4
/33.9 11
/11 I11RA_HUMAN Interleukin-11 receptor subunit alpha

8dps[8] D IL6RB_HUMAN Interleukin-6 receptor subunit beta[297 aa] C 0.0
/33.9 4
/4 I11RA_HUMAN Interleukin-11 receptor subunit alpha

8d74[1] B CNTF_HUMAN Ciliary neurotrophic factor[174 aa] A 33.3
/29.9 12
/12 IL6RB_HUMAN Interleukin-6 receptor subunit beta

8d74[1] B CNTF_HUMAN Ciliary neurotrophic factor[174 aa] C 14.3
/34.7 14
/14 CNTFR_HUMAN Ciliary neurotrophic factor receptor subunit alpha..

8d74[2] A IL6RB_HUMAN Interleukin-6 receptor subunit beta[392 aa] C 36.4
/34.7 11
/11 CNTFR_HUMAN Ciliary neurotrophic factor receptor subunit alpha..

8dpt[2] A IL6RB_HUMAN Interleukin-6 receptor subunit beta[398 aa] C 33.3
/34.2 15
/15 I11RA_HUMAN Interleukin-11 receptor subunit alpha

8dpt[2] D IL6RB_HUMAN Interleukin-6 receptor subunit beta[398 aa] C 0.0
/34.2 3
/3 I11RA_HUMAN Interleukin-11 receptor subunit alpha

8d7e[1] B H4H25311P2 antibody Fab fragment light chain[215 a.. A 33.3
/33.9 9
/9 CNTFR_HUMAN Ciliary neurotrophic factor receptor subunit alpha..

8d7e[1] C H4H25311P2 antibody Fab fragment heavy chain[217 a.. A 27.3
/33.9 11
/11 CNTFR_HUMAN Ciliary neurotrophic factor receptor subunit alpha..

8d7e[1] E REGN8938 antibody Fab fragment heavy chain[214 aa].. A 0.0
/33.9 3
/11 CNTFR_HUMAN Ciliary neurotrophic factor receptor subunit alpha..

8dps[10] B IL11_HUMAN Interleukin-11[165 aa] A 40.0
/28.5 10
/10 IL6RB_HUMAN Interleukin-6 receptor subunit beta

8dps[12] B IL11_HUMAN Interleukin-11[165 aa] C 6.7
/33.9 15
/18 I11RA_HUMAN Interleukin-11 receptor subunit alpha

8dpt[2] E IL11_HUMAN Interleukin-11[165 aa] A 0.0
/28.6 1
/10 IL6RB_HUMAN Interleukin-6 receptor subunit beta

8qy4[2] A IL11_HUMAN Interleukin-11[165 aa] E 0.0
/31.7 10
/15 I11RA_HUMAN Interleukin-11 receptor subunit alpha

8upa[2] A De novo designed IL-6 mimetic[56 aa] B 37.5
/29.9 16
/16 IL6RB_HUMAN Interleukin-6 receptor subunit beta

1f45[1] B I12A_HUMAN INTERLEUKIN-12 ALPHA CHAIN[133 aa] A 25.0
/30.4 20
/21 I12B_HUMAN INTERLEUKIN-12 BETA CHAIN

1pvh[2] B LIF_HUMAN Leukemia inhibitory factor[169 aa] A 23.1
/29.9 13
/13 IL6RB_HUMAN Interleukin-6 receptor beta chain

8d6a[1] A LIF_HUMAN Leukemia inhibitory factor[169 aa] B 30.0
/29.9 10
/10 IL6RB_HUMAN Interleukin-6 receptor subunit beta

8d74[2] C CNTFR_HUMAN Ciliary neurotrophic factor receptor subunit alpha.. A 18.2
/29.9 11
/11 IL6RB_HUMAN Interleukin-6 receptor subunit beta

8d7h[3] B CLCF1_HUMAN Cardiotrophin-like cytokine factor 1[178 aa] A 12.5
/33.9 16
/17 CNTFR_HUMAN Ciliary neurotrophic factor receptor subunit alpha..

8d7h[3] B CLCF1_HUMAN Cardiotrophin-like cytokine factor 1[178 aa] C 9.1
/29.6 11
/13 CRLF1_HUMAN Cytokine receptor-like factor 1

8d7h[2] E CLCF1_HUMAN Cardiotrophin-like cytokine factor 1[178 aa] C 20.0
/29.6 5
/11 CRLF1_HUMAN Cytokine receptor-like factor 1

3d85[4] C IL23A_HUMAN Interleukin-23 subunit p19[133 aa] D 12.5
/28.3 16
/17 IL12B_HUMAN Interleukin-12 subunit p40

4grw[8] A IL23A_HUMAN Interleukin-23 subunit alpha[130 aa] B 18.8
/29.2 16
/17 IL12B_HUMAN Interleukin-12 subunit beta

8cr8[1] B IL23A_HUMAN Interleukin-23 subunit alpha[138 aa] A 14.3
/29.8 14
/15 IL12B_HUMAN Interleukin-12 subunit beta

3d87[6] A IL23A_HUMAN Interleukin-23 subunit p19[161 aa] B 16.7
/28.8 18
/19 IL12B_HUMAN Interleukin-12 subunit p40

3d87[1] C IL23A_HUMAN Interleukin-23 subunit p19[159 aa] B 0.0
/28.8 2
/2 IL12B_HUMAN Interleukin-12 subunit p40

5mzv[1] B IL23A_HUMAN Interleukin-23 subunit alpha[137 aa] A 18.8
/28.0 16
/17 IL12B_HUMAN Interleukin-12 subunit beta

5mzv[1] C IL23R_HUMAN Interleukin-23 receptor[293 aa] A 0.0
/28.0 2
/6 IL12B_HUMAN Interleukin-12 subunit beta

6wdq[1] C IL23R_HUMAN Interleukin-23 receptor[293 aa] A 66.7
/28.3 3
/5 IL12B_HUMAN Interleukin-12 subunit beta

8oe4[1] C IL23R_HUMAN CALM1_HUMAN Interleukin-23 receptor,Calmodulin-1[293 aa] A 0.0
/29.3 1
/1 IL12B_HUMAN Interleukin-12 subunit beta

8oe4[1] D I12R1_HUMAN DAPK1_HUMAN Interleukin-12 receptor subunit beta-1,Death-assoc.. A 0.0
/29.3 8
/16 IL12B_HUMAN Interleukin-12 subunit beta

3hmx[1] B IL12A_HUMAN Interleukin-12 subunit alpha[176 aa] A 17.6
/29.0 17
/18 IL12B_HUMAN Interleukin-12 subunit beta

3hmx[1] D USTEKINUMAB FAB HEAVY CHAIN[217 aa] A 25.0
/29.0 12
/13 IL12B_HUMAN Interleukin-12 subunit beta

3qwr[1] C ADNECTIN[91 aa] A 28.6
/28.9 21
/22 IL12B_HUMAN Interleukin-12 subunit beta

8d82[2] A IL6RA_HUMAN Soluble interleukin-6 receptor subunit alpha[296 a.. C 9.1
/28.6 11
/11 IL6RB_HUMAN Interleukin-6 receptor subunit beta

6uib[1] C Peptide 23-652[15 aa] B 25.0
/28.6 12
/12 IL12B_HUMAN Interleukin-12 subunit beta

5njd[1] J IL23A_HUMAN Interleukin-23 subunit alpha[141 aa] I 18.8
/28.6 16
/16 IL12B_HUMAN Interleukin-12 subunit beta

3duh[1] D IL23A_HUMAN Interleukin-23 subunit alpha[137 aa] B 12.5
/28.5 16
/17 IL12B_HUMAN Interleukin-12 subunit beta

4grw[2] G Nanobody 124C4[125 aa] B 23.1
/29.2 13
/15 IL12B_HUMAN Interleukin-12 subunit beta

4grw[2] J Nanobody 37D5[122 aa] B 75.0
/29.2 4
/4 IL12B_HUMAN Interleukin-12 subunit beta

8dpt[8] C I11RA_HUMAN Interleukin-11 receptor subunit alpha[294 aa] A 9.1
/28.6 11
/12 IL6RB_HUMAN Interleukin-6 receptor subunit beta

5njd[6] U Briakinumab FAb Light chain[215 aa] A 0.0
/27.9 3
/8 IL12B_HUMAN Interleukin-12 subunit beta

5njd[6] V Briakinumab FAb Heavy chain[205 aa] A 0.0
/27.9 2
/10 IL12B_HUMAN Interleukin-12 subunit beta

1i1r[2] B Q98823_HHV8 VIRAL IL-6[167 aa] A 36.4
/28.2 11
/11 IL6RB_HUMAN INTERLEUKIN-6 RECEPTOR BETA CHAIN

6wdq[6] D I12R1_HUMAN Interleukin-12 receptor subunit beta-1[109 aa] A 0.0
/28.3 8
/14 IL12B_HUMAN Interleukin-12 subunit beta

8xrp[5] A IL12A_HUMAN Interleukin-12 subunit alpha[185 aa] B 14.3
/28.2 14
/15 IL12B_HUMAN Interleukin-12 subunit beta

8xrp[4] M IL12A_HUMAN Interleukin-12 subunit alpha[185 aa] B 66.7
/28.2 3
/3 IL12B_HUMAN Interleukin-12 subunit beta

8xrp[4] O I12R2_HUMAN Interleukin-12 receptor subunit beta-2[291 aa] B 100.0
/28.2 1
/1 IL12B_HUMAN Interleukin-12 subunit beta

4grw[3] H Nanobody 22E11[123 aa] B 0.0
/29.2 10
/17 IL12B_HUMAN Interleukin-12 subunit beta

7u7n[1] D IL27A_HUMAN Interleukin-27 subunit alpha[191 aa] B 0.0
/28.9 1
/12 IL6RB_HUMAN Interleukin-6 receptor subunit beta

7u7n[2] D IL27A_HUMAN Interleukin-27 subunit alpha[191 aa] C 0.0
/26.7 20
/21 IL27B_HUMAN Interleukin-27 subunit beta

7u7n[2] A I27RA_HUMAN Interleukin-27 receptor subunit alpha[195 aa] C 40.0
/26.7 10
/10 IL27B_HUMAN Interleukin-27 subunit beta

7z0l[1] B IL27B_MOUSE IL27A_MOUSE Interleukin-27 subunit beta,Interleukin-27 subunit.. A 0.0
/26.3 1
/14 IL6RB_MOUSE Interleukin-6 receptor subunit beta

1p9m[4] B IL6_HUMAN Interleukin-6[163 aa] A 33.3
/28.9 12
/12 IL6RB_HUMAN Interleukin-6 receptor beta chain

1p9m[2] B IL6_HUMAN Interleukin-6[163 aa] C 100.0
/100.0 15
/15 IL6RA_HUMAN Interleukin-6 receptor alpha chain

5fuc[1] B IL6_HUMAN INTERLEUKIN-6[160 aa] C 100.0
/99.0 18
/18 D6R9R8_HUMAN IL6RA_HUMAN INTERLEUKIN-6 RECEPTOR SUBUNIT ALPHA, INTERLEUKIN-..

8d82[2] B IL6_HUMAN Interleukin-6[169 aa] A 100.0
/100.0 12
/12 IL6RA_HUMAN Soluble interleukin-6 receptor subunit alpha

8qy5[4] B IL6_HUMAN Interleukin-6[157 aa] A 11.1
/26.1 9
/10 IL6RB_MOUSE Interleukin-6 receptor subunit beta

8qy5[4] B IL6_HUMAN Interleukin-6[157 aa] C 100.0
/100.0 11
/11 IL6RA_HUMAN Interleukin-6 receptor subunit alpha

1p9m[2] C IL6RA_HUMAN Interleukin-6 receptor alpha chain[201 aa] A 10.0
/28.9 10
/11 IL6RB_HUMAN Interleukin-6 receptor beta chain

8qy5[4] C IL6RA_HUMAN Interleukin-6 receptor subunit alpha[201 aa] A 9.1
/26.1 11
/11 IL6RB_MOUSE Interleukin-6 receptor subunit beta

8dps[2] C I11RA_HUMAN Interleukin-11 receptor subunit alpha[200 aa] A 10.0
/28.5 10
/11 IL6RB_HUMAN Interleukin-6 receptor subunit beta

8qy4[2] E I11RA_HUMAN Interleukin-11 receptor subunit alpha[197 aa] B 9.1
/26.1 11
/11 IL6RB_MOUSE Interleukin-6 receptor subunit beta

3mzg[9] A PRL_HUMAN Prolactin[186 aa] B 0.0
/24.7 21
/22 PRLR_HUMAN Prolactin receptor

3ew3[1] A PRL_HUMAN Prolactin[185 aa] B 0.0
/25.4 20
/21 PRLR_RAT Prolactin receptor

3d48[1] A PRL_HUMAN Prolactin[165 aa] B 0.0
/25.1 21
/22 PRLR_HUMAN Prolactin receptor

4i18[1] D antibody heavy chain[220 aa] E 20.0
/24.9 20
/21 PRLR_HUMAN Prolactin receptor

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

COMPOUND

468 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

1n26[2] H CYS
CYSTEINE[7 atoms] A 100.0
/100.0 5
/5 IL6A_HUMAN IL-6 Receptor alpha chain

7dc8[2] H ATP
ADENOSINE-5'-TRIPHOSPHATE[31 atoms] C 100.0
/99.5 1
/1 IL6RA_HUMAN Interleukin-6 receptor subunit alpha

1n26[6] D NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. A 100.0
/100.0 5
/5 IL6A_HUMAN IL-6 Receptor alpha chain

1n26[27] E NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. A 100.0
/100.0 3
/3 IL6A_HUMAN IL-6 Receptor alpha chain

1n26[1] E NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. A 100.0
/100.0 3
/3 IL6A_HUMAN IL-6 Receptor alpha chain

3duh[3] E NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. A 0.0
/28.6 2
/7 IL12B_HUMAN Interleukin-12 subunit beta

5fuc[3] G NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. C 100.0
/99.0 3
/3 D6R9R8_HUMAN IL6RA_HUMAN INTERLEUKIN-6 RECEPTOR SUBUNIT ALPHA, INTERLEUKIN-..

6o4p[7] E NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. A 50.0
/35.0 4
/4 I11RA_HUMAN Interleukin-11 receptor subunit alpha

7u7n[2] K NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. B 0.0
/28.9 1
/2 IL6RB_HUMAN Interleukin-6 receptor subunit beta

7z0l[1] J NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. A 50.0
/26.3 2
/2 IL6RB_MOUSE Interleukin-6 receptor subunit beta

8d74[2] P NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. C 0.0
/34.7 1
/1 CNTFR_HUMAN Ciliary neurotrophic factor receptor subunit alpha..

8d7h[2] V NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. C 0.0
/29.6 1
/1 CRLF1_HUMAN Cytokine receptor-like factor 1

8d82[2] S NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. A 100.0
/100.0 3
/3 IL6RA_HUMAN Soluble interleukin-6 receptor subunit alpha

8d82[3] T NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. C 100.0
/28.6 1
/1 IL6RB_HUMAN Interleukin-6 receptor subunit beta

8d85[1] H NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. A 16.7
/26.7 6
/6 IL27B_HUMAN Interleukin-27 subunit beta

8iow[1] F NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. A 100.0
/100.0 3
/3 IL6RA_HUMAN Interleukin-6 receptor subunit alpha

8qy4[2] P NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. B 0.0
/26.1 3
/3 IL6RB_MOUSE Interleukin-6 receptor subunit beta

8qy4[6] Q NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. B 33.3
/26.1 3
/3 IL6RB_MOUSE Interleukin-6 receptor subunit beta

8upa[2] E NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. B 50.0
/29.9 2
/2 IL6RB_HUMAN Interleukin-6 receptor subunit beta

8upa[2] F NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. B 0.0
/29.9 3
/3 IL6RB_HUMAN Interleukin-6 receptor subunit beta

1f42[1] C MNB
5-MERCAPTO-2-NITRO-BENZOIC ACID[13 atoms] A 66.7
/28.9 3
/3 I12B_HUMAN INTERLEUKIN-12 BETA CHAIN

1f42[1] D MNB
5-MERCAPTO-2-NITRO-BENZOIC ACID[13 atoms] A 50.0
/28.9 6
/6 I12B_HUMAN INTERLEUKIN-12 BETA CHAIN

3d87[1] G MAN
alpha-D-mannopyranose[11 atoms] D 0.0
/28.9 4
/4 IL12B_HUMAN Interleukin-12 subunit p40

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

METAL

468 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

1pvh[1] E IOD
IODIDE ION[1 atoms] A 100.0
/29.9 1
/1 IL6RB_HUMAN Interleukin-6 receptor beta chain

8cr8[1] D TB
TERBIUM(III) ION[1 atoms] A 0.0
/29.8 1
/2 IL12B_HUMAN Interleukin-12 subunit beta

3d87[2] F K
POTASSIUM ION[1 atoms] B 50.0
/28.8 2
/2 IL12B_HUMAN Interleukin-12 subunit p40

3mzg[7] C NA
SODIUM ION[1 atoms] B 0.0
/24.7 2
/2 PRLR_HUMAN Prolactin receptor

3mzg[7] E NA
SODIUM ION[1 atoms] B 40.0
/24.7 5
/5 PRLR_HUMAN Prolactin receptor

3mzg[7] F NA
SODIUM ION[1 atoms] B 0.0
/24.7 5
/5 PRLR_HUMAN Prolactin receptor

3nce[1] C NA
SODIUM ION[1 atoms] B 0.0
/24.7 2
/3 PRLR_HUMAN Prolactin receptor

5mj3[1] H NA
SODIUM ION[1 atoms] A 33.3
/28.3 3
/3 IL12B_HUMAN Interleukin-12 subunit beta

5mj3[1] I NA
SODIUM ION[1 atoms] A 0.0
/28.3 3
/3 IL12B_HUMAN Interleukin-12 subunit beta

5mzv[1] K NA
SODIUM ION[1 atoms] A 100.0
/28.0 1
/1 IL12B_HUMAN Interleukin-12 subunit beta

3mzg[7] D CL
CHLORIDE ION[1 atoms] B 50.0
/24.7 2
/2 PRLR_HUMAN Prolactin receptor

5mzv[1] J CL
CHLORIDE ION[1 atoms] A 0.0
/28.0 2
/3 IL12B_HUMAN Interleukin-12 subunit beta

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

OTHERPOLY

468 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

1n26[2] B 2-acetamido-2-deoxy-alpha-D-glucopyranose-(1-4)-al.. A 100.0
/100.0 9
/9 IL6A_HUMAN IL-6 Receptor alpha chain

1f42[2] B alpha-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-be.. A 0.0
/28.9 3
/7 I12B_HUMAN INTERLEUKIN-12 BETA CHAIN

8cr8[1] C alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-.. A 25.0
/29.8 4
/9 IL12B_HUMAN Interleukin-12 subunit beta

3qwr[2] D alpha-D-mannopyranose-(1-3)-beta-D-mannopyranose-(.. A 0.0
/28.9 3
/7 IL12B_HUMAN Interleukin-12 subunit beta

5mxa[1] C alpha-D-mannopyranose-(1-3)-beta-D-mannopyranose-(.. B 0.0
/28.0 2
/8 IL12B_HUMAN Interleukin-12 subunit beta

6o4p[1] C alpha-D-mannopyranose-(1-3)-beta-D-mannopyranose-(.. A 0.0
/35.0 5
/5 I11RA_HUMAN Interleukin-11 receptor subunit alpha

3l5h[1] C beta-D-mannopyranose-(1-4)-beta-D-mannopyranose-(1.. A 0.0
/28.8 1
/1 IL6RB_HUMAN Interleukin-6 receptor subunit beta

3hmx[3] E alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose.. A 0.0
/29.0 3
/7 IL12B_HUMAN Interleukin-12 subunit beta

4grw[8] K alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose.. B 0.0
/29.2 3
/9 IL12B_HUMAN Interleukin-12 subunit beta

6wdq[1] E beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 0.0
/28.3 1
/2 IL12B_HUMAN Interleukin-12 subunit beta

7u7n[1] H beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. C 16.7
/26.7 6
/6 IL27B_HUMAN Interleukin-27 subunit beta

8dps[4] H beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. C 0.0
/33.9 3
/3 I11RA_HUMAN Interleukin-11 receptor subunit alpha

8dpu[6] T beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. C 16.7
/35.3 6
/6 I11RA_HUMAN Interleukin-11 receptor subunit alpha

8xrp[5] Q beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. B 25.0
/28.2 4
/8 IL12B_HUMAN Interleukin-12 subunit beta

5mzv[1] E alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-.. A 25.0
/28.0 4
/10 IL12B_HUMAN Interleukin-12 subunit beta

1n26[2] C 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/100.0 5
/5 IL6A_HUMAN IL-6 Receptor alpha chain

3l5h[4] B 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 50.0
/28.8 2
/2 IL6RB_HUMAN Interleukin-6 receptor subunit beta

6o4p[1] D 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 0.0
/35.4 4
/4 I11RA_HUMAN Interleukin-11 receptor subunit alpha

6uib[1] D 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 0.0
/28.6 4
/7 IL12B_HUMAN Interleukin-12 subunit beta

7z0l[4] F 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 20.0
/26.3 5
/5 IL6RB_MOUSE Interleukin-6 receptor subunit beta

8d74[5] F 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. C 40.0
/34.7 5
/5 CNTFR_HUMAN Ciliary neurotrophic factor receptor subunit alpha..

8d7e[3] H 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 50.0
/33.9 2
/4 CNTFR_HUMAN Ciliary neurotrophic factor receptor subunit alpha..

8d7h[2] M 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. C 0.0
/29.6 2
/2 CRLF1_HUMAN Cytokine receptor-like factor 1

8d82[2] G 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/100.0 1
/1 IL6RA_HUMAN Soluble interleukin-6 receptor subunit alpha

8qy4[2] I 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. E 40.0
/31.7 5
/5 I11RA_HUMAN Interleukin-11 receptor subunit alpha

8qy4[2] J 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. E 0.0
/31.7 5
/5 I11RA_HUMAN Interleukin-11 receptor subunit alpha

8qy5[4] J 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 0.0
/26.1 4
/4 IL6RB_MOUSE Interleukin-6 receptor subunit beta

8qy5[4] K 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 0.0
/26.1 5
/5 IL6RB_MOUSE Interleukin-6 receptor subunit beta

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

HOMO

468 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

1n26[1] A IL6A_HUMAN IL-6 Receptor alpha chain[299 aa] A 100.0
/100.0 11
/11 IL6A_HUMAN IL-6 Receptor alpha chain

1n26[1] A IL6A_HUMAN IL-6 Receptor alpha chain[299 aa] A 100.0
/100.0 15
/15 IL6A_HUMAN IL-6 Receptor alpha chain

8iow[1] B IL6RA_HUMAN Interleukin-6 receptor subunit alpha[14 aa] A 100.0
/100.0 8
/8 IL6RA_HUMAN Interleukin-6 receptor subunit alpha

1bqu[1] B IL6RB_HUMAN PROTEIN (GP130)[215 aa] A 33.3
/30.2 9
/9 IL6RB_HUMAN PROTEIN (GP130)

1bqu[1] A IL6RB_HUMAN PROTEIN (GP130)[208 aa] B 20.0
/29.9 10
/11 IL6RB_HUMAN PROTEIN (GP130)

8d7h[2] F CRLF1_HUMAN Cytokine receptor-like factor 1[303 aa] C 40.0
/29.6 5
/6 CRLF1_HUMAN Cytokine receptor-like factor 1

3npz[2] C PRLR_RAT Prolactin receptor[199 aa] B 15.4
/25.7 13
/14 PRLR_RAT Prolactin receptor

3ew3[1] C PRLR_RAT Prolactin receptor[181 aa] B 10.0
/25.4 10
/11 PRLR_RAT Prolactin receptor

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

PRECIPITANT

468 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

1bqu[3] C SO4
SULFATE ION[5 atoms] A 0.0
/30.2 4
/4 IL6RB_HUMAN PROTEIN (GP130)

1bqu[9] E SO4
SULFATE ION[5 atoms] A 100.0
/30.2 2
/2 IL6RB_HUMAN PROTEIN (GP130)

1bqu[1] I SO4
SULFATE ION[5 atoms] B 0.0
/29.9 2
/2 IL6RB_HUMAN PROTEIN (GP130)

1bqu[3] J SO4
SULFATE ION[5 atoms] B 0.0
/29.9 3
/3 IL6RB_HUMAN PROTEIN (GP130)

1n26[2] F SO4
SULFATE ION[5 atoms] A 100.0
/100.0 3
/3 IL6A_HUMAN IL-6 Receptor alpha chain

1n26[2] G SO4
SULFATE ION[5 atoms] A 100.0
/100.0 3
/3 IL6A_HUMAN IL-6 Receptor alpha chain

3l5h[1] I SO4
SULFATE ION[5 atoms] A 0.0
/28.8 1
/1 IL6RB_HUMAN Interleukin-6 receptor subunit beta

3l5h[1] J SO4
SULFATE ION[5 atoms] A 0.0
/28.8 1
/1 IL6RB_HUMAN Interleukin-6 receptor subunit beta

6o4p[1] I SO4
SULFATE ION[5 atoms] A 0.0
/35.0 1
/3 I11RA_HUMAN Interleukin-11 receptor subunit alpha

6o4p[2] J SO4
SULFATE ION[5 atoms] A 33.3
/35.0 3
/3 I11RA_HUMAN Interleukin-11 receptor subunit alpha

6o4p[1] L SO4
SULFATE ION[5 atoms] B 0.0
/35.4 2
/2 I11RA_HUMAN Interleukin-11 receptor subunit alpha

6o4p[1] M SO4
SULFATE ION[5 atoms] B 0.0
/35.4 3
/3 I11RA_HUMAN Interleukin-11 receptor subunit alpha

6o4p[1] P SO4
SULFATE ION[5 atoms] B 0.0
/35.4 1
/1 I11RA_HUMAN Interleukin-11 receptor subunit alpha

3d87[2] E PO4
PHOSPHATE ION[5 atoms] B 50.0
/28.8 2
/2 IL12B_HUMAN Interleukin-12 subunit p40

8upa[1] G PO4
PHOSPHATE ION[5 atoms] B 0.0
/29.9 3
/4 IL6RB_HUMAN Interleukin-6 receptor subunit beta

5mj3[1] G PGE
TRIETHYLENE GLYCOL[10 atoms] A 75.0
/28.3 4
/4 IL12B_HUMAN Interleukin-12 subunit beta

1bqu[1] F GOL
GLYCEROL[6 atoms] A 50.0
/30.2 6
/6 IL6RB_HUMAN PROTEIN (GP130)

1bqu[2] G GOL
GLYCEROL[6 atoms] A 25.0
/30.2 8
/8 IL6RB_HUMAN PROTEIN (GP130)

1bqu[1] L GOL
GLYCEROL[6 atoms] B 50.0
/29.9 6
/6 IL6RB_HUMAN PROTEIN (GP130)

1bqu[1] M GOL
GLYCEROL[6 atoms] B 25.0
/29.9 4
/4 IL6RB_HUMAN PROTEIN (GP130)

4i18[1] K GOL
GLYCEROL[6 atoms] E 83.3
/24.9 6
/6 PRLR_HUMAN Prolactin receptor

4i18[1] L ACT
ACETATE ION[4 atoms] E 0.0
/24.9 2
/2 PRLR_HUMAN Prolactin receptor

3d48[1] D CO3
CARBONATE ION[4 atoms] B 50.0
/25.1 2
/2 PRLR_HUMAN Prolactin receptor

3d48[1] E CO3
CARBONATE ION[4 atoms] B 75.0
/25.1 4
/4 PRLR_HUMAN Prolactin receptor

3d48[1] F CO3
CARBONATE ION[4 atoms] B 12.5
/25.1 8
/8 PRLR_HUMAN Prolactin receptor

3ncc[1] G CO3
CARBONATE ION[4 atoms] B 0.0
/24.7 2
/2 PRLR_HUMAN Prolactin receptor

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

MONOMER
468
	pdb_id	a¹	identity[%]²	description
	1n26	A	100.0	IL6A_HUMAN IL-6 Receptor alpha chain
	1.a¹:asym_id for the homologue. 2.identity[%]²:sequence identity between the query and the homologue.

Contact Molecules for Homologous Proteins

Summary Bars[0.0 %]

UniProt Feature Tables [P08887(IL6RA_HUMAN)]