Contact Molecules for Homologous Proteins | ||||
![]() [Full Bars] |
![]() [SiteTable] |
|
![]() [Back to Search Page] |
![]() [Back to HOMCOS] |
![]() [SupCon3D] |
![]() [help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | ![]() [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
9058 | 422 | 14 | P59595(NCAP_SARS) | RecName: Full=Nucleoprotein ;AltName: Full=Nucleocapsid protein ; Short=NC ; Short=Protein N ; |
QUERYSEQ |
MSDNGPQSNQRSAPRITFGGPTDSTDNNQNGGRNGARPKQRRPQGLPNNTASWFTALTQHGKEELRFPRGQGVPINTNSGPDDQIGYYRRATRRVRGGDGKMKELSPRWYFYYLGTGPEASLPYGANKEGIVWVATEGALNTPKDHIGTR NPNNNAATVLQLPQGTTLPKGFYAEGSRGGSQASSRSSSRSRGNSRNSTPGSSRGNSPARMASGGGETALALLLLDRLNQLESKVSGKGQQQQGQTVTKKSAAEASKKPRQKRTATKQYNVTQAFGRRGPEQTQGNFGDQDLIRQGTDYK HWPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYHGAIKLDDKDPQFKDNVILLNKHIDAYKTFPPTEPKKDKKKKTDEAQPLPQRQKKQPTVTLLPAADMDDFSRQLQNSMSGASADSTQA |
422 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
region | name | description |
![]() |
1-422 | CHAIN | /note="Nucleoprotein" /id="PRO_0000106003" |
![]() ![]() ![]() |
49-176 | DOMAIN | /note="CoV N NTD" |
![]() ![]() ![]() |
248-365 | DOMAIN | /note="CoV N CTD" |
![]() ![]() |
1-52 | REGION | /note="Disordered" |
![]() ![]() ![]() |
42-187 | REGION | /note="RNA-binding" |
![]() ![]() ![]() |
45-181 | REGION | /note="RNA-binding" |
![]() ![]() ![]() |
167-214 | REGION | /note="Disordered" |
![]() ![]() ![]() |
177-204 | REGION | /note="SR region" |
![]() ![]() ![]() |
234-287 | REGION | /note="Disordered" |
![]() ![]() ![]() |
259-362 | REGION | /note="Dimerization" |
![]() ![]() |
362-422 | REGION | /note="Disordered" |
![]() ![]() |
1-35 | COMPBIAS | /note="Polar residues" |
![]() ![]() ![]() |
178-209 | COMPBIAS | /note="Polar residues" |
![]() ![]() ![]() |
234-252 | COMPBIAS | /note="Polar residues" |
![]() ![]() ![]() |
265-287 | COMPBIAS | /note="Polar residues" |
![]() ![]() ![]() |
363-383 | COMPBIAS | /note="Basic and acidic residues" |
![]() ![]() |
404-422 | COMPBIAS | /note="Polar residues" |
![]() ![]() ![]() |
93-93 | BINDING | /ligand="RNA" /ligand_id="ChEBI:CHEBI:33697" |
![]() ![]() ![]() |
108-108 | BINDING | /ligand="RNA" /ligand_id="ChEBI:CHEBI:33697" |
![]() ![]() ![]() |
150-150 | BINDING | /ligand="RNA" /ligand_id="ChEBI:CHEBI:33697" |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
1-422 | DISORDER | predicted by DISOPRED |
![]() |
|||||||
422 | |||||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
pdb_id | a1 | identity[%]2 | description | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | 100.0 | NCAP_CVHSA Nucleocapsid protein | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 100.0 | NCAP_CVHSA Nucleocapsid protein | |||
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue. |
![]() |
|||||||
422 | pdb_id | contact mol | homologue | ||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
a3 | description | a4 | identity[%]5 | Ncon6 | description | |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | NCAP_CVHSA NUCLEOCAPSID PROTEIN[113 aa] | A | 100.0 /100.0 |
52 /52 |
NCAP_CVHSA NUCLEOCAPSID PROTEIN |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | NCAP_CVHSA Nucleocapsid protein[97 aa] | A | 100.0 /100.0 |
8 /8 |
NCAP_CVHSA Nucleocapsid protein |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | NCAP_CVHSA Nucleocapsid protein[97 aa] | A | 100.0 /100.0 |
6 /6 |
NCAP_CVHSA Nucleocapsid protein |
![]() ![]() ![]() ![]() ![]() |
![]() |
B | NCAP_CVHSA Nucleocapsid protein[96 aa] | A | 100.0 /100.0 |
1 /1 |
NCAP_CVHSA Nucleocapsid protein |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | NCAP_CVHSA Nucleocapsid protein[97 aa] | B | 100.0 /100.0 |
3 /3 |
NCAP_CVHSA Nucleocapsid protein |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
![]() |
|||||||
422 | pdb_id | contact mol | homologue | ||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
a3 | description | a4 | identity[%]5 | Ncon6 | description | |
![]() ![]() ![]() ![]() ![]() |
![]() |
C |
SO4
|
A | 100.0 /100.0 |
2 /2 |
NCAP_CVHSA Nucleocapsid protein |
![]() ![]() ![]() ![]() ![]() |
![]() |
B |
EDO
|
A | 100.0 /100.0 |
2 /2 |
NCAP_CVHSA Nucleocapsid protein |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. |